BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780680|ref|YP_003065093.1| seryl-tRNA synthetase
[Candidatus Liberibacter asiaticus str. psy62]
         (430 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780680|ref|YP_003065093.1| seryl-tRNA synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040357|gb|ACT57153.1| seryl-tRNA synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 430

 Score =  889 bits (2297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/430 (100%), Positives = 430/430 (100%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ
Sbjct: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN
Sbjct: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ
Sbjct: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY
Sbjct: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE
Sbjct: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ
Sbjct: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL
Sbjct: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420

Query: 421 AVIKKEHILE 430
           AVIKKEHILE
Sbjct: 421 AVIKKEHILE 430


>gi|315122209|ref|YP_004062698.1| seryl-tRNA synthetase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495611|gb|ADR52210.1| seryl-tRNA synthetase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 432

 Score =  728 bits (1879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/425 (80%), Positives = 385/425 (90%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQWIRQNP+  DIALKKR+LEPQSE ILSLD + R LI++IE IRA+RNS S QIGQ
Sbjct: 1   MLDIQWIRQNPDTFDIALKKRNLEPQSECILSLDTQYRSLIRQIEKIRAQRNSKSEQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           AIA+GNL L D +K E ST+KEQLP+LE +E+E+ SSL +++SCIPN+PLE+VPIG +  
Sbjct: 61  AIAKGNLLLADTIKAEVSTIKEQLPLLEAKENEIKSSLNQILSCIPNIPLEDVPIGANEK 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           ENILIRSVG KP+AIHLS+EHFEIGE LGLMDFDR+ KLSGARFS+L  HLA LERALGQ
Sbjct: 121 ENILIRSVGNKPNAIHLSKEHFEIGEELGLMDFDRSAKLSGARFSILASHLALLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHTSEHGYTEVSAPLLVRDEAMYGTGQ+PKFA+DMFCTTDGRWLIPTSEVSLTN++
Sbjct: 181 FMLDLHTSEHGYTEVSAPLLVRDEAMYGTGQLPKFANDMFCTTDGRWLIPTSEVSLTNIF 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           S+EII+   LPLR   LAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT+EE+S  EHE
Sbjct: 241 SNEIIDFNLLPLRLVALAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITKEEESHIEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RMLSCAE++LK+LDLHYR+VSLC+GDLGFSACKTYDLEVWL GQNLYREISSCS CG+FQ
Sbjct: 301 RMLSCAEKVLKKLDLHYRIVSLCSGDLGFSACKTYDLEVWLPGQNLYREISSCSNCGSFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           SRRMNSRYRD  +KSLKFTHTLNGSGVAVGRCLIAILENYLN DGSVTIPT+LRPYM+NL
Sbjct: 361 SRRMNSRYRDSFNKSLKFTHTLNGSGVAVGRCLIAILENYLNKDGSVTIPTILRPYMHNL 420

Query: 421 AVIKK 425
            VIKK
Sbjct: 421 EVIKK 425


>gi|159184878|ref|NP_354691.2| seryl-tRNA synthetase [Agrobacterium tumefaciens str. C58]
 gi|30173186|sp|Q8UEQ2|SYS_AGRT5 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|159140158|gb|AAK87476.2| seryl-tRNA synthetase [Agrobacterium tumefaciens str. C58]
          Length = 427

 Score =  608 bits (1569), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 277/425 (65%), Positives = 344/425 (80%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+WIR+NPE  D AL +R +EP +  +++LDEK R +I+ ++D+++RRN+ S +IG 
Sbjct: 1   MHDIKWIRENPEAFDAALARRSVEPAAAGLIALDEKRRSVIQSLQDMQSRRNAASKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ N+ L + LK E + +KE +P  E+E+ +V + L   +S +PN+P ++VP G   +
Sbjct: 61  AMAQKNMELAEKLKAEVADIKENMPRAEEEDRQVSAELNDALSRLPNMPFDDVPDGKDEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N++ R  G+KP   H ++EHFEIGEALG MDF+RA KLSG+RF+VLT  LA LERALGQ
Sbjct: 121 DNVVARVTGQKPGWNHAAKEHFEIGEALGYMDFERAAKLSGSRFTVLTSQLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMIDLHTSEHGYTEVS+PL+VRDEAM+GTGQ+PKFA+D+F TTDGRWLIPT+EV+LTNL 
Sbjct: 181 FMIDLHTSEHGYTEVSSPLMVRDEAMFGTGQLPKFAEDLFRTTDGRWLIPTAEVTLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           S EI+E + LPLRFT L PSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT  E +  EHE
Sbjct: 241 SGEILEQEKLPLRFTALTPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITDAESAVAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL LH+R ++LCTGD+GFSA KTYDLEVWL GQN YREISSCS CG+FQ
Sbjct: 301 RMTACAEEVLKRLGLHFRTLTLCTGDMGFSARKTYDLEVWLPGQNTYREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR  + K+ KF HTLNGSG AVGRCLIA+LENYLN DGSVTIP VL PYM  L
Sbjct: 361 ARRMNARYRGKDDKATKFVHTLNGSGTAVGRCLIAVLENYLNDDGSVTIPDVLLPYMGGL 420

Query: 421 AVIKK 425
             I+K
Sbjct: 421 TRIEK 425


>gi|325293088|ref|YP_004278952.1| Seryl-tRNA synthetase [Agrobacterium sp. H13-3]
 gi|325060941|gb|ADY64632.1| Seryl-tRNA synthetase [Agrobacterium sp. H13-3]
          Length = 427

 Score =  608 bits (1567), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 277/425 (65%), Positives = 343/425 (80%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+WIR+NPE  D AL +R  EP +  +++LDEK R +I+ ++D+++RRN+ S  IG 
Sbjct: 1   MHDIKWIRENPEAFDAALARRGAEPAASSLIALDEKRRSVIQSLQDMQSRRNAASKDIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ N+ L + LK E + +KE +P  E+E+ +V + L   +S +PN+P ++VP G   +
Sbjct: 61  AMAQKNMELAEKLKAEVADIKENMPRAEEEDRQVTAELNDALSRLPNIPFDDVPDGKDEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N++ R VG+KP   H ++EHFEIGEALG MDF+RA KLSG+RF+VLT  LA LERALGQ
Sbjct: 121 DNVVTRVVGQKPGWNHEAKEHFEIGEALGYMDFERAAKLSGSRFTVLTSQLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMIDLHTSEHGYTEVS+PL+VRDEAM+GTGQ+PKF++D+F TTDGRWLIPT+EV+LTNL 
Sbjct: 181 FMIDLHTSEHGYTEVSSPLMVRDEAMFGTGQLPKFSEDLFKTTDGRWLIPTAEVTLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           S EI+E + LPLRFT L PSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT  E +  EHE
Sbjct: 241 SGEILEQEKLPLRFTALTPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITDAESAVAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL LH+R ++LCTGD+GFSA KTYDLEVWL GQN YREISSCS CG+FQ
Sbjct: 301 RMTACAEEVLKRLGLHFRTMTLCTGDMGFSARKTYDLEVWLPGQNTYREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR  + K+ KF HTLNGSG AVGRCLIA+LENYLN DGSVTIP VL PYM  L
Sbjct: 361 ARRMNARYRGKDDKATKFVHTLNGSGTAVGRCLIAVLENYLNDDGSVTIPNVLLPYMGGL 420

Query: 421 AVIKK 425
             I+K
Sbjct: 421 KRIEK 425


>gi|222148967|ref|YP_002549924.1| seryl-tRNA synthetase [Agrobacterium vitis S4]
 gi|254782999|sp|B9JXD8|SYS_AGRVS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|221735953|gb|ACM36916.1| seryl-tRNA synthetase [Agrobacterium vitis S4]
          Length = 427

 Score =  608 bits (1567), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 275/425 (64%), Positives = 346/425 (81%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR  EP S+ +++LDE+ R +++ ++D+++RRNS S +IG 
Sbjct: 1   MLDIKWIRENPELLDQALAKRGAEPLSQSLIALDEQRRAVVQDMQDMQSRRNSASKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ +++L + LK E ++LK+ LP  E++E  + + L   +S IPN+PL++VP+G   +
Sbjct: 61  AMAQKDMALAEKLKAEVASLKDTLPAAEEDERRLSAELTDALSRIPNIPLDDVPVGADEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N++ R VG+KP   H + EH EIGEALG MDFDRA KLSGARF+VLTG LA LERALGQ
Sbjct: 121 DNVVARVVGQKPGWNHTAIEHPEIGEALGYMDFDRAAKLSGARFTVLTGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMIDLHTSEHGYTEVS+PL+VRDEAMYGTGQ+PKF++++F TTDGRWLIPT+EV+LTNL 
Sbjct: 181 FMIDLHTSEHGYTEVSSPLMVRDEAMYGTGQLPKFSEELFKTTDGRWLIPTAEVTLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           S EI++ + LPLRFT L PSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT  + +  EHE
Sbjct: 241 SGEILDQEKLPLRFTALTPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITDAQSALAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL LH+R ++LCTGD+GF A KTYDLEVWL GQN +REISSCS CG+FQ
Sbjct: 301 RMTACAEEVLKRLGLHFRTMTLCTGDMGFGAAKTYDLEVWLPGQNTFREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR+ + K   F HTLNGSG AVGRCLIA++ENYLN DGS+T+P VL PYM  L
Sbjct: 361 GRRMNARYRNKDGKGTTFVHTLNGSGTAVGRCLIAVMENYLNEDGSITVPDVLLPYMGGL 420

Query: 421 AVIKK 425
             I+K
Sbjct: 421 TRIEK 425


>gi|241204418|ref|YP_002975514.1| seryl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240858308|gb|ACS55975.1| seryl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 427

 Score =  601 bits (1549), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 277/425 (65%), Positives = 340/425 (80%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR  EP ++ +++LDEK R  ++K +D+ +RRN  S +IG 
Sbjct: 1   MLDIKWIRENPEALDAALAKRGAEPLAQSLVALDEKRRSAVQKAQDLLSRRNLASKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ N  L + LK E S LK  LP +E+E+ ++ + L   +S IPN+P ++VP+G   +
Sbjct: 61  AMAQKNGELAEKLKAEVSELKTLLPAIEEEDRQLTAELNDALSRIPNIPFDDVPVGKDEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N++ R+VG+KP   H  +EHFEIGEALG MDF+RA KLSG+RF+VLTG LA LERALGQ
Sbjct: 121 DNVVTRTVGEKPRWNHAPKEHFEIGEALGYMDFERAAKLSGSRFTVLTGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMIDLHTSEHGY+EVS+PL+VRDEA+YGT Q+PKFADD+F TTDGRWLIPT+EV+LTNL 
Sbjct: 181 FMIDLHTSEHGYSEVSSPLMVRDEAVYGTAQLPKFADDLFRTTDGRWLIPTAEVTLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ + LPLRFT L PSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT  E +  EHE
Sbjct: 241 REEILDQEKLPLRFTALTPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITDAESAVAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL LH+R ++LCTGD+GF + KTYDLEVWL GQN +REISSCS CG+FQ
Sbjct: 301 RMTACAEEVLKRLGLHFRTMTLCTGDMGFGSRKTYDLEVWLPGQNAFREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    K+ KF HTLNGSG AVGRCLIA+LENYLN DGSVTIP VL PYM  L
Sbjct: 361 GRRMNARYRGKEDKNNKFVHTLNGSGTAVGRCLIAVLENYLNEDGSVTIPDVLLPYMGGL 420

Query: 421 AVIKK 425
             I++
Sbjct: 421 TKIER 425


>gi|116251809|ref|YP_767647.1| seryl-tRNA synthetase [Rhizobium leguminosarum bv. viciae 3841]
 gi|166223278|sp|Q1MHM2|SYS_RHIL3 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|115256457|emb|CAK07541.1| putative seryl-tRNA synthetase [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 427

 Score =  600 bits (1548), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 278/425 (65%), Positives = 340/425 (80%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR  EP ++ +++LDEK R  ++K +D+ +RRN  S +IG 
Sbjct: 1   MLDIKWIRENPEALDAALAKRGAEPLAQSLVALDEKRRSAVQKAQDLLSRRNLASKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ N  L + LK E S LK  LP +E+E+ ++ + L   +S IPN+P ++VP+G   +
Sbjct: 61  AMAQKNSELAEKLKAEVSELKTLLPAIEEEDRQLTAELNDALSRIPNIPFDDVPVGKDEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +NI+ R+VG+KP   H  +EHFEIGEALG MDF+RA KLSG+RF+VLTG LA LERALGQ
Sbjct: 121 DNIVTRTVGEKPRWNHAPKEHFEIGEALGYMDFERAAKLSGSRFTVLTGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMIDLHTSEHGY EVS+PL+VRDEA+YGT Q+PKFA+D+F TTDGRWLIPT+EV+LTNL 
Sbjct: 181 FMIDLHTSEHGYIEVSSPLMVRDEAVYGTAQLPKFAEDLFRTTDGRWLIPTAEVTLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ + LPLRFT L PSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT  E +  EHE
Sbjct: 241 REEILDQEKLPLRFTALTPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITDAESAVAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL LH+R ++LCTGD+GF + KTYDLEVWL GQN +REISSCS CG+FQ
Sbjct: 301 RMTACAEEVLKRLGLHFRTMTLCTGDMGFGSRKTYDLEVWLPGQNAFREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR  + KS KF HTLNGSG AVGRCLIA+LENYLN DGSVTIP VL PYM  L
Sbjct: 361 GRRMNARYRGKDDKSNKFVHTLNGSGTAVGRCLIAVLENYLNEDGSVTIPDVLLPYMGGL 420

Query: 421 AVIKK 425
             I++
Sbjct: 421 TKIER 425


>gi|86357454|ref|YP_469346.1| seryl-tRNA synthetase [Rhizobium etli CFN 42]
 gi|123512164|sp|Q2K967|SYS_RHIEC RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|86281556|gb|ABC90619.1| seryl-tRNA synthetase (serine-tRNA ligase) protein [Rhizobium etli
           CFN 42]
          Length = 427

 Score =  592 bits (1525), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 275/425 (64%), Positives = 337/425 (79%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR  EP ++ +++LDEK R  ++K +D+ +RRN+ S +IG 
Sbjct: 1   MLDIKWIRENPEALDAALAKRGAEPLAQTLVALDEKRRSAVQKTQDLLSRRNAASKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ N  L + LK E + +KE LP  E+EE  + + L   +S IPNVP ++VP+G   +
Sbjct: 61  AMAQKNAELAEKLKAEVAEIKETLPAAEEEERTLSAELIDALSRIPNVPFDDVPVGKDEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N + R VG+KP   H  REHFEIGEALG MDF+RA KLSG+RF+VLTG LA LERALGQ
Sbjct: 121 DNAVARIVGEKPRWNHTPREHFEIGEALGYMDFERAAKLSGSRFTVLTGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMIDLHT EHGYTEVS+PL+VR EA++GTG +PKF +D+F TTDGR+LIPT+EV+LTNL 
Sbjct: 181 FMIDLHTREHGYTEVSSPLMVRAEAVFGTGSLPKFEEDLFKTTDGRYLIPTAEVTLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ + LPLRFT L PSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT  E S  EHE
Sbjct: 241 REEILDQEKLPLRFTALTPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITDAESSIAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL LH+R ++LCTGD+GF + KTYDLEVWL GQN +REISSCS CG+FQ
Sbjct: 301 RMTACAEEVLKRLGLHFRTMTLCTGDMGFGSRKTYDLEVWLPGQNAFREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR  + K+ KF HTLNGSG AVGRCLIA+LENYLN DGSVTIP VL PYM  L
Sbjct: 361 ARRMNARYRGKDDKNNKFVHTLNGSGTAVGRCLIAVLENYLNEDGSVTIPDVLLPYMGGL 420

Query: 421 AVIKK 425
             I++
Sbjct: 421 TKIER 425


>gi|327189128|gb|EGE56313.1| seryl-tRNA synthetase [Rhizobium etli CNPAF512]
          Length = 427

