HHsearch results for GI: 254780680 and protein with PDBid: 1hc7_A

>1hc7_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP + L-proline + tRNA(Pro) AMP + PPI + L-prolyl-tRNA(Pro); 2.43A {Thermus thermophilus} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1h4q_A* 1h4t_A 1h4s_A
Probab=99.92  E-value=8.8e-25  Score=203.28  Aligned_cols=267  Identities=20%  Similarity=0.214  Sum_probs=230.9

Q ss_pred             CCCCCCCCCCCC--CHHHHCCCCCHHHHHHHCCCCCEEECCHHHHHHHHHHHHHHHHHHHHCCCCEEHHHHHCCHHHHHH
Q ss_conf             656656662112--202211731000112221675301056488999999999998622320320212356202788986
Q gi|254780680|r  131 KPSAIHLSREHF--EIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYG  208 (430)
Q Consensus       131 ~~~f~f~~k~H~--elge~l~liDfe~a~kvsGsrF~~Lkg~~A~Le~ALi~y~ld~~~~~~Gy~~v~~P~lv~~~~~~g  208 (430)
                      +++.+|   +.|  +|..+-+++|..   .|  +|+|++.-.|.++-+.|.+|+-+. ..+.||.+|.+|.++..+.+..
T Consensus         9 ~~~~~f---~~wy~~~~~~a~l~d~~---~i--~G~~~~lP~G~~i~~~i~~~i~~~-~~~~G~~ev~~P~li~~~~l~k   79 (477)
T 1hc7_A            9 PQSQDF---SEWYLEVIQKAELADYG---PV--RGTIVVRPYGYAIWENIQQVLDRM-FKETGHQNAYFPLFIPMSFLRK   79 (477)
T ss_dssp             CHHHHH---HHHHHHHHHHTTSEEEC---SS--TTCEEECHHHHHHHHHHHHHHHHH-HHHTTCEECBCCSEEESTTC--
T ss_pred             CCCCCC---HHHHHHHHHHCCCCCCC---CC--CCEEEECCCHHHHHHHHHHHHHHH-HHHCCCEEEECCCCCCHHHHHH
T ss_conf             853361---48999999970774147---88--962888855999999999999999-9985997998966157899998


Q ss_pred             -HHHCHHHHHHHHHHH--------HCCEECCCCCCHHHHHHHHHCCCHHHHCCEEEEEECCCCCCCCCCCCCCCCEEEEE
Q ss_conf             -551422476776431--------00023134541145445342059555042088532210788433554343212222
Q gi|254780680|r  209 -TGQIPKFADDMFCTT--------DGRWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQH  279 (430)
Q Consensus       209 -tG~lp~f~~~~y~~~--------d~l~Li~TaEvpL~~~~~~~~l~~~~LPik~~~~s~cfR~EaGs~GkdtrGl~RvH  279 (430)
                       .|++..|.++||.+.        +.++|-||+|...+.+|++.+.++.+||+|+..+++|||-|.-     ++|++|+-
T Consensus        80 ~sgh~~~f~~emf~v~~~~~~~~~e~~~LrPt~e~~~~~~~~~~i~SyrdLPlrl~q~~~~fR~E~~-----~~gllR~R  154 (477)
T 1hc7_A           80 EAEHVEGFSPELAVVTHAGGEELEEPLAVRPTSETVIGYMWSKWIRSWRDLPQLLNQWGNVVRWEMR-----TRPFLRTS  154 (477)
T ss_dssp             -------CCTTCEEEEEESSSEEEEEEEECSCSHHHHHHHHHHHCCBGGGCCEEEEEEEEEECCCSS-----CBTTTBCS
T ss_pred             HHCCHHHCCCCEEEEECCCCHHHCCCCCCCCCCCHHHHHHHHCCCCCCCCCCHHHHHCCCCEECCCC-----CCCCCEEE
T ss_conf             8676413175607885168411024314689766889999962355202488888615301000246-----77753489


Q ss_pred             EEEEEEEEE-CCCCCCHHHHHHHHHHHHHHHHHHHCCHHHHCCCCC-HHCCCHHHEEEEEEEECCCCCCEEEEEEECCCC
Q ss_conf             102002121-278650145789899999999998410675303780-117844340241011010048332375310210
Q gi|254780680|r  280 QFWKCELVS-ITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCT-GDLGFSACKTYDLEVWLAGQNLYREISSCSTCG  357 (430)
Q Consensus       280 QF~KVE~~~-~~~pe~S~~~~e~~~~~~~~i~~~L~lpyRvv~~~s-gdlg~~a~~~~DiE~w~P~~~~y~Ev~S~Snc~  357 (430)
                      +|.--|... +|+++++.++++.+++....++..|..++.++-..+ .+-++.+..++++|+.+|. ++..+++.+.+++
T Consensus       155 eF~~~D~ht~~~t~e~a~~~~~~~~~~y~~~~~~~~~~~~~~g~~~~~e~~~ga~~~~~ie~~~~~-Gr~~q~gt~~~lg  233 (477)
T 1hc7_A          155 EFLWQEGHTAHATREEAEEEVRRMLSIYARLAREYAAIPVIEGLKTEKEKFAGAVYTTTIEALMKD-GKALQAGTSHYLG  233 (477)
T ss_dssp             EEEEEEEEEEESSHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCTTTSCTTSSEEEEEEEECTT-SCEEEEEEEEEEE
T ss_pred             EEEEEEHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHEEECCCCCCCCCCCCCCCCHHHHHHHC-CHHHHCCCEEECC
T ss_conf             998751244422388889999999999999976431111120565455454463434134676644-5044327333034


Q ss_pred             CHHHHHCCCEEECCCCCCCCEEEEEC-CCHHHHHHHHHHHHHHCCCCCCCEECCCCCCCCC
Q ss_conf             07645326847338998410104200-4322899999999883468998386582223101
Q gi|254780680|r  358 NFQSRRMNSRYRDPNSKSLKFTHTLN-GSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM  417 (430)
Q Consensus       358 D~QsrRl~iry~~~~~~~~~~~htlN-gt~~A~~R~l~ailEn~q~~dg~i~iP~~L~pym  417 (430)
                      .-.|++.++.|.+++|+ .+++|+-. |++   .|+|+|++|.|-..+| ++.|..|-|+=
T Consensus       234 ~~fs~~f~i~y~d~~g~-~~~~~~~~~Gi~---~R~i~alie~h~d~~G-l~lP~~lAP~Q  289 (477)
T 1hc7_A          234 ENFARAFDIKFQDRDLQ-VKYVHTTSWGLS---WRFIGAIIMTHGDDRG-LVLPPRLAPIQ  289 (477)
T ss_dssp             THHHHHTTCEEECTTSC-EEECEEEEEEEE---THHHHHHHHHHCBTTB-CCCCTTTCSCS
T ss_pred             CCHHHHCCCEEECCCCC-EEEEEEEECCCC---HHHHHHHHHHHCCCCC-CCCCHHCCCCE
T ss_conf             30456526556435784-333566640441---6789999998326767-42480028405