HHsearch results for GI: 254780680 and protein with PDBid: 1nj1_A

>1nj1_A Proline-tRNA synthetase, proline--tRNA ligase; protein-aminoacyladenylate complex class-II tRNA synthetase; HET: 5CA; 2.55A {Methanothermobacterthermautotrophicus} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1nj2_A 1nj5_A* 1nj6_A*
Probab=100.00  E-value=3.1e-35  Score=280.96  Aligned_cols=293  Identities=18%  Similarity=0.232  Sum_probs=251.6

Q ss_pred             HHCCCCCCCHHHHCCCCCCCEEEEEECCCCCCCCCCCCCCCHHHHCCCCCHHHHHHHCCCCCEEECCHHHHHHHHHHHHH
Q ss_conf             10022588112211355540242000156566566621122022117310001122216753010564889999999999
Q gi|254780680|r  103 SCIPNVPLEEVPIGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQFM  182 (430)
Q Consensus       103 l~IPNi~~~~VP~G~de~dNv~i~~~G~~~~f~f~~k~H~elge~l~liDfe~a~kvsGsrF~~Lkg~~A~Le~ALi~y~  182 (430)
                      -.+||.+|-..|.++.+.     +..|++.. +|. .=+.+|.++.+|+|+..+++    |++++...|+++.++|.+|+
T Consensus        13 ~~~~~~~~~~~~~~~~~~-----r~~~~~~~-~f~-~w~~~~~~~a~l~d~~~~vk----G~~~~lP~G~~i~~~i~~~~   81 (501)
T 1nj1_A           13 GLVPRGSHMQKPIKKDPN-----RYHGEKMT-EFS-EWFHNILEEAEIIDQRYPVK----GMHVWMPHGFMIRKNTLKIL   81 (501)
T ss_dssp             --------------------------------CHH-HHHHHHHHHTTCEECCCSST----TCCEECHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCCCC-----CCCCCCHH-HHH-HHHHHHHHHCCCCCCCCCCC----EEEEECCCHHHHHHHHHHHH
T ss_conf             406688743455566755-----35577455-516-99999999708823389997----15997703999999999999


Q ss_pred             HHHHHHHCCCCEEHHHHHCCHH-HHHHHHHCHHHHHHHHHHH--------HCCEECCCCCCHHHHHHHHHCCCHHHHCCE
Q ss_conf             9862232032021235620278-8986551422476776431--------000231345411454453420595550420
Q gi|254780680|r  183 IDLHTSEHGYTEVSAPLLVRDE-AMYGTGQIPKFADDMFCTT--------DGRWLIPTSEVSLTNLYSHEIIESKSLPLR  253 (430)
Q Consensus       183 ld~~~~~~Gy~~v~~P~lv~~~-~~~gtG~lp~f~~~~y~~~--------d~l~Li~TaEvpL~~~~~~~~l~~~~LPik  253 (430)
                      -+. . ++||.+|.+|.++..+ ....+|+++.|.++||.+.        ++++|.||+|.+++.+|++.+..+.+||+|
T Consensus        82 r~~-~-~~G~~ev~tP~l~~~~~L~~~SGh~~~f~eemf~v~~~~~~~~~~~~~LrPt~e~~~~~~~~~~~~SyrdLPlr  159 (501)
T 1nj1_A           82 RRI-L-DRDHEEVLFPLLVPEDELAKEAIHVKGFEDEVYWVTHGGLSKLQRKLALRPTSETVMYPMFALWVRSHTDLPMR  159 (501)
T ss_dssp             HHH-H-TTTCEECCCCSEEEHHHHTTSHHHHHHTTTTCCEEEEETTEEEEEEEEECSSSHHHHHHHHHHHCCBTTTCCEE
T ss_pred             HHH-H-HCCCEEEECCCCCCHHHHHHHHCCCCCCCCCCEEEECCCCCCCCCEEEEECCCCHHHHHHHHHHCCCCCCCCEE
T ss_conf             999-9-85998997886405789866645655446477278416754567606871378888999996320136679868