 Score =  591 bits (1523), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 271/425 (63%), Positives = 339/425 (79%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR  EP ++ +++LDEK R  ++K +D+ +RRN  S +IG 
Sbjct: 1   MLDIKWIRENPEALDAALAKRGAEPLAQSLVALDEKRRSAVQKAQDMLSRRNLASKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ N  L + LK E + LK  LP +E+EE ++ + L   +S IPN+P ++VP+G   +
Sbjct: 61  AMAQRNGELAEKLKAEVAELKTLLPAIEEEERQLTAELNDALSRIPNIPFDDVPVGKDEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N++ R+VG+KP   H  +EHFEIGEALG MDF+RA KLSG+RF+VLTG LA LERALGQ
Sbjct: 121 DNVVTRTVGEKPRWNHTPKEHFEIGEALGYMDFERAAKLSGSRFTVLTGQLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMIDLHT EHGYTEVS+PL+VR EA++GTG +PKF +D+F TTDGR+LIPT+EV+LTNL 
Sbjct: 181 FMIDLHTREHGYTEVSSPLMVRAEALFGTGNLPKFEEDLFKTTDGRYLIPTAEVTLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ + LPLRFT L PSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT  E +  EHE
Sbjct: 241 REEILDQEKLPLRFTALTPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITDAESAIAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL LH+R ++LCTGD+GF + KTYDLEVWL GQN +REISSCS CG+FQ
Sbjct: 301 RMTACAEEVLKRLGLHFRTMTLCTGDMGFGSRKTYDLEVWLPGQNAFREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR  + K+ +F HTLNGSG AVGRCLIA+LENYLN DGSVTIP VL PYM  L
Sbjct: 361 ARRMNARYRGKDDKTNRFVHTLNGSGTAVGRCLIAVLENYLNEDGSVTIPDVLLPYMGGL 420

Query: 421 AVIKK 425
             I++
Sbjct: 421 TKIER 425


>gi|190891515|ref|YP_001978057.1| seryl-tRNA synthetase [Rhizobium etli CIAT 652]
 gi|238692532|sp|B3PXU3|SYS_RHIE6 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|190696794|gb|ACE90879.1| seryl-tRNA synthetase protein [Rhizobium etli CIAT 652]
          Length = 427

 Score =  590 bits (1520), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 270/425 (63%), Positives = 339/425 (79%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR  EPQ++ +++LDEK R  ++K +D+ +RRN  S +IG 
Sbjct: 1   MLDIKWIRENPEALDAALAKRGAEPQAQSLVALDEKRRSAVQKAQDMLSRRNLASKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ N  L + LK E + LK  LP +E+E+ ++ + L   +S IPN+P ++VP+G   +
Sbjct: 61  AMAQKNGELAEKLKAEVAELKTLLPAIEEEDRQLTAELNDALSRIPNIPFDDVPVGKDEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N++ R+VG+KP   H  +EHFEIGEALG MDF+RA KLSG+RF+VLTG LA LERALGQ
Sbjct: 121 DNVVTRTVGEKPRWNHTPKEHFEIGEALGYMDFERAAKLSGSRFTVLTGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMIDLHT EHGYTEVS+PL+VR EA++GTG +PKF +D+F TTD R+LIPT+EV+LTNL 
Sbjct: 181 FMIDLHTREHGYTEVSSPLMVRAEALFGTGNLPKFEEDLFKTTDDRYLIPTAEVTLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI+E + LPLRFT L PSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT  + +  EHE
Sbjct: 241 REEILEQEKLPLRFTALTPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITDADSAIAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL LH+R ++LCTGD+GF + KTYDLEVWL GQN +REISSCS CG+FQ
Sbjct: 301 RMTACAEEVLKRLGLHFRTMTLCTGDMGFGSRKTYDLEVWLPGQNAFREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR  + K+ +F HTLNGSG AVGRCLIA+LENYLN DGSVTIP VL PYM  L
Sbjct: 361 ARRMNARYRGKDDKTNRFVHTLNGSGTAVGRCLIAVLENYLNEDGSVTIPDVLLPYMGGL 420

Query: 421 AVIKK 425
             I++
Sbjct: 421 TKIER 425


>gi|222085788|ref|YP_002544318.1| seryl-tRNA synthetase (serine-tRNA ligase) protein [Agrobacterium
           radiobacter K84]
 gi|254782998|sp|B9JEH1|SYS_AGRRK RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|221723236|gb|ACM26392.1| seryl-tRNA synthetase (serine-tRNA ligase) protein [Agrobacterium
           radiobacter K84]
          Length = 427

 Score =  588 bits (1515), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 272/425 (64%), Positives = 336/425 (79%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+N E LD AL KR  EP S+ +++LDEK R +I+ ++D+++RRN+ S +IG 
Sbjct: 1   MLDIKWIRENAEVLDAALAKRGAEPLSQGLIALDEKRRSIIQSVQDMQSRRNAASKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ N  L + LK E + +K  LP  E+EE  + + L   +S IPN+PL++VP+G   +
Sbjct: 61  AMAQKNTELAEKLKGEVADIKTSLPAAEEEERVLTAELNDALSRIPNIPLDDVPVGKDEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N++  S G KP+  H  +EH+EIGE LG MDF+RA KLSG+RF+VLT  LA LERALGQ
Sbjct: 121 DNVVKHSWGAKPAWNHKPKEHYEIGEELGYMDFERAAKLSGSRFTVLTSQLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHTSEHGYTEVS+PL+VRDEAM+GTGQ+PKFA+D F TT G WLIPT+EV+LTNL 
Sbjct: 181 FMLDLHTSEHGYTEVSSPLMVRDEAMFGTGQLPKFAEDSFRTTGGHWLIPTAEVTLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           S +I++ + LPLRFT L PSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT  E S  EHE
Sbjct: 241 SGDILDQEKLPLRFTALTPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITDAESSIAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL LHYRV++L TGD+GF A KTYDLEVWL GQ+ YREISSCS CG+FQ
Sbjct: 301 RMTACAEEVLKRLGLHYRVMTLSTGDMGFGARKTYDLEVWLPGQDTYREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR  + K  KF HTLNGSG AVGRCLIA+LENYLN DGSVT+P  L PYM  L
Sbjct: 361 ARRMNARYRGKDDKGTKFVHTLNGSGTAVGRCLIAVLENYLNDDGSVTVPDALLPYMGGL 420

Query: 421 AVIKK 425
             I++
Sbjct: 421 KRIER 425


>gi|209549091|ref|YP_002281008.1| seryl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|238065105|sp|B5ZMG0|SYS_RHILW RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|209534847|gb|ACI54782.1| seryl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 427

 Score =  587 bits (1513), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 269/425 (63%), Positives = 339/425 (79%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR  EP ++ +++LDEK R  ++K +D+ +RRN  S +IG 
Sbjct: 1   MLDIKWIRENPEALDAALAKRGAEPLAQNLVALDEKRRSAVQKAQDLLSRRNLASKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+++ N  L + LK E + LK  LP +E+E+ ++ + L   +S IPN+P ++VP+G   +
Sbjct: 61  ALSQKNGELAEKLKVEVAELKAMLPAVEEEDRQLTAELNDALSRIPNIPFDDVPVGKDEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N++ R+VG+KP   H  +EHFEIGEALG MDF+RA KLSG+RF+VLTG LA LERALGQ
Sbjct: 121 DNVVTRTVGEKPRWNHTPKEHFEIGEALGYMDFERAAKLSGSRFTVLTGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMIDLHT EHGYTEVS+PL+VR EA++GTG +PKF +D+F TTDGR+LIPT+EV+LTNL 
Sbjct: 181 FMIDLHTREHGYTEVSSPLMVRAEALFGTGNLPKFEEDLFKTTDGRYLIPTAEVTLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ + LPLRFT L PSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT  E +  EHE
Sbjct: 241 REEILDQEKLPLRFTALTPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITDAESAVAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAE++LKRL LH+R ++LCTGD+GF + KTYDLEVWL GQN +REISSCS CG+FQ
Sbjct: 301 RMTACAEDVLKRLGLHFRTMTLCTGDMGFGSRKTYDLEVWLPGQNAFREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR  + KS +F HTLNGSG AVGRCLIA+LENYLN DGSVTIP VL PYM  L
Sbjct: 361 ARRMNARYRGKDDKSNRFVHTLNGSGTAVGRCLIAVLENYLNEDGSVTIPDVLLPYMGGL 420

Query: 421 AVIKK 425
             I++
Sbjct: 421 TKIER 425


>gi|15965285|ref|NP_385638.1| seryl-tRNA synthetase [Sinorhizobium meliloti 1021]
 gi|307307875|ref|ZP_07587600.1| seryl-tRNA synthetase [Sinorhizobium meliloti BL225C]
 gi|307317049|ref|ZP_07596490.1| seryl-tRNA synthetase [Sinorhizobium meliloti AK83]
 gi|30173198|sp|Q92Q22|SYS_RHIME RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|15074465|emb|CAC46111.1| Probable seryl-tRNA synthetase (serine--tRNA ligase) [Sinorhizobium
           meliloti 1021]
 gi|306897137|gb|EFN27882.1| seryl-tRNA synthetase [Sinorhizobium meliloti AK83]
 gi|306901491|gb|EFN32094.1| seryl-tRNA synthetase [Sinorhizobium meliloti BL225C]
          Length = 427

 Score =  571 bits (1471), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 264/425 (62%), Positives = 326/425 (76%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+N + LD AL KR  EP S  +++LDE+ R +++ ++D+++RRN+ S +IG 
Sbjct: 1   MLDIKWIRENADALDEALAKRGAEPLSASLIALDERRRAVLQSLQDMQSRRNAASKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ N  L D LK E + LK  LP  E+E   + + L   +S IPN PL +VP+G   +
Sbjct: 61  AMAQKNSELADRLKAEVADLKNALPAAEEESRRIEAELSDALSRIPNTPLADVPVGADES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N++ R VG KP   H   EHFEIGEALGLMDF+ A +++G+RF++L G LA LERALGQ
Sbjct: 121 ANVVTRVVGAKPGWNHKPLEHFEIGEALGLMDFEGAARIAGSRFTILKGQLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT EHGY EV  PLLVRD+AMYGTGQ+PKF+DD+F TTDGRWLIPT+EV LTN+ 
Sbjct: 181 FMLDLHTGEHGYIEVQPPLLVRDDAMYGTGQLPKFSDDLFRTTDGRWLIPTAEVPLTNMV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             +I++ + LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K ELVSIT  E S  EHE
Sbjct: 241 REQILDGEKLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFNKVELVSITDAESSIDEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL LHYRV++LCTGD+GF A KTYDLEVWL GQ+ YREISSCS CG+FQ
Sbjct: 301 RMTACAEEVLKRLGLHYRVMTLCTGDMGFGARKTYDLEVWLPGQDAYREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR    K  KF HTLNGSGVA+GR LIA++ENYLN DGS+T+P VL PYM  L
Sbjct: 361 ARRMNARYRGKEEKGTKFVHTLNGSGVALGRALIAVIENYLNDDGSITVPDVLVPYMGGL 420

Query: 421 AVIKK 425
             I+K
Sbjct: 421 RRIEK 425


>gi|227821937|ref|YP_002825907.1| seryl-tRNA synthetase [Sinorhizobium fredii NGR234]
 gi|254783042|sp|C3MBU2|SYS_RHISN RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|227340936|gb|ACP25154.1| seryl-tRNA synthetase [Sinorhizobium fredii NGR234]
          Length = 427

 Score =  565 bits (1455), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 262/425 (61%), Positives = 328/425 (77%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+N   LD AL KR  EP S  +++LDE+ R +++ ++++++RRN+ S +IG 
Sbjct: 1   MLDIKWIRENAGVLDNALAKRGAEPLSASLIALDERRRTVLQSLQEMQSRRNAASKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ N  L + LK E + LK+ LP  E+E   + + L  ++S IPNVPLE+VP+G   +
Sbjct: 61  AMAQKNSELAEKLKAEVAELKDALPAAEEESRRMEAELTDILSRIPNVPLEDVPVGPDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N++ R VG KP+  H   EHFEIGE LG MDF+ A +++G+RF++L G LA LERALGQ
Sbjct: 121 GNVVKRLVGSKPTWNHKPLEHFEIGEGLGFMDFEGAARIAGSRFTILKGQLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT EHGY EV  PLLVRD+AMYGTGQ+PKFA+D+F TTDGRWLIPT+EV LTN+ 
Sbjct: 181 FMLDLHTQEHGYIEVQPPLLVRDDAMYGTGQLPKFAEDLFRTTDGRWLIPTAEVPLTNMV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             +I+E + LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K ELVS+T  E S  EHE
Sbjct: 241 REQILEGEKLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFNKVELVSLTDAETSVDEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL LHYRV++LCTGD+GF A KTYDLEVWL GQ+ YREISSCS CG+FQ
Sbjct: 301 RMTACAEEVLKRLGLHYRVMTLCTGDMGFGARKTYDLEVWLPGQDAYREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR    K  KF HTLNGSGVAVGR LIA++ENYLN DGSV++P VL PYM  L
Sbjct: 361 ARRMNARYRSKEEKGTKFVHTLNGSGVAVGRALIAVIENYLNEDGSVSVPEVLVPYMGGL 420

Query: 421 AVIKK 425
             ++K
Sbjct: 421 RRVEK 425


>gi|150396386|ref|YP_001326853.1| seryl-tRNA synthetase [Sinorhizobium medicae WSM419]
 gi|166223291|sp|A6U8N8|SYS_SINMW RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|150027901|gb|ABR60018.1| seryl-tRNA synthetase [Sinorhizobium medicae WSM419]
          Length = 427

 Score =  563 bits (1452), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 261/425 (61%), Positives = 324/425 (76%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+N + LD AL KR   P S  +++LDE+ R +++ ++D+++RRN+ S +IG 
Sbjct: 1   MLDIKWIRENADVLDSALAKRGAGPLSASLIALDERRRTILQSLQDMQSRRNAASKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ N  L D LK E + LK  LP  E+E   + + L   +S IPN PL++VP+G   +
Sbjct: 61  AMAQKNSELADRLKAEVAELKTTLPAAEEESRRIEAELTDALSRIPNAPLDDVPVGADES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N++ R VG KP+  H   EHFEIGEALGLMDF+ A +++G+RF++L G LA LERALGQ
Sbjct: 121 ANVVTRVVGAKPTWNHKPLEHFEIGEALGLMDFEGAARIAGSRFTILKGQLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT EHGY EV  PLLVRD+AMYGTGQ+PKF DD+F TTDGRWLIPT+EV LTN+ 
Sbjct: 181 FMLDLHTGEHGYIEVQPPLLVRDDAMYGTGQLPKFTDDLFRTTDGRWLIPTAEVPLTNMV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             +I++ + LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K ELVSIT  E +  EHE
Sbjct: 241 REQILDGEKLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFNKVELVSITDAESALDEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL LHYRV++LCTGD+GFSA KTYDLEVWL GQ+ YREISSCS CG+FQ
Sbjct: 301 RMTACAEEVLKRLGLHYRVMTLCTGDMGFSARKTYDLEVWLPGQDAYREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    K  KF HTLNGSGVA+GR LIA++ENYLN DGS+T+P  L  YM  L
Sbjct: 361 GRRMNARYRGKEEKGTKFAHTLNGSGVALGRALIAVIENYLNEDGSITVPDALIAYMGGL 420

Query: 421 AVIKK 425
             I+K
Sbjct: 421 RRIEK 425


>gi|306840377|ref|ZP_07473144.1| seryl-tRNA synthetase [Brucella sp. BO2]
 gi|306289662|gb|EFM60862.1| seryl-tRNA synthetase [Brucella sp. BO2]
          Length = 469

 Score =  552 bits (1423), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 258/425 (60%), Positives = 321/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 43  MLDIKWIRENPETLDKALAKRGAAPLSSELIALDEKRREHVGKVQAAQERRNAASKEIGK 102

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LKE L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 103 AMAAKDMDTAEKLKAEVGELKEFLAHAEEDERRLSKELSDALSTIPNIPLDDVPLGKDES 162

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 163 DNVELRRIGNPRNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 222

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 223 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 282

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K E+VS+T  E S  EHE
Sbjct: 283 AEEIVDMKGLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSVTDAESSVAEHE 342

