HHsearch results for GI: 254780680 and protein with PDBid: 1htt_A

>1htt_A Histidyl-tRNA synthetase; complex (tRNA synthetase/His-adenylate), aminoacyl-tRNA synthase, ligase; HET: HIS AMP; 2.60A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1kmm_A* 1kmn_A* 2el9_A*
Probab=98.69  E-value=1.3e-07  Score=75.64  Aligned_cols=149  Identities=13%  Similarity=0.167  Sum_probs=117.5

Q ss_pred             CCCEEECCHHHHHHHHHHHHHHHHHHHHCCCCEEHHHHHCCHHHHHHHH--HCHHHHHHHHHHH----HCCEECCCCCCH
Q ss_conf             7530105648899999999999862232032021235620278898655--1422476776431----000231345411
Q gi|254780680|r  162 ARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTG--QIPKFADDMFCTT----DGRWLIPTSEVS  235 (430)
Q Consensus       162 srF~~Lkg~~A~Le~ALi~y~ld~~~~~~Gy~~v~~P~lv~~~~~~gtG--~lp~f~~~~y~~~----d~l~Li~TaEvp  235 (430)
                      .||+.+-..++++-+.|++++.+. ..++||++|.||.|-..+++...|  ..+...++||...    +.+.|-|-..+|
T Consensus         8 ~G~~d~lP~g~~~~~~l~~~ir~~-~~~~Gy~eI~tP~le~~dl~~~s~g~~~d~~~~~m~~~~d~~g~~l~Lrpd~t~~   86 (423)
T 1htt_A            8 RGMNDYLPGETAIWQRIEGTLKNV-LGSYGYSEIRLPIVEQTPLFKRAIGEVTDVVEKEMYTFEDRNGDSLTLRPEGTAG   86 (423)
T ss_dssp             TTCCCBCHHHHHHHHHHHHHHHHH-HHTTTCEECBCCSEEEHHHHHHHHCSSSHHHHHTCEEEECTTSCEEEECSCSHHH
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHH-HHHCCCEEEECCCCCCHHHHHHCCCCCCCCCHHHCCCEECCCCCEECCCCCCCHH
T ss_conf             998755988999999999999999-9986997999852041999843368510000032032044899876048888578


Q ss_pred             HHHHHHHHCCCHHHHCCEEEEEECCCCCCCCCCCCCCCCEEEEEEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             45445342059555042088532210788433554343212222102002121278650145789899999999998410
Q gi|254780680|r  236 LTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDL  315 (430)
Q Consensus       236 L~~~~~~~~l~~~~LPik~~~~s~cfR~EaGs~GkdtrGl~RvHQF~KVE~~~~~~pe~S~~~~e~~~~~~~~i~~~L~l  315 (430)
                      ++-+++..- ....+|+|++-++++||.|...     +|.+|.+...=+|++....++    .-.+++..+.+++..+++
T Consensus        87 i~r~~~~~~-~~~~~p~r~~y~g~v~R~~~~~-----~g~~re~~q~~~e~~g~~~~~----~d~e~i~~~~~~l~~~~~  156 (423)
T 1htt_A           87 CVRAGIEHG-LLYNQEQRLWYIGPMFRHERPQ-----KGRYRQFHQLGCEVFGLQGPD----IDAELIMLTARWWRALGI  156 (423)
T ss_dssp             HHHHHHHHT-CSTTCCEEEEEEEEEECCCCCC-----SSCCSEEEEEEEEEESCCSHH----HHHHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHH-HHCCCCEEEEEECCEEEECCCC-----CCCEEEEEEECCHHCCCCHHH----HHHHHHHHHHHHHHHHCC
T ss_conf             799998644-2237985899854178832688-----886257766042120540678----889999999999987234


Q ss_pred             HHHHCC
Q ss_conf             675303
Q gi|254780680|r  316 HYRVVS  321 (430)
Q Consensus       316 pyRvv~  321 (430)
                      ....+.
T Consensus       157 ~~~~~~  162 (423)
T 1htt_A          157 SEHVTL  162 (423)
T ss_dssp             GGGCEE
T ss_pred             CCCEEE
T ss_conf             431266