HHsearch results for GI: 254780680 and protein with PDBid: 1m1j_B

>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B*
Probab=95.58  E-value=0.048  Score=34.32  Aligned_cols=42  Identities=17%  Similarity=0.191  Sum_probs=22.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             799999999999998864446666677888774431002258
Q gi|254780680|r   68 SLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVP  109 (430)
Q Consensus        68 ~~~~~Lk~e~~~Lk~eik~le~~~~~le~el~~lll~IPNi~  109 (430)
                      +.+..|.....++..+|+.+++++..+++.+........+++
T Consensus       168 ~qi~~Lq~~l~elq~kIq~LE~qI~q~~ek~~~~~~~~~~~~  209 (464)
T 1m1j_B          168 SSLRVLRAVIDSLHKKIQKLENAIATQTDYCRSPCVASCNIP  209 (464)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSBCEECCCEE
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             999999999999999999999999878875056654455457