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 343 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 402

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSGVAVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 403 GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQQEDGSIHIPEALQPYMGGL 462

Query: 421 AVIKK 425
             I+K
Sbjct: 463 TRIEK 467


>gi|306843782|ref|ZP_07476380.1| seryl-tRNA synthetase [Brucella sp. BO1]
 gi|306275860|gb|EFM57576.1| seryl-tRNA synthetase [Brucella sp. BO1]
          Length = 469

 Score =  552 bits (1422), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 258/425 (60%), Positives = 321/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 43  MLDIKWIRENPETLDKALAKRGAAPLSSELIALDEKRREHVGKVQAAQERRNAASKEIGK 102

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LKE L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 103 AMAAKDMDTAEKLKAEVGELKEFLAHAEEDERRLSKELNDALSTIPNIPLDDVPLGKDES 162

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 163 DNVELRRIGNPRNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 222

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 223 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 282

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K E+VS+T  E S  EHE
Sbjct: 283 AEEIVDMKGLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSVTDAESSVAEHE 342

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 343 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 402

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSGVAVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 403 GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQQEDGSIHIPEALQPYMGGL 462

Query: 421 AVIKK 425
             I+K
Sbjct: 463 TRIEK 467


>gi|254693618|ref|ZP_05155446.1| seryl-tRNA synthetase [Brucella abortus bv. 3 str. Tulya]
 gi|261213884|ref|ZP_05928165.1| seryl-tRNA synthetase [Brucella abortus bv. 3 str. Tulya]
 gi|260915491|gb|EEX82352.1| seryl-tRNA synthetase [Brucella abortus bv. 3 str. Tulya]
          Length = 427

 Score =  552 bits (1422), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 258/425 (60%), Positives = 321/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 1   MLDIKWIRENPETLDKALAKRGAAPLSSELITLDEKRREHVGKVQAAQERRNAASKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LK+ L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 61  AMAAKDMGTAEKLKAEVGELKDFLAHAEEDERRLSKELSDALSTIPNIPLDDVPLGKDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 121 DNVELRRIGNPHNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 181 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K E+VSIT  E S  EHE
Sbjct: 241 AEEIVDMKGLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSITDAESSVAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 301 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSGVAVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 361 GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQQEDGSIHIPEALQPYMGGL 420

Query: 421 AVIKK 425
             I+K
Sbjct: 421 TRIEK 425


>gi|62289830|ref|YP_221623.1| seryl-tRNA synthetase [Brucella abortus bv. 1 str. 9-941]
 gi|82699755|ref|YP_414329.1| seryl-tRNA synthetase [Brucella melitensis biovar Abortus 2308]
 gi|189024071|ref|YP_001934839.1| seryl-tRNA synthetase [Brucella abortus S19]
 gi|254689135|ref|ZP_05152389.1| seryl-tRNA synthetase [Brucella abortus bv. 6 str. 870]
 gi|254697268|ref|ZP_05159096.1| seryl-tRNA synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701649|ref|ZP_05163477.1| seryl-tRNA synthetase [Brucella suis bv. 5 str. 513]
 gi|254706906|ref|ZP_05168734.1| seryl-tRNA synthetase [Brucella pinnipedialis M163/99/10]
 gi|254709987|ref|ZP_05171798.1| seryl-tRNA synthetase [Brucella pinnipedialis B2/94]
 gi|254713987|ref|ZP_05175798.1| seryl-tRNA synthetase [Brucella ceti M644/93/1]
 gi|254716954|ref|ZP_05178765.1| seryl-tRNA synthetase [Brucella ceti M13/05/1]
 gi|254730167|ref|ZP_05188745.1| seryl-tRNA synthetase [Brucella abortus bv. 4 str. 292]
 gi|256031480|ref|ZP_05445094.1| seryl-tRNA synthetase [Brucella pinnipedialis M292/94/1]
 gi|256060990|ref|ZP_05451148.1| seryl-tRNA synthetase [Brucella neotomae 5K33]
 gi|256159606|ref|ZP_05457368.1| seryl-tRNA synthetase [Brucella ceti M490/95/1]
 gi|256254886|ref|ZP_05460422.1| seryl-tRNA synthetase [Brucella ceti B1/94]
 gi|256369312|ref|YP_003106820.1| seryl-tRNA synthetase [Brucella microti CCM 4915]
 gi|260168614|ref|ZP_05755425.1| seryl-tRNA synthetase [Brucella sp. F5/99]
 gi|260545423|ref|ZP_05821164.1| seryl-tRNA synthetase [Brucella abortus NCTC 8038]
 gi|260754634|ref|ZP_05866982.1| seryl-tRNA synthetase [Brucella abortus bv. 6 str. 870]
 gi|260757857|ref|ZP_05870205.1| seryl-tRNA synthetase [Brucella abortus bv. 4 str. 292]
 gi|260761680|ref|ZP_05874023.1| seryl-tRNA synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|261218759|ref|ZP_05933040.1| seryl-tRNA synthetase [Brucella ceti M13/05/1]
 gi|261222070|ref|ZP_05936351.1| seryl-tRNA synthetase [Brucella ceti B1/94]
 gi|261314369|ref|ZP_05953566.1| seryl-tRNA synthetase [Brucella pinnipedialis M163/99/10]
 gi|261317535|ref|ZP_05956732.1| seryl-tRNA synthetase [Brucella pinnipedialis B2/94]
 gi|261321742|ref|ZP_05960939.1| seryl-tRNA synthetase [Brucella ceti M644/93/1]
 gi|261324992|ref|ZP_05964189.1| seryl-tRNA synthetase [Brucella neotomae 5K33]
 gi|261752202|ref|ZP_05995911.1| seryl-tRNA synthetase [Brucella suis bv. 5 str. 513]
 gi|261758088|ref|ZP_06001797.1| seryl-tRNA synthetase [Brucella sp. F5/99]
 gi|265988570|ref|ZP_06101127.1| seryl-tRNA synthetase [Brucella pinnipedialis M292/94/1]
 gi|265998035|ref|ZP_06110592.1| seryl-tRNA synthetase [Brucella ceti M490/95/1]
 gi|81309426|sp|Q57DM2|SYS_BRUAB RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|123546686|sp|Q2YNM6|SYS_BRUA2 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|238689362|sp|B2S5B8|SYS_BRUA1 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|62195962|gb|AAX74262.1| SerS, seryl-tRNA synthetase [Brucella abortus bv. 1 str. 9-941]
 gi|82615856|emb|CAJ10860.1| tRNA synthetases, class-II (G, H, P and S):Seryl-tRNA synthetase,
           class IIa:Aminoacyl-transfer RNA synthetase, class II
           [Brucella melitensis biovar Abortus 2308]
 gi|189019643|gb|ACD72365.1| seryl-tRNA synthetase [Brucella abortus S19]
 gi|255999472|gb|ACU47871.1| seryl-tRNA synthetase [Brucella microti CCM 4915]
 gi|260096830|gb|EEW80705.1| seryl-tRNA synthetase [Brucella abortus NCTC 8038]
 gi|260668175|gb|EEX55115.1| seryl-tRNA synthetase [Brucella abortus bv. 4 str. 292]
 gi|260672112|gb|EEX58933.1| seryl-tRNA synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674742|gb|EEX61563.1| seryl-tRNA synthetase [Brucella abortus bv. 6 str. 870]
 gi|260920654|gb|EEX87307.1| seryl-tRNA synthetase [Brucella ceti B1/94]
 gi|260923848|gb|EEX90416.1| seryl-tRNA synthetase [Brucella ceti M13/05/1]
 gi|261294432|gb|EEX97928.1| seryl-tRNA synthetase [Brucella ceti M644/93/1]
 gi|261296758|gb|EEY00255.1| seryl-tRNA synthetase [Brucella pinnipedialis B2/94]
 gi|261300972|gb|EEY04469.1| seryl-tRNA synthetase [Brucella neotomae 5K33]
 gi|261303395|gb|EEY06892.1| seryl-tRNA synthetase [Brucella pinnipedialis M163/99/10]
 gi|261738072|gb|EEY26068.1| seryl-tRNA synthetase [Brucella sp. F5/99]
 gi|261741955|gb|EEY29881.1| seryl-tRNA synthetase [Brucella suis bv. 5 str. 513]
 gi|262552503|gb|EEZ08493.1| seryl-tRNA synthetase [Brucella ceti M490/95/1]
 gi|264660767|gb|EEZ31028.1| seryl-tRNA synthetase [Brucella pinnipedialis M292/94/1]
          Length = 427

 Score =  551 bits (1421), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 258/425 (60%), Positives = 321/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 1   MLDIKWIRENPETLDKALAKRGAAPLSSELIALDEKRREHVGKVQAAQERRNAASKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LK+ L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 61  AMAAKDMGTAEKLKAEVGELKDFLAHAEEDERRLSKELSDALSTIPNIPLDDVPLGKDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 121 DNVELRRIGNPHNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 181 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K E+VSIT  E S  EHE
Sbjct: 241 AEEIVDMKGLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSITDAESSVAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 301 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSGVAVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 361 GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQQEDGSIHIPEALQPYMGGL 420

Query: 421 AVIKK 425
             I+K
Sbjct: 421 TRIEK 425


>gi|256257384|ref|ZP_05462920.1| seryl-tRNA synthetase [Brucella abortus bv. 9 str. C68]
 gi|260883661|ref|ZP_05895275.1| seryl-tRNA synthetase [Brucella abortus bv. 9 str. C68]
 gi|260873189|gb|EEX80258.1| seryl-tRNA synthetase [Brucella abortus bv. 9 str. C68]
          Length = 427

 Score =  551 bits (1419), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 257/425 (60%), Positives = 321/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 1   MLDIKWIRENPETLDKALAKRGAAPLSSELIALDEKRREHVGKVQAAQERRNAASKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LK+ L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 61  AMAAKDMGTAEKLKAEVGELKDFLAHAEEDERRLSKELSDALSTIPNIPLDDVPLGKDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 121 DNVELRRIGNPHNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 181 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAG+AGRDTRGMLRQHQF K E+VSIT  E S  EHE
Sbjct: 241 AEEIVDMKGLPLRFTALTPCFRSEAGAAGRDTRGMLRQHQFLKVEMVSITDAESSVAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 301 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSGVAVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 361 GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQQEDGSIHIPEALQPYMGGL 420

Query: 421 AVIKK 425
             I+K
Sbjct: 421 TRIEK 425


>gi|225627373|ref|ZP_03785410.1| seryl-tRNA synthetase [Brucella ceti str. Cudo]
 gi|225617378|gb|EEH14423.1| seryl-tRNA synthetase [Brucella ceti str. Cudo]
          Length = 469

 Score =  551 bits (1419), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 258/425 (60%), Positives = 321/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 43  MLDIKWIRENPETLDKALAKRGAAPLSSELIALDEKRREHVGKVQAAQERRNAASKEIGK 102

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LK+ L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 103 AMAAKDMGTAEKLKAEVGELKDFLAHAEEDERRLSKELSDALSTIPNIPLDDVPLGKDES 162

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 163 DNVELRRIGNPHNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 222

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 223 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 282

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K E+VSIT  E S  EHE
Sbjct: 283 AEEIVDMKGLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSITDAESSVAEHE 342

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 343 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 402

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSGVAVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 403 GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQQEDGSIHIPEALQPYMGGL 462

Query: 421 AVIKK 425
             I+K
Sbjct: 463 TRIEK 467


>gi|237815315|ref|ZP_04594313.1| seryl-tRNA synthetase [Brucella abortus str. 2308 A]
 gi|237790152|gb|EEP64362.1| seryl-tRNA synthetase [Brucella abortus str. 2308 A]
          Length = 469

 Score =  551 bits (1419), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 258/425 (60%), Positives = 321/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 43  MLDIKWIRENPETLDKALAKRGAAPLSSELIALDEKRREHVGKVQAAQERRNAASKEIGK 102

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LK+ L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 103 AMAAKDMGTAEKLKAEVGELKDFLAHAEEDERRLSKELSDALSTIPNIPLDDVPLGKDES 162

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 163 DNVELRRIGNPHNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 222

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 223 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 282

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K E+VSIT  E S  EHE
Sbjct: 283 AEEIVDMKGLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSITDAESSVAEHE 342

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 343 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 402

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSGVAVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 403 GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQQEDGSIHIPEALQPYMGGL 462

Query: 421 AVIKK 425
             I+K
Sbjct: 463 TRIEK 467


>gi|161511138|ref|NP_539999.2| seryl-tRNA synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|225852397|ref|YP_002732630.1| seryl-tRNA synthetase [Brucella melitensis ATCC 23457]
 gi|256044558|ref|ZP_05447462.1| seryl-tRNA synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256113431|ref|ZP_05454272.1| seryl-tRNA synthetase [Brucella melitensis bv. 3 str. Ether]
 gi|256264105|ref|ZP_05466637.1| seryl-tRNA synthetase [Brucella melitensis bv. 2 str. 63/9]
 gi|260563911|ref|ZP_05834397.1| seryl-tRNA synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|265990984|ref|ZP_06103541.1| seryl-tRNA synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994821|ref|ZP_06107378.1| seryl-tRNA synthetase [Brucella melitensis bv. 3 str. Ether]
 gi|30173191|sp|Q8YGS6|SYS_BRUME RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|254783011|sp|C0RIL8|SYS_BRUMB RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|225640762|gb|ACO00676.1| seryl-tRNA synthetase [Brucella melitensis ATCC 23457]
 gi|260153927|gb|EEW89019.1| seryl-tRNA synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|262765934|gb|EEZ11723.1| seryl-tRNA synthetase [Brucella melitensis bv. 3 str. Ether]
 gi|263001768|gb|EEZ14343.1| seryl-tRNA synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094323|gb|EEZ18168.1| seryl-tRNA synthetase [Brucella melitensis bv. 2 str. 63/9]
 gi|326408903|gb|ADZ65968.1| seryl-tRNA synthetase [Brucella melitensis M28]
 gi|326538622|gb|ADZ86837.1| seryl-tRNA synthetase [Brucella melitensis M5-90]
          Length = 427

 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 257/425 (60%), Positives = 320/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 1   MLDIKWIRENPETLDKALAKRGAAPLSSELIALDEKRREHVGKVQAAQERRNAASKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LK+ L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 61  AMAAKDMGTAEKLKAEVGELKDFLAHAEEDERRLSKELSDALSTIPNIPLDDVPLGKDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 121 DNVELRRIGNPHNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 181 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K E+VSIT  E S  EHE
Sbjct: 241 AEEIVDMKGLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSITDAESSVAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 301 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSG AVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 361 GRRMNARYRPEGEKSTRFVHTLNGSGAAVGRALIAVMENYQQEDGSIHIPEALQPYMGGL 420

Query: 421 AVIKK 425
             I+K
Sbjct: 421 TRIEK 425


>gi|254718989|ref|ZP_05180800.1| seryl-tRNA synthetase [Brucella sp. 83/13]
 gi|265983979|ref|ZP_06096714.1| seryl-tRNA synthetase [Brucella sp. 83/13]
 gi|264662571|gb|EEZ32832.1| seryl-tRNA synthetase [Brucella sp. 83/13]
          Length = 427

 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 257/425 (60%), Positives = 321/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 1   MLDIKWIRENPETLDKALAKRGAAPLSFELIALDEKRREHVGKVQAAQERRNAASKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LK+ L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 61  AMAAKDMGTAEKLKAEVGELKDFLAHAEEDERRLSKELSDALSTIPNIPLDDVPLGKDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 121 DNVELRRIGNPHNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 181 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K E+VS+T  E S  EHE
Sbjct: 241 AEEIVDMKGLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSVTDAESSVAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 301 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSGVAVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 361 GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQQEDGSIHIPEALQPYMGGL 420

Query: 421 AVIKK 425
             I+K
Sbjct: 421 TRIEK 425


>gi|297248235|ref|ZP_06931953.1| seryl-tRNA synthetase [Brucella abortus bv. 5 str. B3196]
 gi|297175404|gb|EFH34751.1| seryl-tRNA synthetase [Brucella abortus bv. 5 str. B3196]
          Length = 469

