HHsearch results for GI: 254780680 and protein with PDBid: 1wyd_A

>1wyd_A Hypothetical aspartyl-tRNA synthetase; archaea, ligase; HET: EPE; 2.30A {Sulfolobus tokodaii str}
Probab=96.37  E-value=0.0037  Score=42.57  Aligned_cols=112  Identities=18%  Similarity=0.342  Sum_probs=63.2

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEHHHHHCCHHHHHHHHHCHHHHHHHHHHHHCCEECCCCCCHHHHHHHHHCCCHHHHC
Q ss_conf             89999999999986223203202123562027889865514224767764310002313454114544534205955504
Q gi|254780680|r  172 AHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLYSHEIIESKSLP  251 (430)
Q Consensus       172 A~Le~ALi~y~ld~~~~~~Gy~~v~~P~lv~~~~~~gtG~lp~f~~~~y~~~d~l~Li~TaEvpL~~~~~~~~l~~~~LP  251 (430)
                      -++--++++..-++ ..++||++|.||.|+...+ +|.+..  |.-  ..-+.+.||.-..|     +| .+.+- .-++
T Consensus       134 ~r~Rs~i~~~iR~f-~~~~gf~EV~TP~L~~~~~-~g~a~~--f~~--~~~~~~~~L~~Spe-----l~-K~l~~-~g~~  200 (429)
T 1wyd_A          134 IKIQSLALKAFRET-LYKEGFIEIFTPKIIASAT-EGGAQL--FPV--IYFGKEAFLAQSPQ-----LY-KELMA-GVVE  200 (429)
T ss_dssp             HHHHHHHHHHHHHH-HHHTTCEECCCCSEESSCS-STTCCC--CEE--EETTEEEEECSCCH-----HH-HHHHH-HHHS
T ss_pred             HHHHHHHHHHHHHH-HHHCCCEEECCCCCCCCCC-CCCCCC--CCE--EECCCCCEECCCHH-----HH-HHHHH-HHHC
T ss_conf             99999999999987-7743855533864346667-642234--410--51597724303899-----88-88865-3110


Q ss_pred             CEEEEEECCCCCCCCCCCCCCCCEEEEEEEEEEEEEE-CCCCCCHHHHHHHHH
Q ss_conf             2088532210788433554343212222102002121-278650145789899
Q gi|254780680|r  252 LRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVS-ITREEDSFTEHERML  303 (430)
Q Consensus       252 ik~~~~s~cfR~EaGs~GkdtrGl~RvHQF~KVE~~~-~~~pe~S~~~~e~~~  303 (430)
                       |+..+++|||.|-+.    ++  ...-+|+.+|... +.+-++.....|.|+
T Consensus       201 -rvf~i~~~FR~E~~~----~~--rH~pEFtmlE~y~a~~d~~~~m~~~E~l~  246 (429)
T 1wyd_A          201 -RVFEVAPAWRAEESD----TP--FHLAEFISMDVEMAFADYNDVMQLLEKIL  246 (429)
T ss_dssp             -EEEEEEEEECCCCCC----SS--SCCSEEEEEEEEEETCCHHHHHHHHHHHH
T ss_pred             -CEEEEECCCCCCCCC----CC--CCCCCCCCEEEEHHHHHHHHHHHHHHHHH
T ss_conf             -006750320036787----64--34566420220024455678899999999