HHsearch results for GI: 254780680 and protein with PDBid: 3a32_A

>3a32_A Probable threonyl-tRNA synthetase 1; aeropyrum pernix K1, protein biosynthesis, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; 2.30A {Aeropyrum pernix} PDB: 3a31_A
Probab=99.78  E-value=7.1e-19  Score=159.38  Aligned_cols=269  Identities=16%  Similarity=0.168  Sum_probs=175.9

Q ss_pred             CCCCCCHHHHCCCCCH------HHH---HHHCCCCCEEECCHHHHHHHHHHHHHHHHHHHHCCCCEEHHHHHCCHHHHHH
Q ss_conf             6211220221173100------011---2221675301056488999999999998622320320212356202788986
Q gi|254780680|r  138 SREHFEIGEALGLMDF------DRA---TKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYG  208 (430)
Q Consensus       138 ~k~H~elge~l~liDf------e~a---~kvsGsrF~~Lkg~~A~Le~ALi~y~ld~~~~~~Gy~~v~~P~lv~~~~~~g  208 (430)
                      -|+|+++++.|++...      ..+   +..+|+|.|++.-.|+++-+.|.+|+-+.+ .+.||.+|.+|.|.+.+....
T Consensus         6 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~G~~~wlP~G~~v~~~ie~~ire~~-~~~G~~EV~tP~l~~~eLw~~   84 (471)
T 3a32_A            6 DKTHIDYAYELDITVKPDSRVPVFNREFATFTGAGVPLFSLGGGPIRYALAEVLAKFH-ARRGYYVVETPIIASTELFKV   84 (471)
T ss_dssp             -CCHHHHHHHTTSBCCTTSBCTTTCSBTHHHHCTTCCCBCTTHHHHHHHHHHHHHHHH-HHTTCEECCCCSEEETHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHCCCCCCCCCCCCCCCEECCCHHHHHHHHHHHHHHHH-HHCCCEEEECCEECCHHHHHH
T ss_conf             6689999997775347521112023446746448621371787999999999999999-986997998980677779877


Q ss_pred             HHHCHHHHHHHHHHH---HCCEECCCCCCHHHHHHHHHC---CCHHHHCCEEEEEECCCCCCCCCCCCCCCCEEEEEEEE
Q ss_conf             551422476776431---000231345411454453420---59555042088532210788433554343212222102
Q gi|254780680|r  209 TGQIPKFADDMFCTT---DGRWLIPTSEVSLTNLYSHEI---IESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFW  282 (430)
Q Consensus       209 tG~lp~f~~~~y~~~---d~l~Li~TaEvpL~~~~~~~~---l~~~~LPik~~~~s~cfR~EaGs~GkdtrGl~RvHQF~  282 (430)
                      +|++..|.++||..+   .+++|-||.+-+.+-+|.+.+   .++.+||+++.-+++|||-|...   -.-||+|+.+|.
T Consensus        85 SGh~d~~~e~Mf~~d~~~~e~~LrP~~~~~~~~~~~~~~~~~~Syk~LPlrlyqi~~~fR~E~~~---~r~gl~R~ReF~  161 (471)
T 3a32_A           85 SGHIEFYRNNMYLFDIEGHEFAVKPMNCPYHILLFLNEVAKHRSKLPLPFKVFEFGRVHRYEPSG---SIYGLLRVRGFT  161 (471)
T ss_dssp             TCCCTTGGGGSEEEEETTEEEEECSCSHHHHHHHHHHHHHHHGGGSCSSEEEEEEEEEECCCCGG---GCBTTTBCSEEE
T ss_pred             HCCHHHHCCCCEEEECCCCEEEECCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEECEEEECCCC---CCCCEEEEEEEE
T ss_conf             27753421266038508947975466870153675412413365335854687640458602256---742178876578


Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHHHH---HCCHHHHCCCCCH----------HCC---------------------
Q ss_conf             002121278650145789899999999998---4106753037801----------178---------------------
Q gi|254780680|r  283 KCELVSITREEDSFTEHERMLSCAEEILKR---LDLHYRVVSLCTG----------DLG---------------------  328 (430)
Q Consensus       283 KVE~~~~~~pe~S~~~~e~~~~~~~~i~~~---L~lpyRvv~~~sg----------dlg---------------------  328 (430)
                      .-+..+||.+++..++...........+..   +++....+.....          -+|                     
T Consensus       162 ~~da~sF~~~~q~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~l~~~~~  241 (471)
T 3a32_A          162 QDDAHIIVPGGRVIDVVYDVFEEMKLVLERLFKLGVSSETFKVRLSMSDKSLIGKEFMGSKEEWEGAEEALREAASRINE  241 (471)
T ss_dssp             EEEEEEEEEGGGHHHHHHHHHHHHHHHHHHTSCCCCSTTTEEEEEECCCGGGBTTTBCSCHHHHHHHHHHHHHHHHHHHH
T ss_pred             EECCEEEECCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             70657863717899999999999999999998607764201210013655555410058647678899999999986164


Q ss_pred             -----------CHHHEEEEEEEECCC----CCCEEEEEEECCCCCHHHHHCCCEEECCCCCCCCEEEEEC-CCHHHHHHH
Q ss_conf             -----------443402410110100----4833237531021007645326847338998410104200-432289999
Q gi|254780680|r  329 -----------FSACKTYDLEVWLAG----QNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLN-GSGVAVGRC  392 (430)
Q Consensus       329 -----------~~a~~~~DiE~w~P~----~~~y~Ev~S~Snc~D~QsrRl~iry~~~~~~~~~~~htlN-gt~~A~~R~  392 (430)
                                 ..+...-.++.+++.    .++-..++. ....-..+.|.++.|-+..+.+...++.+. |+.-.+.|+
T Consensus       242 ~~~~~~~~~~~~~~~~~~k~d~~~~~~~~~~gr~~~~~t-~~~~~~~~~~f~l~y~~~~~~~~~~p~~~~~~~~g~~~R~  320 (471)
T 3a32_A          242 KYGIDIVELEGEAAFYGPKLDFIMMVEESGVSKEWQMGT-IQFDFNLPRRFRLYDVVREEFGIEEVYIIHRALLGSIERF  320 (471)
T ss_dssp             HHCCEEEEETTCSBTTBCEEEEEEEEESSSCEEEEEEEE-EEEESSHHHHTTHHHHHHHHHCCSCEEEEEEEEEEEHHHH
T ss_pred             CCCCCEEECCCCCCCCCCCCCEEEECCCCCCCCEEECCE-EEEEECCHHHCCCEEEECCCCCEECEEEEEECCCCCHHHH
T ss_conf             545314752673224466511231013432242340434-5675013321687147506894634088851456626777


Q ss_pred             HHHHHHHCCCCCCCEECCCCCCCC
Q ss_conf             999988346899838658222310
Q gi|254780680|r  393 LIAILENYLNADGSVTIPTVLRPY  416 (430)
Q Consensus       393 l~ailEn~q~~dg~i~iP~~L~py  416 (430)
                      ++|++|+|.     ...|..|-||
T Consensus       321 ia~liE~~g-----~~lP~~LAP~  339 (471)
T 3a32_A          321 LGVYLEHRR-----GRMPFTLAPI  339 (471)
T ss_dssp             HHHHHHHTT-----TCCCGGGCSC
T ss_pred             HHHHHHHCC-----CCCCCCCCCC
T ss_conf             767898708-----9888643773