 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 257/425 (60%), Positives = 321/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 43  MLDIKWIRENPETLDKALAKRGAAPLSSELIALDEKRREHVGKVQAAQERRNAASKEIGK 102

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LK+ L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 103 AMAAKDMGTAEKLKAEVGELKDFLAHAEEDERRLSKELSDALSTIPNIPLDDVPLGKDES 162

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 163 DNVELRRIGNPHNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 222

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 223 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 282

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAG+AGRDTRGMLRQHQF K E+VSIT  E S  EHE
Sbjct: 283 AEEIVDMKGLPLRFTALTPCFRSEAGAAGRDTRGMLRQHQFLKVEMVSITDAESSVAEHE 342

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 343 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 402

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSGVAVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 403 GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQQEDGSIHIPEALQPYMGGL 462

Query: 421 AVIKK 425
             I+K
Sbjct: 463 TRIEK 467


>gi|306837337|ref|ZP_07470218.1| seryl-tRNA synthetase [Brucella sp. NF 2653]
 gi|306407589|gb|EFM63787.1| seryl-tRNA synthetase [Brucella sp. NF 2653]
          Length = 469

 Score =  550 bits (1416), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 257/425 (60%), Positives = 321/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 43  MLDIKWIRENPETLDKALAKRGAAPLSFELIALDEKRREHVGKVQAAQERRNAASKEIGK 102

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LK+ L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 103 AMAAKDMGTAEKLKAEVGELKDFLAHAEEDERRLSKELSDALSTIPNIPLDDVPLGKDES 162

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 163 DNVELRRIGNPHNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 222

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 223 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 282

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K E+VS+T  E S  EHE
Sbjct: 283 AEEIVDMKGLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSVTDAESSVAEHE 342

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 343 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 402

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSGVAVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 403 GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQQEDGSIHIPEALQPYMGGL 462

Query: 421 AVIKK 425
             I+K
Sbjct: 463 TRIEK 467


>gi|23501771|ref|NP_697898.1| seryl-tRNA synthetase [Brucella suis 1330]
 gi|161618845|ref|YP_001592732.1| seryl-tRNA synthetase [Brucella canis ATCC 23365]
 gi|163843156|ref|YP_001627560.1| seryl-tRNA synthetase [Brucella suis ATCC 23445]
 gi|254704192|ref|ZP_05166020.1| seryl-tRNA synthetase [Brucella suis bv. 3 str. 686]
 gi|260566558|ref|ZP_05837028.1| seryl-tRNA synthetase [Brucella suis bv. 4 str. 40]
 gi|261754861|ref|ZP_05998570.1| seryl-tRNA synthetase [Brucella suis bv. 3 str. 686]
 gi|30173166|sp|Q8G139|SYS_BRUSU RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|189083559|sp|A9MAQ8|SYS_BRUC2 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|189083560|sp|B0CLL0|SYS_BRUSI RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|23347700|gb|AAN29813.1| seryl-tRNA synthetase [Brucella suis 1330]
 gi|161335656|gb|ABX61961.1| seryl-tRNA synthetase [Brucella canis ATCC 23365]
 gi|163673879|gb|ABY37990.1| seryl-tRNA synthetase [Brucella suis ATCC 23445]
 gi|260156076|gb|EEW91156.1| seryl-tRNA synthetase [Brucella suis bv. 4 str. 40]
 gi|261744614|gb|EEY32540.1| seryl-tRNA synthetase [Brucella suis bv. 3 str. 686]
          Length = 427

 Score =  550 bits (1416), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 257/425 (60%), Positives = 321/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 1   MLDIKWIRENPETLDKALAKRGAAPLSSELIALDEKRREHVGKVQAAQERRNAASKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LK+ L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 61  AMAAKDMGTAEKLKAEVGELKDFLAHAEEDERRLSKELSDALSTIPNIPLDDVPLGKDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 121 DNVELRRIGNPHNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 181 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K E+VSIT  E S  EHE
Sbjct: 241 AEEIVDMKGLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSITDAESSVAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 301 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSGVAVGR LIA++ENY   DGS+ IP  L+PY+  L
Sbjct: 361 GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQQEDGSIHIPEALQPYIGGL 420

Query: 421 AVIKK 425
             I+K
Sbjct: 421 TRIEK 425


>gi|17983051|gb|AAL52263.1| seryl-tRNA synthetase [Brucella melitensis bv. 1 str. 16M]
          Length = 469

 Score =  550 bits (1416), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 257/425 (60%), Positives = 320/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 43  MLDIKWIRENPETLDKALAKRGAAPLSSELIALDEKRREHVGKVQAAQERRNAASKEIGK 102

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LK+ L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 103 AMAAKDMGTAEKLKAEVGELKDFLAHAEEDERRLSKELSDALSTIPNIPLDDVPLGKDES 162

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 163 DNVELRRIGNPHNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 222

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 223 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 282

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K E+VSIT  E S  EHE
Sbjct: 283 AEEIVDMKGLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSITDAESSVAEHE 342

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 343 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 402

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSG AVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 403 GRRMNARYRPEGEKSTRFVHTLNGSGAAVGRALIAVMENYQQEDGSIHIPEALQPYMGGL 462

Query: 421 AVIKK 425
             I+K
Sbjct: 463 TRIEK 467


>gi|148559314|ref|YP_001258859.1| seryl-tRNA synthetase [Brucella ovis ATCC 25840]
 gi|148370571|gb|ABQ60550.1| seryl-tRNA synthetase [Brucella ovis ATCC 25840]
          Length = 469

 Score =  548 bits (1413), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 258/425 (60%), Positives = 321/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 43  MLDIKWIRENPETLDKALAKRGAAPLSSELIALDEKRREHVGKVQAAQERRNAASKEIGK 102

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LK+ L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 103 AMAAKDMGTAEKLKAEVGELKDFLAHAEEDERCLSKELSDALSTIPNIPLDDVPLGKDES 162

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 163 DNVELRRIGNPHNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 222

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 223 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 282

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K E+VSIT  E S  EHE
Sbjct: 283 AEEIVDMKGLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSITDAESSVAEHE 342

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 343 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 402

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSGVAVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 403 GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQQEDGSIHIPEALQPYMGGL 462

Query: 421 AVIKK 425
             I+K
Sbjct: 463 TRIEK 467


>gi|153009670|ref|YP_001370885.1| seryl-tRNA synthetase [Ochrobactrum anthropi ATCC 49188]
 gi|151561558|gb|ABS15056.1| seryl-tRNA synthetase [Ochrobactrum anthropi ATCC 49188]
          Length = 442

 Score =  540 bits (1390), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 257/425 (60%), Positives = 320/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR  +  S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 16  MLDIKWIRENPETLDKALAKRGAQSLSSELMALDEKRREYVGKVQAAQERRNAASKEIGK 75

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  + +  D LK E + LK+ L   E EE  +   L   +S IPN+PLE+VP+G   +
Sbjct: 76  AMAAKDAATADKLKAEVAELKDFLAQAEDEERRLTKELNDALSTIPNIPLEDVPLGKDES 135

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R VG + +     +EHFE+GEALG MDF+RA KL+G+RF+VL G LA LERALGQ
Sbjct: 136 DNVEVRRVGNQRNFAFQPKEHFELGEALGYMDFERAAKLAGSRFTVLKGSLARLERALGQ 195

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT EHGYTE   PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 196 FMLDLHTMEHGYTETMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 255

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI+++KSLP R+T L P FRSEAGSAGRDTRGMLRQHQF K E+VSIT  + S  EHE
Sbjct: 256 ADEIVDTKSLPQRYTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSITDADSSIAEHE 315

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A KTYD+EVWL GQN YREISSCS CG+FQ
Sbjct: 316 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQKTYDIEVWLPGQNTYREISSCSVCGDFQ 375

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSGVAVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 376 GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQEEDGSIHIPEALQPYMGGL 435

Query: 421 AVIKK 425
             I+K
Sbjct: 436 TRIEK 440


>gi|110634154|ref|YP_674362.1| seryl-tRNA synthetase [Mesorhizobium sp. BNC1]
 gi|123353591|sp|Q11HC8|SYS_MESSB RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|110285138|gb|ABG63197.1| seryl-tRNA synthetase [Chelativorans sp. BNC1]
          Length = 431

 Score =  539 bits (1388), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 255/431 (59%), Positives = 327/431 (75%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-----EYILSLDEKNRILIKKIEDIRARRNSNS 55
           MLDI+WIR+N + L +AL+KR  E  +     E  ++ DE  R  + K+++ + +RN+ S
Sbjct: 1   MLDIRWIRENADALVLALRKRGQEEAAARSTVEEAIAADEARRTHLTKLQEAQEQRNAAS 60

Query: 56  AQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
            +IG+A+A G+    + LK E + LK  +   E +E  + + L+ L++ IPN+PL++VP+
Sbjct: 61  KEIGKALAAGDKEKAERLKAEVAELKGFIQDGEAQERALDNRLRDLLARIPNIPLDDVPV 120

Query: 116 GTSANENILIRSVG--KKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAH 173
           G   N+N+ IR VG  ++P   + ++EHFEIGEALGLMDF+RA KLSGARF+VLTG LA 
Sbjct: 121 GADENDNVEIRRVGEARQP---NWAKEHFEIGEALGLMDFERAAKLSGARFTVLTGTLAR 177

Query: 174 LERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSE 233
           LERALGQFM+DLHT+EHGYTEV  PLLVRDEA++GTGQ+PKF +D+F TTDGRW+IPT+E
Sbjct: 178 LERALGQFMLDLHTTEHGYTEVQPPLLVRDEALFGTGQLPKFDEDLFRTTDGRWMIPTAE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V LTNL   EI++ + LPLR+T L P FRSEAGSAGRDTRGMLRQHQF+K ELVSIT  E
Sbjct: 238 VPLTNLVREEILDGEKLPLRYTALTPCFRSEAGSAGRDTRGMLRQHQFYKVELVSITDAE 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            +  EHERM +CAEE+LKRL L +R V LCTGD+GF A KTYD+EVWL GQ  YREISSC
Sbjct: 298 SALAEHERMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQKTYDIEVWLPGQKTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S CG+FQ+RRMN+RYR    K  +F HTLNGSGVAVGR LIA++ENY N DGS++IP +L
Sbjct: 358 SVCGDFQARRMNARYRAAGDKQARFVHTLNGSGVAVGRALIAVMENYQNEDGSISIPEIL 417

Query: 414 RPYMNNLAVIK 424
           +PYM  L  I+
Sbjct: 418 QPYMGGLKKIE 428


>gi|163868042|ref|YP_001609246.1| seryl-tRNA synthetase [Bartonella tribocorum CIP 105476]
 gi|189083558|sp|A9IS21|SYS_BART1 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|161017693|emb|CAK01251.1| Seryl-tRNA synthetase [Bartonella tribocorum CIP 105476]
          Length = 425

 Score =  529 bits (1363), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 248/423 (58%), Positives = 317/423 (74%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL  R LEPQ+E ++ LD   R  + K++  + RRN+ S +IGQ
Sbjct: 1   MLDIKWIRENPEKLDKALVSRGLEPQAERLIQLDFARRSHVAKVQLAQERRNAVSKEIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  +  + + L++E   LK  L     EE ++  SL+K++S +PN+PL++VP G   +
Sbjct: 61  ALAVSDEKMAERLRSEVEELKVFLSSATAEEKQLTESLEKILSALPNIPLDDVPEGKDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N++IR  G  P+     +EHF++G+ L  M+F+RA++LSG RF+VL+G LA LERALGQ
Sbjct: 121 DNVVIRHFGLPPTFNFTPKEHFDLGQDLKQMNFERASRLSGTRFTVLSGALARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D+H +EHGYTEVS PLLVRDE +YG  Q+PKFA+D+F TTDGRWLI T+EV LTNL 
Sbjct: 181 FMLDVHVNEHGYTEVSVPLLVRDEIVYGAAQLPKFAEDLFQTTDGRWLISTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI+E   LPLRF++L+P FRSEAG+AGRDTRGMLRQHQFWK E+VSIT EE S  E E
Sbjct: 241 NDEILEVSDLPLRFSSLSPCFRSEAGAAGRDTRGMLRQHQFWKVEMVSITSEEQSLMELE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE+ILKRL L +R V L TGD+GF+A KTYD+EVWL GQ  YREISSCS CG+FQ
Sbjct: 301 RMTECAEDILKRLGLPFRTVVLSTGDMGFAARKTYDIEVWLPGQECYREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    K L F H+LNGSG AVGRCLIA+LENY  ADGS+ +P VL+PYM  +
Sbjct: 361 GRRMNARYRKEGDKKLHFVHSLNGSGTAVGRCLIAVLENYQQADGSIIVPDVLQPYMGGM 420

Query: 421 AVI 423
             I
Sbjct: 421 RCI 423


>gi|163759446|ref|ZP_02166531.1| seryl-tRNA synthetase [Hoeflea phototrophica DFL-43]
 gi|162283043|gb|EDQ33329.1| seryl-tRNA synthetase [Hoeflea phototrophica DFL-43]
          Length = 427

 Score =  527 bits (1358), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 251/425 (59%), Positives = 317/425 (74%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NP  LD AL+KR  E QS  +++LDE  R  +  ++ ++ RRN+ S +IG+
Sbjct: 1   MLDIKWIRENPAALDAALEKRGAEAQSSRLVALDEARRSHVGLVQALQERRNAASKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  + +  DALK E + LK++L   E +E E+   LK  +S +PN+PL+EVP+G    
Sbjct: 61  AMAAKDQAAADALKAEVAKLKDELQAGEAKERELDEELKHALSVLPNIPLDEVPLGADEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R VG+KP      +EHFE+GEALG+MDF+RA K+SGARF++L+G LA LERALGQ
Sbjct: 121 DNVEVRKVGEKPDLGFEPKEHFELGEALGMMDFERAAKMSGARFTILSGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT EHGYTEV+ PLLV D A YGT ++PKF DD+F TTDGRWLIPT+EV LT + 
Sbjct: 181 FMLDLHTGEHGYTEVNPPLLVNDAAAYGTDKLPKFGDDLFRTTDGRWLIPTAEVPLTYMA 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI+    LP R+      FRSEAGSAGRDTRGMLRQHQF K ELVS+T  E S  EHE
Sbjct: 241 AGEILAEDELPKRYAAHTACFRSEAGSAGRDTRGMLRQHQFSKVELVSVTTPETSLEEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM + AE +L RL LH+R V LCTGD+GF A KTYD+EVWL GQN YREISSCS CG+FQ
Sbjct: 301 RMTASAEAVLTRLGLHFRTVVLCTGDMGFGAQKTYDIEVWLPGQNAYREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R R P  K+ +F HTLNGSGVAVGR LIA++ENY NADGS+T+P  LR YM  L
Sbjct: 361 ARRMNARSRKPGDKATRFVHTLNGSGVAVGRALIAVMENYQNADGSITVPDALRFYMGGL 420

Query: 421 AVIKK 425
           + I+K
Sbjct: 421 SKIEK 425


>gi|319408334|emb|CBI81987.1| Seryl-tRNA synthetase [Bartonella schoenbuchensis R1]
          Length = 425

 Score =  526 bits (1354), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 245/421 (58%), Positives = 313/421 (74%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD ALK R +EPQ++ ++ LD + R  + KI+  + RRN  S +IGQ
Sbjct: 1   MLDIKWIRENPEKLDAALKNRGIEPQAQRLIELDLERRSHVAKIQCAQERRNVASKEIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A G+    + +K E   +K+ L     EE ++  +L+K +S IPN+PL +VP G   +
Sbjct: 61  ALAAGDQKNAERIKAEVEEIKDFLSSASMEEKQLTENLEKTLSAIPNIPLNDVPKGKDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+++R  G   +     +EHF++G+ L  MDF++A++LSGARF+VL+G LA LERALGQ
Sbjct: 121 ANVVVRHFGTPTTFDFTPKEHFDLGQNLQQMDFEQASRLSGARFTVLSGALARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D+H  EHGYTEVS PLLVRDE +YG GQ+PKF+DD+F TTDG+WLI T+EV L NL 
Sbjct: 181 FMLDMHVDEHGYTEVSVPLLVRDEIVYGAGQLPKFSDDLFQTTDGKWLISTAEVPLVNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + E+++   LPLRF++L P FRSEAG+AGRDTRGMLRQHQFWK E+VSIT EE S  E E
Sbjct: 241 NSEVLDISDLPLRFSSLTPCFRSEAGAAGRDTRGMLRQHQFWKVEMVSITTEEQSLIELE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE +LKRL L +R V L TGD+GF+A KTYD+EVWL GQ  YREISSCS CG+FQ
Sbjct: 301 RMTECAENVLKRLGLPFRTVLLSTGDMGFAARKTYDIEVWLPGQRCYREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    K+L F HTLNGSG AVGRCLIAILENY  ADGSV +P VL+PYM  +
Sbjct: 361 GRRMNARYRTKGEKTLHFVHTLNGSGTAVGRCLIAILENYQQADGSVIVPDVLQPYMKGI 420