Q ss_pred             EEEEECCCCCCCCCCCCCCCCEEEEEEEEEEEE--EECCCCCCHHHHHHHHHHHHHHHHHHHCCHHHHCCCCCHHCCCHH
Q ss_conf             885322107884335543432122221020021--212786501457898999999999984106753037801178443
Q gi|254780680|r  254 FTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCEL--VSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSA  331 (430)
Q Consensus       254 ~~~~s~cfR~EaGs~GkdtrGl~RvHQF~KVE~--~~~~~pe~S~~~~e~~~~~~~~i~~~L~lpyRvv~~~sgdlg~~a  331 (430)
                      ++.+++|||.|.+.    ++||+|++||+.++.  +..|+|+++++++..|+....++|+.|++||++...+.+|....+
T Consensus       160 i~q~g~~fR~E~~~----~~gllR~REF~q~ed~~~~~~~~e~~~~e~~~~~~~y~~~~~~l~i~~~~~~~~~~d~~~ga  235 (501)
T 1nj1_A          160 FYQVVNTFRYETKH----TRPLIRVREITTFKEAHTIHATASEAEEQVERAVEIYKEFFNSLGIPYLITRRPPWDKFPGS  235 (501)
T ss_dssp             EEEEEEEECCCCSC----CBTTTBCSEEEEEEEEEEEESSHHHHHHHHHHHHHHHHHHHHHHTCCCEEEECCTTTSCTTC
T ss_pred             EEEECHHHCCCCCC----CCCCEEEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCCCCC
T ss_conf             88762121254001----57706999999850003467998999999999999999998641513011012465545562


Q ss_pred             HEEEEEEEECCCCCCEEEEEEECCCCCHHHHHCCCEEECCCCCCCCEEEEECCCHHHHHHHHHHHHHHCCCCCCCEECCC
Q ss_conf             40241011010048332375310210076453268473389984101042004322899999999883468998386582
Q gi|254780680|r  332 CKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPT  411 (430)
Q Consensus       332 ~~~~DiE~w~P~~~~y~Ev~S~Snc~D~QsrRl~iry~~~~~~~~~~~htlNgt~~A~~R~l~ailEn~q~~dg~i~iP~  411 (430)
                      ..++++|+|+|. +...|++++.++++..+++.++.|.+.+|+ ..++|+..-  -...|++.+++|.|...+| ..+|-
T Consensus       236 ~~~~~~e~~~~~-G~~iev~t~~~Lg~~~s~~f~i~y~d~~g~-~~~v~~~~~--G~~~R~i~~lie~~~d~~g-l~lP~  310 (501)
T 1nj1_A          236 EYTVAFDTLMPD-GKTLQIGTVHNLGQTFARTFEIKFETPEGD-HEYVHQTCY--GLSDRVIASVIAIHGDESG-LCLPP  310 (501)
T ss_dssp             SEEEEEEEECTT-SCEEEEEEEEEEETHHHHHHTCEEECTTSC-EEECEEEEE--EECTHHHHHHHHHTCCSSS-EECCT
T ss_pred             HHHCCHHHHHCC-CCCEEEECEECCCCHHHHHCCCCCCCCCCC-CEEEECCCH--HHHHHHHHHHHHHHHHCCC-CEECC
T ss_conf             320000122203-760157330105545767503430245686-302201101--2544364787766213038-53262


Q ss_pred             CCCCCC
Q ss_conf             223101
Q gi|254780680|r  412 VLRPYM  417 (430)
Q Consensus       412 ~L~pym  417 (430)
                      .|-|+=
T Consensus       311 ~lAP~q  316 (501)
T 1nj1_A          311 DVAAHQ  316 (501)
T ss_dssp             TTSSCS
T ss_pred             CCCCEE
T ss_conf             117614