HHsearch results for GI: 254780680 and protein with PDBid: 2du3_A

>2du3_A O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase/RNA complex; HET: SEP; 2.60A {Archaeoglobus fulgidus} PDB: 2du4_A 2du5_A* 2du6_A*
Probab=96.81  E-value=0.0028  Score=43.48  Aligned_cols=114  Identities=15%  Similarity=0.220  Sum_probs=73.0

Q ss_pred             HHHCCCHHHHCCEEEEEECCCCCC-CCCCCCCCCCEEEEEEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCH---
Q ss_conf             342059555042088532210788-4335543432122221020021212786501457898999999999984106---
Q gi|254780680|r  241 SHEIIESKSLPLRFTTLAPSFRSE-AGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLH---  316 (430)
Q Consensus       241 ~~~~l~~~~LPik~~~~s~cfR~E-aGs~GkdtrGl~RvHQF~KVE~~~~~~pe~S~~~~e~~~~~~~~i~~~L~lp---  316 (430)
                      ...+......|+|+++.++|||+| |-.+   |    +.++|+-+|-+++-+    .--+..+....+.+++.|+.+   
T Consensus       195 lr~l~~~~~~Piri~s~GrVyRrD~aiDa---t----H~~~FhQvEGlvVd~----~vs~~dLkg~L~~fl~~~f~~~~k  263 (534)
T 2du3_A          195 LSHIADKLPLPIKLFSIDRCFRREQGEDA---T----RLYTYFSASCVLVDE----ELSVDDGKAVAEALLRQFGFENFR  263 (534)
T ss_dssp             HHTTTTTSCSSEEEEEEEEEECCCTTCSS---S----CCSEEEEEEEEEECS----SCCHHHHHHHHHHHHGGGTCCEEE
T ss_pred             HHHHHHCCCCCEEEECCCCCCCCCCCCCC---C----CCCEEEEEEEEEECC----CCCHHHHHHHHHHHHHHHCCCCCE
T ss_conf             99997368998589615622235655654---3----174105710488669----888999999999999997687757


Q ss_pred             HHHCCCCCH-HCCCHHHEEEEEEEECCC--------CCCEEEEEEECCCCCHHHHHCCCEE
Q ss_conf             753037801-178443402410110100--------4833237531021007645326847
Q gi|254780680|r  317 YRVVSLCTG-DLGFSACKTYDLEVWLAG--------QNLYREISSCSTCGNFQSRRMNSRY  368 (430)
Q Consensus       317 yRvv~~~sg-dlg~~a~~~~DiE~w~P~--------~~~y~Ev~S~Snc~D~QsrRl~iry  368 (430)
                      +|..  ++- ---. -+-..|+.++.|+        .+.|.||.-|.-..----+.++|.|
T Consensus       264 ~R~r--psyFPFte-Ps~EvdV~~~~~~~~g~~~~~~~gWlEI~GcGmv~P~VL~~~GIdy  321 (534)
T 2du3_A          264 FRKD--EKRSKYYI-PDTQTEVFAFHPKLVGSSTKYSDGWIEIATFGIYSPTALAEYDIPY  321 (534)
T ss_dssp             EEEC--TTCCTTBC-TTTCEEEEEEEEEEETCSSSCTEEEEEEEEEEEBCHHHHHTTTCCS
T ss_pred             EEEC--CCCCCCCC-CCEEEEEEEEECCCCCCCCCCCCCEEEEECCCCCCHHHHHHCCCCC
T ss_conf             9746--88799999-9534799995058865555758966999677466878886469898