Query: 421 A 421
           +
Sbjct: 421 S 421


>gi|90419386|ref|ZP_01227296.1| seryl-tRNA synthetase [Aurantimonas manganoxydans SI85-9A1]
 gi|90336323|gb|EAS50064.1| seryl-tRNA synthetase [Aurantimonas manganoxydans SI85-9A1]
          Length = 427

 Score =  526 bits (1354), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 239/425 (56%), Positives = 316/425 (74%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR NP+ LD AL +R   P +E +L LDE+ R  + +++ ++ RRN  S  IG+
Sbjct: 1   MLDIKWIRDNPDKLDAALARRGAAPLAEQLLKLDEERRAHLTRLQTLQGRRNEASKAIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G+ +  + L  E   +KE +   E+ E  +  SL+  ++ IPN+PL++VP G    
Sbjct: 61  AKGTGDEAGAEELIREIGEIKEAIQDGEETERRIDKSLEDALARIPNIPLDDVPEGADET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ IR  G+ P+     +EH+E+GE LGLMDF++A K+SG+RF++L G LA +ERALGQ
Sbjct: 121 DNVEIRRHGEAPNFGFAPKEHYELGEGLGLMDFEQAAKISGSRFTILKGQLARMERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT EHGY E +APLLVRDEA++GTGQ+PKF++D+F T++GRWLIPT+EV LTN+ 
Sbjct: 181 FMLDLHTGEHGYQETAAPLLVRDEALFGTGQLPKFSEDLFHTSEGRWLIPTAEVPLTNMV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             +++ +  LPLRFT L P FRSEAGSAGRDTRGMLRQHQF+K ELVS+T E  S  EHE
Sbjct: 241 REQMLGAGDLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFYKVELVSVTDEGSSIAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM + AEE+LKRL L YRVV+LC GD+GF A KTYD+EVWL GQ+ +REISSCS CG+FQ
Sbjct: 301 RMTAAAEEVLKRLGLSYRVVTLCAGDMGFGARKTYDIEVWLPGQDAFREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM +RYR    K+ ++ HTLNGSGVAVGR LIA++ENY N DGS+T+P  LRPYM  L
Sbjct: 361 ARRMGTRYRVEGEKAARYVHTLNGSGVAVGRALIAVMENYQNEDGSITVPEALRPYMGGL 420

Query: 421 AVIKK 425
             I++
Sbjct: 421 ERIER 425


>gi|49474113|ref|YP_032155.1| seryl-tRNA synthetase [Bartonella quintana str. Toulouse]
 gi|67461757|sp|Q6G036|SYS_BARQU RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|49239617|emb|CAF25976.1| Seryl-tRNA synthetase [Bartonella quintana str. Toulouse]
          Length = 425

 Score =  525 bits (1351), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 245/423 (57%), Positives = 314/423 (74%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+ PE LD AL KR +EPQ+E ++ LD + R  + K++  + RRN+ S +IGQ
Sbjct: 1   MLDIKWIREYPEKLDEALAKRGIEPQAERLIKLDLERRSHVAKVQSAQERRNAASKEIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  + ++ + L+ E   +K  L     EE  +  + ++ +S +PN+PL++V +G   +
Sbjct: 61  ALAACDQTMAEHLRAEVEEIKVFLSSATTEEKRLTENFERALSTLPNIPLDDVSVGKDGS 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N++IR  G         +EHF++G+ L  MDF+RA++LSG RF+VL+G LA LERALGQ
Sbjct: 121 DNVVIRHFGTPAMFDFTPKEHFDLGQNLKQMDFERASRLSGTRFTVLSGALARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D+H  EHGYTEVS PLLVRDE +YG  Q+PKFADD+F TTDGRWLI T+EV LTNL 
Sbjct: 181 FMLDVHVDEHGYTEVSVPLLVRDEIVYGAAQLPKFADDLFRTTDGRWLISTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           ++EI+E   LPLRF++L P FRSEAGSAGRDTRGMLRQHQFWK E+VSIT EE S  E E
Sbjct: 241 NNEILEISDLPLRFSSLTPCFRSEAGSAGRDTRGMLRQHQFWKVEMVSITTEEQSLMELE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE++LKRL L +R V L TGD+GF+A KTYD+EVWL GQ  YREISSCS CG+FQ
Sbjct: 301 RMTECAEDVLKRLGLPFRTVVLSTGDMGFAARKTYDIEVWLPGQGCYREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    K+LKF H+LNGSG AVGRCLIAILENY  ADGS+ IP VL+PY+  +
Sbjct: 361 GRRMNARYRKEGDKTLKFVHSLNGSGTAVGRCLIAILENYQQADGSIIIPDVLQPYVKGM 420

Query: 421 AVI 423
             I
Sbjct: 421 RCI 423


>gi|240850247|ref|YP_002971640.1| seryl-tRNA synthetase [Bartonella grahamii as4aup]
 gi|240267370|gb|ACS50958.1| seryl-tRNA synthetase [Bartonella grahamii as4aup]
          Length = 425

 Score =  522 bits (1345), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 247/423 (58%), Positives = 313/423 (73%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR NPE LD AL  R LEPQ+E ++ LD   R  I K++  + RRN+ S +IGQ
Sbjct: 1   MLDIKWIRDNPEKLDKALVSRGLEPQAERLIQLDLARRSHIAKVQLAQERRNAVSKEIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  +    ++ + E   +K  L     EE ++  SL+K++S +PN+PL++VP G   +
Sbjct: 61  ALAVSDQQKAESFRAEGEEIKIFLSSATAEEKQLTESLEKILSALPNIPLDDVPEGKDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N++IR  G  P+     +EHF++G+ L  M+F+RA++LSG RF+VL+G LA LERALGQ
Sbjct: 121 DNVVIRHFGTPPTFNFTPKEHFDLGQNLKQMNFERASRLSGTRFTVLSGALARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D+H +EHGYTEVS P LVRDE +YG  Q+PKFA+D+F TTDGRWLI T+EV LTNL 
Sbjct: 181 FMLDVHVNEHGYTEVSIPFLVRDEIVYGAAQLPKFAEDLFRTTDGRWLISTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI+E   LPLRF++L+P FRSEAG+AGRDTRGMLRQHQFWK E+VSIT EE S  E E
Sbjct: 241 NDEILEISDLPLRFSSLSPCFRSEAGAAGRDTRGMLRQHQFWKVEMVSITSEEQSLIELE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE+ILKRL L +R V L TGD+GF+A KTYD+EVWL GQ  YREISSCS CG+FQ
Sbjct: 301 RMTECAEDILKRLGLPFRTVVLSTGDMGFAARKTYDIEVWLPGQECYREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    K L F H+LNGSG AVGRCLIA+LENY  ADGS+ IP VL+PYM  +
Sbjct: 361 GRRMNARYRTEGDKKLHFVHSLNGSGTAVGRCLIAVLENYQQADGSIIIPDVLQPYMGGM 420

Query: 421 AVI 423
             I
Sbjct: 421 RCI 423


>gi|49475354|ref|YP_033395.1| seryl-tRNA synthetase [Bartonella henselae str. Houston-1]
 gi|67461759|sp|Q6G419|SYS_BARHE RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|49238160|emb|CAF27369.1| Seryl-tRNA synthetase [Bartonella henselae str. Houston-1]
          Length = 425

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 243/423 (57%), Positives = 313/423 (73%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR++PE LD AL KR +EPQ+E ++ LD + R  + K++  + RRN+ S +IGQ
Sbjct: 1   MLDIKWIREHPEKLDEALAKRGIEPQAERLIKLDLERRSHVAKVQSAQERRNTASKKIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  +  + +  + E   +K  L     EE  +  SL+  +S +PN+PL++VP G   +
Sbjct: 61  ALAVCDQKMAERFRAEVEEIKVFLSSATAEEKRLTESLENALSALPNIPLDDVPEGKDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+++R      +     +EHF++G+ L  MDF+RA++LSG RF+VL+G LA LERALGQ
Sbjct: 121 DNVVLRHFSVPTTFDFTPKEHFDLGQNLKQMDFERASRLSGTRFTVLSGALARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D+H  EHGYTEVS PLLVRDE++YG  Q+PKFADD+F TTDGRWLI T+EV LTNL 
Sbjct: 181 FMLDVHVYEHGYTEVSVPLLVRDESVYGAAQLPKFADDLFRTTDGRWLISTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           ++EI+E   LPLRF++L P FRSEAGSAGRDTRGMLRQHQFWK E+VSIT  E S  E E
Sbjct: 241 NNEILEISDLPLRFSSLTPCFRSEAGSAGRDTRGMLRQHQFWKVEMVSITTAEQSLIELE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE++LKRLDL +R + L TGD+GF+A KTYD+EVWL GQ  YREISSCS CG+FQ
Sbjct: 301 RMTECAEDVLKRLDLPFRTMVLSTGDMGFAARKTYDIEVWLPGQGCYREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    K+L F H+LNGSG AVGRCLIA+LENY  ADGS+ IP VL+PYM  +
Sbjct: 361 GRRMNARYRKEGEKTLHFVHSLNGSGTAVGRCLIAVLENYQQADGSIIIPDVLQPYMRGM 420

Query: 421 AVI 423
             I
Sbjct: 421 RCI 423


>gi|121601913|ref|YP_988834.1| seryl-tRNA synthetase [Bartonella bacilliformis KC583]
 gi|166200601|sp|A1US81|SYS_BARBK RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|120614090|gb|ABM44691.1| seryl-tRNA synthetase [Bartonella bacilliformis KC583]
          Length = 425

 Score =  520 bits (1339), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 242/423 (57%), Positives = 315/423 (74%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL  R +EP +E +++LD + R  + +++  + RRNS S +I Q
Sbjct: 1   MLDIKWIRENPEKLDEALASRGIEPHAERLIALDLERRSHVVEVQCAQERRNSASKEIRQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A G+   V+ +K E   +K  L     +E  +  SL+K++S IPN+PL+ VP G +  
Sbjct: 61  ALAAGDQKTVERIKAEVEEIKTFLSSAAIKEKRLTESLEKILSAIPNIPLDSVPKGENEE 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            NI+IR  G  P+   + +EHF++G+ L  M+F+RA++LSGARF+VL+G LA LERALGQ
Sbjct: 121 ANIVIRHFGTPPTFNFIPKEHFDLGQNLKQMNFERASRLSGARFTVLSGALARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D+H +EHGY E+S PLLVRDE +YG  Q+PKF+DD+F TTDGRWLI T+EV L NL 
Sbjct: 181 FMLDVHVNEHGYEEISLPLLVRDEIVYGAAQLPKFSDDLFRTTDGRWLISTAEVPLVNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + E++    LPLRF++L P FRSEAG+AGRDTRGMLRQHQFWK E+VSIT EE S  E E
Sbjct: 241 NGEVLHESDLPLRFSSLTPCFRSEAGAAGRDTRGMLRQHQFWKVEMVSITTEEQSLIELE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE++LKRL+L +R V L TGD+GF++CKTYD+EVWL GQ  YREISSCS CG+FQ
Sbjct: 301 RMTECAEDVLKRLELPFRTVVLSTGDMGFASCKTYDIEVWLPGQGCYREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    K+L F H+LNGSG A+GRCLIAILENY  ADGS+ IP  L+PYM  +
Sbjct: 361 GRRMNARYRKDGDKTLHFVHSLNGSGTAIGRCLIAILENYQQADGSIIIPGALQPYMKGI 420

Query: 421 AVI 423
           + I
Sbjct: 421 SRI 423


>gi|254469216|ref|ZP_05082621.1| seryl-tRNA synthetase [Pseudovibrio sp. JE062]
 gi|211961051|gb|EEA96246.1| seryl-tRNA synthetase [Pseudovibrio sp. JE062]
          Length = 426

 Score =  516 bits (1330), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 243/424 (57%), Positives = 312/424 (73%), Gaps = 1/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+N E LD AL KR  EP++  ++ LD+  R    K+++ + RRNS S +IG 
Sbjct: 1   MLDIKWIRENQESLDAALAKRGQEPRAAQLVELDDARRSHTTKLQEAQQRRNSASKEIGM 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+ +G+    +ALK E + +K  +   E E+ ++ ++L+  ++ IPN+PL+EVP+G    
Sbjct: 61  AMGQGDKEKAEALKAEVAEIKSFIQNGEDEQRKLNAALEDALAVIPNIPLDEVPVGEDEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+L+ + G+KP      +EH+E+GE LG MDF+ A K+SG+RF +L   +A LERALGQ
Sbjct: 121 DNVLLHTHGEKPELDFEPKEHYELGEKLGGMDFETAAKMSGSRFVILKSQIARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-GRWLIPTSEVSLTNL 239
           FMIDLHT EHGYTEVS PLLVRD A+YGT Q+PKFA+D F   + G WLIPT+EV LTN+
Sbjct: 181 FMIDLHTREHGYTEVSPPLLVRDNALYGTSQLPKFAEDQFRDQETGHWLIPTAEVPLTNM 240

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
            + E +    LP+R T L   FRSEAGSAGRDT GMLRQHQF KCELVS+T E  S  E 
Sbjct: 241 VAGETLAEADLPIRVTALTYCFRSEAGSAGRDTAGMLRQHQFQKCELVSVTDENSSLDEL 300

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           ERM   AE++LK L LHYRVV+LC+GD+GF A KTYD+EVWL GQ+ YREISSCS CG+F
Sbjct: 301 ERMRESAEKVLKLLGLHYRVVTLCSGDMGFGARKTYDIEVWLPGQDAYREISSCSVCGDF 360

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q RRMN+RYR    K+LKF HTLNGSG+AVGRCLIA++ENY NADG++T+P  LRPYMN 
Sbjct: 361 QGRRMNARYRVEGEKALKFVHTLNGSGLAVGRCLIAVMENYQNADGTITVPEALRPYMNG 420

Query: 420 LAVI 423
           L VI
Sbjct: 421 LEVI 424


>gi|319407542|emb|CBI81192.1| Seryl-tRNA synthetase [Bartonella sp. 1-1C]
          Length = 425

 Score =  511 bits (1316), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 241/423 (56%), Positives = 308/423 (72%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR +PE LD AL KR LEPQ++ +   D + R+ + K++  +  RNS S +I Q
Sbjct: 1   MLDIKWIRDHPEELDRALAKRGLEPQAKNLQEFDRERRLHVSKVQQAQELRNSASEKIRQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A G+    + +K E   +K  L     EE  +   L++ +S IPN+PL++ P G   N
Sbjct: 61  ALAVGDKETANRIKAEVEEIKVFLSSAVLEEKRLTDRLEEALSAIPNIPLDDAPEGKDEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+++R  G  P+   L +EHF++G+ L  MDF+RA++LSG+RF+VL+G LA LERALGQ
Sbjct: 121 DNVVMRYFGAPPTFDFLPKEHFDLGQNLKQMDFERASRLSGSRFTVLSGSLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D+H  EHGY E+S PLLVRDE +YG  Q+PKF++D+F T DGRWLI T+EV L NL 
Sbjct: 181 FMLDMHVDEHGYQEISVPLLVRDEIVYGAAQLPKFSEDLFRTIDGRWLISTAEVPLVNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++   LPLRFT+L P FRSEAG+AGRDTRGMLRQHQF K ELVSIT EE S  E E
Sbjct: 241 NSEILDITELPLRFTSLTPCFRSEAGAAGRDTRGMLRQHQFRKVELVSITTEEQSLDELE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE +LKRL L +R V L TGD+GF+A KTYD+EVWL GQ  YREISSCS CG+FQ
Sbjct: 301 RMTECAENVLKRLGLPFRTVVLSTGDMGFAARKTYDIEVWLPGQECYREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    K+L+F H+LNGSG A+GRCLIAILENY  ADGS+ IP VLRPYM ++
Sbjct: 361 GRRMNARYRLEGEKTLRFVHSLNGSGTAIGRCLIAILENYQQADGSIIIPDVLRPYMQDM 420

Query: 421 AVI 423
             I
Sbjct: 421 NYI 423


>gi|319404548|emb|CBI78154.1| Seryl-tRNA synthetase [Bartonella rochalimae ATCC BAA-1498]
          Length = 425

 Score =  509 bits (1311), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 242/423 (57%), Positives = 308/423 (72%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR +PE LD AL KR LEPQ+E +   D + R+ + K++  +  RNS S +I Q
Sbjct: 1   MLDIKWIRDHPEELDRALAKRGLEPQAENLQKFDRERRLHVSKVQQAQELRNSASEKIRQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A G+    + +K E   +K  L     EE  +   L++ +S IPN+PL++VP G   N
Sbjct: 61  ALAVGDKETANRVKAEVEEIKVFLSSAVLEEKRLTDRLEEALSAIPNIPLDDVPEGKDEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+++R  G   +   L +EHF++G+ L  MDF+RA++LSG+RF+VL+G LA LERALGQ
Sbjct: 121 DNVVMRYFGIPQTFDFLPKEHFDLGQNLKQMDFERASRLSGSRFTVLSGSLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D+H  EHGY E+S PLLVRDE +YG  Q+PKF++D+F T DGRWLI T+EV L NL 
Sbjct: 181 FMLDMHVDEHGYQEISVPLLVRDEIVYGAAQLPKFSEDLFRTIDGRWLISTAEVPLVNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++   LPLRFT+L P FRSEAG+AGRDTRGMLRQHQF K ELVSIT EE S  E E
Sbjct: 241 NSEILDITELPLRFTSLTPCFRSEAGAAGRDTRGMLRQHQFRKVELVSITTEEQSLEELE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE +LKRL L +R V L TGD+GF+A KTYD+EVWL GQ  YREISSCS CG+FQ
Sbjct: 301 RMTECAENVLKRLGLPFRTVVLSTGDMGFAARKTYDIEVWLPGQECYREISSCSICGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    K+L+F H+LNGSG A+GRCLIAILENY  ADGS+ IP VLRPYM ++
Sbjct: 361 GRRMNARYRLEGEKTLRFVHSLNGSGTAIGRCLIAILENYQQADGSIIIPDVLRPYMRDM 420

Query: 421 AVI 423
             I
Sbjct: 421 NYI 423


>gi|319899194|ref|YP_004159287.1| Seryl-tRNA synthetase [Bartonella clarridgeiae 73]
 gi|319403158|emb|CBI76717.1| Seryl-tRNA synthetase [Bartonella clarridgeiae 73]
          Length = 425

 Score =  508 bits (1308), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 240/423 (56%), Positives = 305/423 (72%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR +PE LD  L KR +EPQ++ +L  D + R+ + K++  +  RN++S +I Q
Sbjct: 1   MLDIKWIRDHPEELDAVLAKRGIEPQAKNLLEFDLERRLHVSKVQQAQKLRNASSEKIRQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A G+    D +K E   +K  L     EE  +   L+  +S IPN+PL++VP G   N
Sbjct: 61  ALAVGDQKTADHVKAEVEKIKVFLSSAVLEEKRLTDRLEAALSAIPNIPLDDVPEGKDEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N++IR  G  P      +EHF++G+ L  MDF+RA++LSG+RF+VL+G LA LERALGQ
Sbjct: 121 DNVVIRYFGTPPMFDFSPKEHFDLGQNLKQMDFERASRLSGSRFTVLSGSLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLH  EHGY E+S PLLVRDE +YG  Q+PKF++D+F TTDGRWLI T+EV L NL 
Sbjct: 181 FMLDLHVDEHGYQEISVPLLVRDEIVYGAAQLPKFSEDLFRTTDGRWLISTAEVPLVNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++   LPLRFT+L P FRSEAG+AGRDTRGMLRQHQF K ELVSIT EE S  E E
Sbjct: 241 NSEILDVTELPLRFTSLTPCFRSEAGAAGRDTRGMLRQHQFRKVELVSITTEEQSLDELE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE +LK L L +R + L TGD+GF+A KTYD+EVWL GQ  YREISSCS CG+FQ
Sbjct: 301 RMTECAENVLKHLGLPFRTIVLSTGDMGFAARKTYDIEVWLPGQECYREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    K+L F H+LNGSG A+GRCL+AILENY  ADGS+ IP VLRPYM  +
Sbjct: 361 GRRMNARYRLEGEKALHFVHSLNGSGTAIGRCLVAILENYQQADGSIVIPDVLRPYMQGM 420

Query: 421 AVI 423
             I
Sbjct: 421 NYI 423


>gi|239831764|ref|ZP_04680093.1| seryl-tRNA synthetase [Ochrobactrum intermedium LMG 3301]
 gi|239824031|gb|EEQ95599.1| seryl-tRNA synthetase [Ochrobactrum intermedium LMG 3301]
          Length = 407

 Score =  508 bits (1308), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 241/399 (60%), Positives = 302/399 (75%)

Query: 27  SEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQAIAEGNLSLVDALKNETSTLKEQLPI 86
           S  +++LDEK R  + K++  + RRN+ S +IG+A+A  + +  D LK E + LK+ L  
Sbjct: 7   SSELMALDEKRREYVGKVQAAQERRNAASKEIGKAMAAKDAATADKLKAEVAELKDFLAQ 66

Query: 87  LEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSANENILIRSVGKKPSAIHLSREHFEIGE 146
            E EE  +   L   +S IPN+PLE+VP+G   ++N+ IR +G + +     +EHFE+GE
Sbjct: 67  AEDEERRLTRELNDALSSIPNIPLEDVPLGKDESDNVEIRRIGNQRNFAFQPKEHFELGE 126

Query: 147 ALGLMDFDRATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAM 206
           ALG MDF+RA KL+G+RF+VL G LA LERALGQFM+DLHT+EHGYTE   PL+VRDEA+
Sbjct: 127 ALGYMDFERAAKLAGSRFTVLKGPLARLERALGQFMLDLHTTEHGYTETMPPLMVRDEAV 186

Query: 207 YGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAG 266
           YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL + EI+++KSLP R+T L P FRSEAG
Sbjct: 187 YGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLVADEIVDAKSLPQRYTALTPCFRSEAG 246

Query: 267 SAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGD 326
           SAGRDTRGMLRQHQF K E+VSIT  + S  EHERM +CAEE+LKRL L +R V LCTGD
Sbjct: 247 SAGRDTRGMLRQHQFLKVEMVSITDADSSIEEHERMTACAEEVLKRLGLPFRTVVLCTGD 306

Query: 327 LGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSG 386
           +GF A KTYD+EVWL GQN YREISSCS CG+FQ RRMN+RYR    KS +F HTLNGSG
Sbjct: 307 MGFGAQKTYDIEVWLPGQNTYREISSCSVCGDFQGRRMNARYRPEGEKSTRFVHTLNGSG 366

Query: 387 VAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVIKK 425
           VAVGR LIA++ENY   DGS+ IP  L+PYM  L  I+K
Sbjct: 367 VAVGRALIAVMENYQEEDGSIHIPEALQPYMGGLTRIEK 405


>gi|296445300|ref|ZP_06887259.1| seryl-tRNA synthetase [Methylosinus trichosporium OB3b]
 gi|296257255|gb|EFH04323.1| seryl-tRNA synthetase [Methylosinus trichosporium OB3b]
          Length = 440

 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 245/438 (55%), Positives = 307/438 (70%), Gaps = 13/438 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+WIR N    D   ++R+L P S+ +L+LD+  R  I  ++  + RRN+ S +IG 
Sbjct: 1   MYDIKWIRDNAAAFDEGRRRRNLAPLSDSLLALDDSRRAAIGVLQAAQERRNAASKEIGL 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+ E + +  +ALK E + LKE  P LE+ E E  ++L K +S IPN PLE+VP G   N
Sbjct: 61  AMREKDAARAEALKAEVAKLKEDFPQLEQREREASAALDKALSEIPNTPLEQVPEGKDEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +   G+  +     +EHF+IGE L LMDF+ ATKLSGARF V  G +A LERAL Q
Sbjct: 121 ENVEVLRWGEPRNFDFPPKEHFDIGEGLRLMDFESATKLSGARFVVNKGPMARLERALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGR-------------W 227
           FM+DLHT +HGY EV+ PLLVRD+AM+GT Q+PKF DD F  + GR             W
Sbjct: 181 FMLDLHTDQHGYAEVAPPLLVRDDAMFGTAQLPKFRDDQFSVSAGRPSGDDPASETSDYW 240

Query: 228 LIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELV 287
           LIPT+EV LTNL    I++   LPLRFT     FR+EAG+AGRDTRGM+RQHQF+K ELV
Sbjct: 241 LIPTAEVPLTNLVRESILDESQLPLRFTAGTYCFRAEAGAAGRDTRGMIRQHQFYKVELV 300

Query: 288 SITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLY 347
           SIT  E S  EHERM  CAE++L+ L+L YR V+LCTGD+GF++ KTYDLEVWL GQ  Y
Sbjct: 301 SITTPEKSLEEHERMTGCAEKVLQLLELPYRKVTLCTGDMGFASQKTYDLEVWLPGQGKY 360

Query: 348 REISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSV 407
           REISSCS CG+FQ+RRMN+RYR  +SK+ +F HTLNGSGVAVGR L+A+LENY  ADGSV
Sbjct: 361 REISSCSVCGDFQARRMNARYRPADSKATRFVHTLNGSGVAVGRALVAVLENYQEADGSV 420

Query: 408 TIPTVLRPYMNNLAVIKK 425
           T+P VLRPYM  L  I K
Sbjct: 421 TVPKVLRPYMGGLEKIAK 438


>gi|319406057|emb|CBI79687.1| Seryl-tRNA synthetase [Bartonella sp. AR 15-3]
          Length = 425

 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 238/423 (56%), Positives = 306/423 (72%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR +PE LD AL KR LEPQ++ +L  D + R+ + K++  +  RNS S +I Q
Sbjct: 1   MLDIKWIRDHPEELDTALAKRGLEPQAKNLLKFDLERRLYVSKVQQAQELRNSASEKIRQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+  G+    + +K E   +K  L     EE  +   L++ +S IPN+PL++VP G    
Sbjct: 61  ALTAGDQKTANRVKAEVEEIKVFLSAAVLEEKRLTDRLEEALSAIPNIPLDDVPEGKDER 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +NI++R  G  P+   L ++HF++G+ L  MDF+RA++LSG+RF+VL+  LA LERALGQ
Sbjct: 121 DNIVVRYFGTPPTFDFLPKQHFDLGQNLKQMDFERASRLSGSRFTVLSSSLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D+H  EHGY E+S P LVR E +YG  Q+PKF++D+F TTDGRWLI T+EV L NL 
Sbjct: 181 FMLDMHVDEHGYQEISVPFLVRSEIVYGAAQLPKFSEDLFQTTDGRWLISTAEVPLVNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++   LPLRFT+L P FRSEAG+AGRDTRGMLRQHQF K ELVSIT EE S  E E
Sbjct: 241 NSEILDITELPLRFTSLTPCFRSEAGAAGRDTRGMLRQHQFRKVELVSITTEEQSLDELE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE +LKRL L +R V L TGD+GF+A KTYD+EVWL GQ  YREISSCS CG+FQ
Sbjct: 301 RMTECAENVLKRLGLPFRTVVLSTGDMGFTARKTYDIEVWLPGQECYREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR  + K+L F H+LNGSG A+GRCLIAILENY  ADGS+ IP VL+PYM  +
Sbjct: 361 GRRMNARYRLEDKKTLHFVHSLNGSGTAIGRCLIAILENYQQADGSIIIPDVLQPYMQGM 420

Query: 421 AVI 423
           + I
Sbjct: 421 SCI 423


>gi|218516937|ref|ZP_03513777.1| seryl-tRNA synthetase [Rhizobium etli 8C-3]
          Length = 347

 Score =  505 bits (1300), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 230/345 (66%), Positives = 282/345 (81%)

Query: 81  KEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSANENILIRSVGKKPSAIHLSRE 140
           K  LP +E+E+ ++ + L   +S IPN+P ++VP+G   ++N++ R+VG+KP   H  +E
Sbjct: 1   KTLLPAIEEEDRQLTAELNDALSRIPNIPFDDVPVGKDEHDNVVTRTVGEKPRWNHTPKE 60

Query: 141 HFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLL 200
           HFEIGEALG MDF+RA KLSG+RF+VLTG LA LERALGQFMIDLHT EHGYTEVS+PL+
Sbjct: 61  HFEIGEALGYMDFERAAKLSGSRFTVLTGPLARLERALGQFMIDLHTREHGYTEVSSPLM 120

Query: 201 VRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPS 260
           VR EA++GTG +PKF +D+F TTD R+LIPT+EV+LTNL   EI+E + LPLRFT L PS
Sbjct: 121 VRAEALFGTGNLPKFEEDLFKTTDDRYLIPTAEVTLTNLVREEILEQEKLPLRFTALTPS 180

Query: 261 FRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRVV 320
           FRSEAGSAGRDTRGMLRQHQFWKCELVSIT  + +  EHERM +CAEE+LKRL LH+R +
Sbjct: 181 FRSEAGSAGRDTRGMLRQHQFWKCELVSITDADSAIAEHERMTACAEEVLKRLGLHFRTM 240

Query: 321 SLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTH 380
           +LCTGD+GF + KTYDLEVWL GQN +REISSCS CG+FQ+RRMN+RYR  + K+ +F H
Sbjct: 241 TLCTGDMGFGSRKTYDLEVWLPGQNAFREISSCSVCGDFQARRMNARYRGKDDKTNRFVH 300

Query: 381 TLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVIKK 425
           TLNGSG AVGRCLIA+LENYLN DGSVTIP VL PYM  L  I++
Sbjct: 301 TLNGSGTAVGRCLIAVLENYLNEDGSVTIPDVLLPYMGGLTKIER 345


>gi|13471180|ref|NP_102749.1| seryl-tRNA synthetase [Mesorhizobium loti MAFF303099]
 gi|30173204|sp|Q98LC8|SYS_RHILO RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|14021924|dbj|BAB48535.1| seryl-tRNA synthetase [Mesorhizobium loti MAFF303099]
          Length = 434

 Score =  504 bits (1299), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 245/432 (56%), Positives = 314/432 (72%), Gaps = 8/432 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHL---EPQS--EYILSLDEKNRILIKKIEDIRARRNSNS 55
           MLDI+WIR NP+ L  AL KR     E QS  + +++ DE  R  + +++  + RRN+ S
Sbjct: 1   MLDIKWIRDNPKALVEALAKRSWSAGEAQSTVDDLIARDEARREHVTELQTKQERRNAAS 60

Query: 56  AQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
            +IG A+  G+ +L + LK E   +K  +   E  E E+  +L   ++ +PNVPL++VP+
Sbjct: 61  KEIGNAMRSGDAALAEKLKAEVGDIKTFIQNGEARERELDKALTDALAVLPNVPLDDVPV 120

Query: 116 GTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLE 175
           G   ++N++   VGK P+  +  +EHFEIGEALG+MDF+RA KLSG+RF+VL   LA +E
Sbjct: 121 GKDEHDNVVKHIVGKVPTRSNWVKEHFEIGEALGMMDFERAAKLSGSRFTVLKSGLARME 180

Query: 176 RALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW---LIPTS 232
           RA+GQFM+DLHT+EHGY EV  PL+VRDE ++GT Q+PKF +D+F T  G     LIPT+
Sbjct: 181 RAIGQFMLDLHTTEHGYEEVIPPLMVRDEVLFGTNQLPKFEEDLFFTPHGEGRLGLIPTA 240

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI   + LPLRFT L P FRSEAGSAGRDTRGMLRQHQF+K ELVSIT +
Sbjct: 241 EVPLTNLVREEITAHEKLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFYKVELVSITDQ 300

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           + S  EHERM  CAEE+LKRL+L +R + LCTGD+GF A KTYD+EVWL GQN YREISS
Sbjct: 301 DSSLAEHERMTQCAEEVLKRLELPFRTMVLCTGDMGFGARKTYDIEVWLPGQNAYREISS 360

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS CG+FQ+RRM++RY+D + K  +F HTLNGSG AVGR LIA++ENY N DGSVTIP V
Sbjct: 361 CSVCGDFQARRMDARYKDKDGKGNRFVHTLNGSGTAVGRALIAVIENYQNEDGSVTIPEV 420

Query: 413 LRPYMNNLAVIK 424
           LRPYM  LA I+
Sbjct: 421 LRPYMGGLAKIE 432


>gi|154253470|ref|YP_001414294.1| seryl-tRNA synthetase [Parvibaculum lavamentivorans DS-1]
 gi|171769667|sp|A7HXK4|SYS_PARL1 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|154157420|gb|ABS64637.1| seryl-tRNA synthetase [Parvibaculum lavamentivorans DS-1]
          Length = 435

 Score =  503 bits (1295), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 233/431 (54%), Positives = 307/431 (71%), Gaps = 8/431 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR +    D  L KR L PQ+  ++ +DE+ R +I  +++++ RRN  S QIGQ
Sbjct: 1   MFDIKAIRDDAGAFDAGLAKRGLAPQAARLIEIDERRRAIITSLQELQQRRNDASKQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+ + +L  +L  E +++K  +   E++E    + ++  ++ IPN+P ++VP+G   +
Sbjct: 61  AKAKKDDALAQSLMEEVASIKSAIQEGEEKERAANAEIEAALASIPNIPFDDVPVGPDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N++  S GK        +EHF++GEALGLMDF+ A K+SGARF+VL G LA LERA+G 
Sbjct: 121 ANVIRHSHGKAREMNFAPKEHFDLGEALGLMDFEAAAKMSGARFTVLKGQLARLERAIGN 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG--------RWLIPTS 232
           FM+DLHT+E GY EV+ PL+VRD+AM+GT Q+PKF DD F T  G         WLIPT+
Sbjct: 181 FMVDLHTTEFGYEEVAPPLMVRDDAMFGTAQLPKFEDDQFATFKGLARDDQEKYWLIPTA 240

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL    I+  + LP RFT     FR+EAGSAGRDTRGM+RQHQF K ELVSIT  
Sbjct: 241 EVPLTNLVRESILSEEELPKRFTAYTACFRAEAGSAGRDTRGMIRQHQFSKVELVSITTP 300

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E S  EHERMLSCAEE+LKRLDLHYRV++L TGD+GF++ KTYD+EVWL GQN +REISS
Sbjct: 301 EKSREEHERMLSCAEEVLKRLDLHYRVMTLSTGDMGFASRKTYDIEVWLPGQNAFREISS 360

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS CG+FQ+RRMN+RYR    K+ +F HTLNGSG+AVGR L+A++ENY  ADGS+T+PT 
Sbjct: 361 CSVCGDFQARRMNARYRPKGEKNTRFVHTLNGSGLAVGRALVAVMENYQQADGSITVPTA 420

Query: 413 LRPYMNNLAVI 423
           L+PYM    VI
Sbjct: 421 LQPYMGGQEVI 431


>gi|307946877|ref|ZP_07662212.1| seryl-tRNA synthetase [Roseibium sp. TrichSKD4]
 gi|307770541|gb|EFO29767.1| seryl-tRNA synthetase [Roseibium sp. TrichSKD4]
          Length = 425

 Score =  501 bits (1289), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 237/422 (56%), Positives = 310/422 (73%), Gaps = 3/422 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+WIR+N E  D AL KR  EP +  +++LD+  R  I K+++++ RRNS S +IG+
Sbjct: 1   MFDIKWIRENSEAFDAALAKRGYEPSAAKLIALDDARRSHITKLQEVQERRNSTSKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A  +     AL NE + +K  +   E+EE ++ ++++  ++ IPN+P ++VP+G    
Sbjct: 61  AKATKDEEKAQALINEVAEIKAFIQSGEEEERKLVAAVEDAMAVIPNLPHDDVPVGEDEA 120

Query: 121 ENILIRSVGKKPSAI--HLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
           +N+L R+ G+KP+    H  +EHFE+GE  G MDF  A  LSG+RF VL G +A LERAL
Sbjct: 121 DNVLYRTHGEKPTFTFNHAPKEHFELGEENGGMDFSTAANLSGSRFVVLKGQIARLERAL 180

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTN 238
           GQFMID HT EHGYTEVS PLLV D+ ++GT Q+PKF +D+F T D  +LIPT+EV LTN
Sbjct: 181 GQFMIDTHTQEHGYTEVSPPLLVHDKPLFGTSQLPKFEEDLFKTGD-HYLIPTAEVPLTN 239

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L + +I+  ++LP+R + L   FRSEAGSAGRDTRGMLRQHQF KCELVS+T+ EDS  E
Sbjct: 240 LVADQILIDEALPVRVSALTYCFRSEAGSAGRDTRGMLRQHQFQKCELVSVTKPEDSLNE 299

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            ERML CAE IL++L LHYRV++LCTGD+GF A KTYD+EVWL GQ+ YREISSCS CG+
Sbjct: 300 LERMLGCAETILQKLGLHYRVMTLCTGDMGFGARKTYDIEVWLPGQDTYREISSCSVCGD 359

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRMN+R+R    K     HTLNGSG+AVGR LIA+LENY N DG++T+P VLRPYMN
Sbjct: 360 FQARRMNARFRPQGEKQTVHVHTLNGSGIAVGRALIAVLENYQNGDGTITVPEVLRPYMN 419

Query: 419 NL 420
            L
Sbjct: 420 GL 421


>gi|182679617|ref|YP_001833763.1| seryl-tRNA synthetase [Beijerinckia indica subsp. indica ATCC 9039]
 gi|238691238|sp|B2IJG1|SYS_BEII9 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|182635500|gb|ACB96274.1| seryl-tRNA synthetase [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 436

 Score =  501 bits (1289), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 241/435 (55%), Positives = 303/435 (69%), Gaps = 10/435 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+WIR N    D   ++R L   S  +L+LD+  R  I + +  + RRN+ S +IG 
Sbjct: 1   MYDIKWIRDNSALFDQGRERRGLPKLSAELLALDDARRAAIAESQAAQERRNAASKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+   + +  +ALK E + LK   P LE+ E    ++L + ++ IPN+PLE+VP G   N
Sbjct: 61  AMKAKDNARAEALKAEMAELKAVSPALEEAERLAIAALDRALAEIPNLPLEDVPFGRDEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N  +R VG+KP    + +EHF+IGE LGLMDF+ A KLSGARF V  G LA LERALGQ
Sbjct: 121 DNPELRVVGEKPVFSFVPKEHFDIGEGLGLMDFEAAAKLSGARFVVNKGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGR----------WLIP 230
           FM+DLHT EHGYTEV+ P+L RD+A++GT Q+PK  +DMF    GR          WLIP
Sbjct: 181 FMLDLHTGEHGYTEVNPPILARDDALFGTAQLPKLEEDMFAAHAGRVPQEAAGDLYWLIP 240

Query: 231 TSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT 290
           TSEV LTNL    I++ K LPLRFT   P FR+EAGSAGRDTRGM+RQHQF K ELVSIT
Sbjct: 241 TSEVVLTNLVRETILDEKQLPLRFTACTPCFRAEAGSAGRDTRGMIRQHQFTKTELVSIT 300

Query: 291 REEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREI 350
             E++  EHERML+CAEE+LKRL L YRVV+LCTGD+GF++ KTYD+EVWL GQ  YREI
Sbjct: 301 TPEEALVEHERMLTCAEEVLKRLGLAYRVVTLCTGDMGFASQKTYDIEVWLPGQGRYREI 360

Query: 351 SSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIP 410
           SSCS CG+FQ+RRMN+RYR    K+ +F HTLNGSGVAVGR L+A+LENY   DG V +P
Sbjct: 361 SSCSVCGDFQARRMNARYRPEGGKTTRFVHTLNGSGVAVGRALVAVLENYQREDGGVNVP 420

Query: 411 TVLRPYMNNLAVIKK 425
             L PYM  +  I +
Sbjct: 421 RALLPYMGGITTITR 435


>gi|114707229|ref|ZP_01440127.1| seryl-tRNA synthetase [Fulvimarina pelagi HTCC2506]
 gi|114537425|gb|EAU40551.1| seryl-tRNA synthetase [Fulvimarina pelagi HTCC2506]
          Length = 473

 Score =  500 bits (1288), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 246/469 (52%), Positives = 313/469 (66%), Gaps = 46/469 (9%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M+DI+WIR NP  LD ALK R   P +  ++ LDEK R  +K ++D++ARRN  S  IG+
Sbjct: 1   MIDIRWIRDNPNKLDEALKARGAGPAAIDLIKLDEKRRDHLKILQDLQARRNEASKAIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G+ +  + L  E + +K QL   E EE  + ++L+  +S +PNVPLE+VP+G    
Sbjct: 61  AKGSGDDAKAEELIGEVAKIKSQLQAGEAEERRIDAALRDGLSRLPNVPLEDVPVGADEG 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N  +R VG+KPS     +EH+E+GEALGLMDF+ A K+SG+RF+VL G LA LERALGQ
Sbjct: 121 DNAELRKVGEKPSFAFKPKEHYELGEALGLMDFELAGKISGSRFNVLRGELARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF--CTTDGR------------ 226
           FM+DLHT EHGY EV  P+LVR++AMYGT Q+PKF +D+F   +  GR            
Sbjct: 181 FMLDLHTGEHGYEEVQPPVLVRNDAMYGTSQLPKFGEDLFIGASMTGRAQQTDDVLAQYT 240

Query: 227 --------------------------------WLIPTSEVSLTNLYSHEIIESKSLPLRF 254
                                           WLIPT+EV LTNL   E + +++LP R 
Sbjct: 241 RPEDIERLKSGEIEVRELVANAFEDAPTEEQFWLIPTAEVPLTNLVREETLSAEALPRRM 300

Query: 255 TTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLD 314
           T L P FRSEAGSAGRDTRGMLRQHQF K ELVSIT E+ S  E ERM +CAEE+LKRL 
Sbjct: 301 TALTPCFRSEAGSAGRDTRGMLRQHQFNKVELVSITDEQSSLAELERMTACAEEVLKRLG 360

Query: 315 LHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSK 374
           L YRVV+LCTGD+GF+A KTYD+EVWL GQ+ YREISSCS CG+FQ+RRMN+RY+    K
Sbjct: 361 LPYRVVTLCTGDMGFAARKTYDIEVWLPGQDTYREISSCSVCGDFQARRMNARYKAEGEK 420

Query: 375 SLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVI 423
             +F HTLNGSGVAVGR LIA++ENY   DGS+ +P VL+PY+  +  I
Sbjct: 421 QQRFVHTLNGSGVAVGRALIAVMENYQQEDGSILVPDVLKPYIGGVERI 469


>gi|260459791|ref|ZP_05808045.1| seryl-tRNA synthetase [Mesorhizobium opportunistum WSM2075]
 gi|259034593|gb|EEW35850.1| seryl-tRNA synthetase [Mesorhizobium opportunistum WSM2075]
          Length = 434

 Score =  500 bits (1287), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 243/432 (56%), Positives = 314/432 (72%), Gaps = 8/432 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHL---EPQS--EYILSLDEKNRILIKKIEDIRARRNSNS 55
           MLDI+WIR NP+ L  AL KR     E QS  + ++++DE  R  + +++  + RRN+ S
Sbjct: 1   MLDIKWIRDNPKALVEALVKRSWSAAEAQSTVDELIAMDEARREHVTELQTSQERRNAAS 60

Query: 56  AQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
            +IG A+  G+ +L + LK E   +K  +   E  E E+  +L   ++ +PNVP ++VP+
Sbjct: 61  KEIGNAMRSGDAALAERLKAEVGEIKTFIQNGEARERELDKALNDALAVLPNVPFDDVPV 120

Query: 116 GTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLE 175
           G   ++N++   VG+ P+  +  +EHFEIGEALG+MDF+RA KLSG+RF+VL   LA +E
Sbjct: 121 GKDEHDNVVKHIVGEVPTRRNWVKEHFEIGEALGMMDFERAAKLSGSRFTVLKSGLARME 180

Query: 176 RALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT--DGRW-LIPTS 232
           RA+GQFM+DLHT+EHGY E+  PL+VRDE ++GT Q+PKF +D+F T   DGR  LIPT+
Sbjct: 181 RAIGQFMLDLHTNEHGYEEIIPPLMVRDEVLFGTNQLPKFEEDLFFTQHGDGRLGLIPTA 240

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI   + LPLR+T L P FRSEAGSAGRDTRGMLRQHQF+K ELVSIT +
Sbjct: 241 EVPLTNLVREEITAHEKLPLRYTALTPCFRSEAGSAGRDTRGMLRQHQFYKVELVSITDQ 300

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E S  EHERM  CAEE+LKRL L +R + LCTGD+GF A KTYD+EVWL GQN YREISS
Sbjct: 301 ESSLAEHERMTQCAEEVLKRLGLPFRTMVLCTGDMGFGARKTYDIEVWLPGQNAYREISS 360

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS CG+FQ+RRM++RY+D + K  +F HTLNGSG AVGR LIA++ENY N DGSVTIP V
Sbjct: 361 CSVCGDFQARRMDARYKDKDGKGNRFVHTLNGSGTAVGRALIAVIENYQNEDGSVTIPEV 420

Query: 413 LRPYMNNLAVIK 424
           LRPYM  L  I+
Sbjct: 421 LRPYMGGLEKIE 432


>gi|323137658|ref|ZP_08072734.1| seryl-tRNA synthetase [Methylocystis sp. ATCC 49242]
 gi|322396955|gb|EFX99480.1| seryl-tRNA synthetase [Methylocystis sp. ATCC 49242]
          Length = 427

 Score =  498 bits (1281), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 235/425 (55%), Positives = 293/425 (68%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+WIR+N E  D   K+R LEP S  +L+ D+  R  I +++  + RRN+ S +IG 
Sbjct: 1   MYDIKWIRENAELFDNGRKRRGLEPLSAQLLAFDDARRAAIAQLQVAQERRNAASREIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+  G+ +  +ALK E + +KE  P LE+ E    + L   ++ IPN PL+ VP G   N
Sbjct: 61  AMKAGDSAKAEALKAEVAQIKENWPALEEAERYAVAELDAALAAIPNTPLDAVPDGADEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G+        +EHFEIGE LGLMDF+ A KLSGARF V  G LA LERAL Q
Sbjct: 121 DNVEVSRWGEPRKFDFAPKEHFEIGEGLGLMDFETAAKLSGARFVVNKGPLARLERALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT  HGY EV+ PLLVRD+AM+GT Q+PKF +D F   DG WLIPT+EV LTNL 
Sbjct: 181 FMLDLHTGAHGYVEVNPPLLVRDDAMFGTAQLPKFREDQFAAGDGYWLIPTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
              I++   LP+R T     FR+EAG+AG+DTRGM+RQHQF+K ELVSIT  E S  EHE
Sbjct: 241 RESILDETQLPIRMTAGTYCFRAEAGAAGKDTRGMIRQHQFYKVELVSITTPEQSLEEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE +L+ L L YR V LCTGD+GF++ KTYDLEVWL GQ  YREISSCS CG+FQ
Sbjct: 301 RMTGCAERVLQTLGLPYRKVVLCTGDMGFASQKTYDLEVWLPGQGKYREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM +RYR   SK  +F HTLNGSGVAVGR ++A+LENY  ADGSVTIP  LRPYM  +
Sbjct: 361 ARRMGARYRPAESKGPRFVHTLNGSGVAVGRAMVAVLENYQEADGSVTIPQALRPYMGGM 420

Query: 421 AVIKK 425
             I +
Sbjct: 421 ERIAR 425


>gi|209885385|ref|YP_002289242.1| seryl-tRNA synthetase [Oligotropha carboxidovorans OM5]
 gi|229890229|sp|B6JFP3|SYS_OLICO RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|209873581|gb|ACI93377.1| seryl-tRNA synthetase [Oligotropha carboxidovorans OM5]
          Length = 439

 Score =  498 bits (1281), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 240/439 (54%), Positives = 305/439 (69%), Gaps = 14/439 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+WIR NPE  D AL +R LEPQ+  +++LDEK R  I   E  +ARRN+ S +IG+
Sbjct: 1   MHDIRWIRDNPEAFDAALGRRGLEPQAAALIALDEKRRGAIAAFEQAQARRNAASKEIGE 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A      +  DAL  E   LK +LP ++     +   L+K ++ IPN+PL EVP G   +
Sbjct: 61  AKKAKENARADALMAEVGELKTKLPEMDAAAKRLEEDLRKELAQIPNLPLAEVPEGADEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+     G+  S     +EH  +GE LG MDF+RA KLSGARF VL   LA LERA+GQ
Sbjct: 121 GNVQHHVYGEPRSYAFKPKEHVALGEGLGFMDFERAAKLSGARFVVLKSGLARLERAIGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT------TDGRWLIPTSEV 234
           F +D+HT EHGYTEV+ PLLVRD+AM+GT Q+PKF +D F          G WLIPT+EV
Sbjct: 181 FFLDVHTGEHGYTEVNPPLLVRDDAMFGTAQLPKFREDQFAAGSLDAEGQGYWLIPTAEV 240

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            LTNL    I++ K LP+R T L P FR+EAG+AGRDTRGM+RQHQF K ELVSIT  ++
Sbjct: 241 PLTNLVRESILDEKELPMRLTALTPCFRAEAGAAGRDTRGMIRQHQFTKVELVSITTPDE 300

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQ-------NLY 347
           S  EHERMLSCAEE+LKRL LHYRV++LCTGD+GF++ KTYD+EVW+ GQ        +Y
Sbjct: 301 SRNEHERMLSCAEEVLKRLGLHYRVMTLCTGDMGFASQKTYDIEVWMPGQISSQGEGGMY 360

Query: 348 REISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSV 407
           REISSCS CG+FQ+RRM++RYR P++K   F HTLNGSG AVGR LIA++E Y   DGS+
Sbjct: 361 REISSCSVCGDFQARRMDARYRGPDNKP-HFVHTLNGSGTAVGRALIAVMETYQQEDGSI 419

Query: 408 TIPTVLRPYMNNLAVIKKE 426
            +P VL+PYM  L VI+++
Sbjct: 420 AVPDVLQPYMGGLKVIERD 438


>gi|319783192|ref|YP_004142668.1| seryl-tRNA synthetase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317169080|gb|ADV12618.1| seryl-tRNA synthetase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 434

 Score =  497 bits (1280), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 242/432 (56%), Positives = 310/432 (71%), Gaps = 8/432 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHL---EPQSEY--ILSLDEKNRILIKKIEDIRARRNSNS 55
           MLDI+WIR NP+ L  AL KR     E QS    +++ DE  R  + +++  + RRN+ S
Sbjct: 1   MLDIKWIRDNPKALVEALVKRSWSADEAQSTVGGLIASDEARREHVTELQTKQERRNAAS 60

Query: 56  AQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
            +IG A+  G+ +L + LK E   +K  +   E  E E+  +L   ++ +PNVP ++VP+
Sbjct: 61  KEIGNAMRSGDAALAETLKAEVGEIKVFIQNGEARERELDKALNDALAVLPNVPFDDVPV 120

Query: 116 GTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLE 175
           G   ++N++   VGK P+  +  +EHFEIGEALG+MDF+RA KLSG+RF+VL   LA +E
Sbjct: 121 GKDEHDNVVKHIVGKVPTRPNWVKEHFEIGEALGMMDFERAAKLSGSRFTVLKNGLARME 180

Query: 176 RALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW---LIPTS 232
           RALGQFM+DLHT+EHGY EV  PL+V+D  ++GT Q+PKF +D+F T  G     LIPT+
Sbjct: 181 RALGQFMLDLHTTEHGYEEVIPPLMVKDNVLFGTNQLPKFEEDLFFTPHGEGRLGLIPTA 240

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI   + LPLR+T L P FRSEAGSAGRDTRGMLRQHQF+K ELVSIT +
Sbjct: 241 EVPLTNLVREEITAHEKLPLRYTALTPCFRSEAGSAGRDTRGMLRQHQFYKVELVSITDQ 300

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E S  EHERM  CAEE+LKRL L +R ++LCTGD+GF A KTYD+EVWL GQN YREISS
Sbjct: 301 ESSLAEHERMTQCAEEVLKRLGLPFRTMTLCTGDMGFGARKTYDIEVWLPGQNAYREISS 360

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS CG+FQ+RRM++RY+D + K  +F HTLNGSG AVGR LIA++ENY N DGSVTIP V
Sbjct: 361 CSVCGDFQARRMDARYKDKDGKGNRFVHTLNGSGTAVGRALIAVIENYQNEDGSVTIPEV 420

Query: 413 LRPYMNNLAVIK 424
           LRPYM  L  I+
Sbjct: 421 LRPYMGGLEKIE 432


>gi|188583939|ref|YP_001927384.1| seryl-tRNA synthetase [Methylobacterium populi BJ001]
 gi|238692895|sp|B1ZJ12|SYS_METPB RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|179347437|gb|ACB82849.1| seryl-tRNA synthetase [Methylobacterium populi BJ001]
          Length = 428

 Score =  496 bits (1278), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 236/424 (55%), Positives = 298/424 (70%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NPE  D  L++R L P S  +++LD+  +  +   +  + RRN+ S +IG 
Sbjct: 1   MHDIRAIRENPEAFDRDLERRGLSPLSAELIALDDARKGAVSAAQAAQERRNALSKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A    + +    L  E + LKE+ P L+  + +    L + ++ IPN P  +VP+G   +
Sbjct: 61  AKKAKDEARAAELMAEVARLKEEAPGLDAAQAQAAKVLDERLAAIPNQPKADVPLGADEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+  R      + +   R+HFE+GEA GLMDF+ A KLSG+RF VL G LA LERALGQ
Sbjct: 121 GNVEYRRFDSSRARLAEGRQHFELGEATGLMDFEAAAKLSGSRFVVLKGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT EHGYTEV  P+LVRDEAM+GT Q+PKF DD F   DG WLIPT+EV LTNL 
Sbjct: 181 FMLDLHTGEHGYTEVVPPVLVRDEAMFGTAQLPKFRDDQFAAGDGFWLIPTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
              I+    LPLRFT L P FR+EAG+AGRDTRGMLRQHQF K ELVSIT  E S  EHE
Sbjct: 241 RENILAEDELPLRFTALTPCFRAEAGAAGRDTRGMLRQHQFNKVELVSITAPEKSAEEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML+CAE +L++LDL YRV++LCTGD+GF++ KTYD+EVW+ GQ  YREISSCS CG FQ
Sbjct: 301 RMLACAEAVLQKLDLTYRVMTLCTGDMGFASQKTYDIEVWVPGQQTYREISSCSVCGEFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR    + + F HTLNGSGVAVGR LIA++ENY N DGSVTIP+VL+PYM  L
Sbjct: 361 ARRMNARYRAKEGRGVGFVHTLNGSGVAVGRALIAVMENYQNPDGSVTIPSVLQPYMGGL 420

Query: 421 AVIK 424
             I+
Sbjct: 421 NRIE 424


>gi|118589124|ref|ZP_01546531.1| seryl-tRNA synthetase [Stappia aggregata IAM 12614]
 gi|118438453|gb|EAV45087.1| seryl-tRNA synthetase [Stappia aggregata IAM 12614]
          Length = 426

 Score =  496 bits (1277), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 233/425 (54%), Positives = 311/425 (73%), Gaps = 2/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+WIR+N    D AL KR  E  +  +++LD+  R  I K+++ + RRN+ S +IG+
Sbjct: 1   MFDIRWIRENAAAFDQALAKRGYEASAAKLIALDDSRRSHITKLQEAQERRNAASKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G+ +    L +E + +K  +   E+EE ++ + L+  ++ IPN+P ++VP+G    
Sbjct: 61  AKGSGDDARAQELIDEVAQIKAFIQSGEEEERKLIADLEAAMAVIPNLPHDDVPVGEDET 120

Query: 121 ENILIRSVGKKP--SAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
           +N+L+++ G+KP  +     +EH+E+GE LG MDF +A KLSG+RF +L G +A LERAL
Sbjct: 121 DNVLLKTHGEKPVFTFNEAPKEHYELGEDLGGMDFAKAAKLSGSRFVILKGQIARLERAL 180

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTN 238
           GQFMIDLHT E+GYTEVS PLLV  E +YGTGQ+PKF +D+F TT   +LIPT+E+ LTN
Sbjct: 181 GQFMIDLHTQENGYTEVSPPLLVHSEPLYGTGQLPKFEEDLFKTTTDHYLIPTAEIPLTN 240

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L + EI+    LPLR T L   FRSEAGSAGRDTRGMLRQHQF KCELVS+T+ E+S  E
Sbjct: 241 LVAGEILPEDQLPLRVTALTYCFRSEAGSAGRDTRGMLRQHQFQKCELVSVTKPEESLDE 300

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            ERML CAE++L++L LHYRV++LC+GD+GF A KTYD+EVWL GQ+ YREISSCS CG+
Sbjct: 301 LERMLGCAEKVLQKLGLHYRVMTLCSGDMGFGARKTYDIEVWLPGQDTYREISSCSVCGD 360

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRMN+R+R  +SK     HTLNGSG+AVGR LIA+LENY N DG++T+P VLRPYM 
Sbjct: 361 FQARRMNARFRPADSKQPVHVHTLNGSGIAVGRALIAVLENYQNGDGTITVPEVLRPYMG 420

Query: 419 NLAVI 423
            L  I
Sbjct: 421 GLEKI 425


>gi|254503029|ref|ZP_05115180.1| seryl-tRNA synthetase [Labrenzia alexandrii DFL-11]
 gi|222439100|gb|EEE45779.1| seryl-tRNA synthetase [Labrenzia alexandrii DFL-11]
          Length = 426

 Score =  493 bits (1270), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 236/425 (55%), Positives = 307/425 (72%), Gaps = 2/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+WIR+N +  D AL KR  EP +  +++LD+  R  I K+++ + RRN+ S +IG+
Sbjct: 1   MFDIKWIRENADAFDKALAKRGYEPSAANLIALDDSRRSHITKLQEAQERRNAASKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G+      L +E + +K  +   E+EE ++ ++L++ ++ IPN+P ++VP G    
Sbjct: 61  AKGSGDDVRAQELIDEVAQIKAFIQSGEEEERKLIAALEEAMAVIPNLPHDDVPEGADEA 120

Query: 121 ENILIRSVGKKPSAI--HLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
            N+L ++ G+KP+       +EH+E+GE LG MDF  A KLSG+RF VL G +A LERAL
Sbjct: 121 GNVLYKTHGEKPAFTFNEAPKEHYELGEELGGMDFSTAAKLSGSRFVVLKGQIARLERAL 180

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTN 238
           GQFMID+HT E+GYTEVS PLLV  + +YGTGQ+PKF +D+F T    +LIPT+EV LTN
Sbjct: 181 GQFMIDMHTQENGYTEVSPPLLVHSDPLYGTGQLPKFEEDLFKTATDHYLIPTAEVPLTN 240

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L + EI+    LPLR T L   FRSEAGSAGRDTRGMLRQHQF KCELVS+T  E+S  E
Sbjct: 241 LVAGEIMSEDQLPLRVTALTYCFRSEAGSAGRDTRGMLRQHQFQKCELVSVTTPEESLNE 300

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            ERML CAE IL++L LHYRV++LCTGD+GF A KTYD+EVWL GQ+ +REISSCS CG+
Sbjct: 301 LERMLGCAEMILQKLGLHYRVMTLCTGDMGFGARKTYDIEVWLPGQDTFREISSCSVCGD 360

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRMN+R+R   SK     HTLNGSG+AVGR LIA+LENY NADGS+T+P VLRPYM 
Sbjct: 361 FQARRMNARFRPAGSKQPVHVHTLNGSGIAVGRALIAVLENYQNADGSITVPDVLRPYMG 420

Query: 419 NLAVI 423
            L  I
Sbjct: 421 GLEKI 425


>gi|163853631|ref|YP_001641674.1| seryl-tRNA synthetase [Methylobacterium extorquens PA1]
 gi|238687369|sp|A9VY49|SYS_METEP RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|163665236|gb|ABY32603.1| seryl-tRNA synthetase [Methylobacterium extorquens PA1]
          Length = 428

 Score =  493 bits (1268), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 234/424 (55%), Positives = 296/424 (69%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NPE  D  L++R L P S  +++LD+  +  +   +  + RRN+ S +IG 
Sbjct: 1   MHDIRAIRENPEAFDRDLERRGLAPLSAELIALDDARKGAVSAAQAAQERRNALSKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A    + +    L  E + LKE+ P LE  + E   +L + ++ IPN P ++VP G   +
Sbjct: 61  AKKAKDEARATELMAEVARLKEEAPGLEAAQGEAAKALDERLAAIPNRPKDDVPPGADEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+  R        +   R+HFE+GEA GLMDF+ A KLSG+RF VL G LA LERALGQ
Sbjct: 121 GNVEYRRFDSSRERLAQGRQHFELGEATGLMDFEAAAKLSGSRFVVLKGQLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT EHGYTEV  P+LVR+EAM+GT Q+PKF DD F   +  WLIPT+EV LTNL 
Sbjct: 181 FMLDLHTGEHGYTEVVPPVLVREEAMFGTAQLPKFRDDQFAAGENFWLIPTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
              I+    LPLRFT L P FR+EAG+AGRDTRGMLRQHQF K ELVSIT  E S  EHE
Sbjct: 241 RESILAEDELPLRFTALTPCFRAEAGAAGRDTRGMLRQHQFNKVELVSITAPEKSAEEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML+CAE +L++LDL YRV++LCTGD+GF++ KTYD+EVW+ GQ  YREISSCS CG FQ
Sbjct: 301 RMLACAEAVLQKLDLTYRVMTLCTGDMGFASQKTYDIEVWVPGQQTYREISSCSVCGEFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR    + + F HTLNGSGVAVGR LIA++ENY N DGSVTIP+ L+PYM  L
Sbjct: 361 ARRMNARYRAKEGRGVGFVHTLNGSGVAVGRALIAVMENYQNPDGSVTIPSALQPYMGGL 420

Query: 421 AVIK 424
             I+
Sbjct: 421 TRIE 424


>gi|240141053|ref|YP_002965533.1| serine tRNA synthetase; also charges selenocystein tRNA with serine
           [Methylobacterium extorquens AM1]
 gi|240011030|gb|ACS42256.1| serine tRNA synthetase; also charges selenocystein tRNA with serine
           [Methylobacterium extorquens AM1]
          Length = 428

 Score =  493 bits (1268), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 234/424 (55%), Positives = 296/424 (69%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NPE  D  L++R L P S  +++LD+  +  +   +  + RRN+ S +IG 
Sbjct: 1   MHDIRAIRENPEAFDRDLERRGLAPLSAELIALDDARKGAVSAAQAAQERRNALSKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A    + +    L  E + LKE+ P LE  + E   +L + ++ IPN P ++VP G   +
Sbjct: 61  AKKAKDEARATELMAEVARLKEEAPGLEAAQGEAAKALDERLAAIPNRPKDDVPPGADEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+  R        +   R+HFE+GEA GLMDF+ A KLSG+RF VL G LA LERALGQ
Sbjct: 121 GNVEYRRFDSSRERLTQGRQHFELGEATGLMDFEAAAKLSGSRFVVLKGQLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT EHGYTEV  P+LVR+EAM+GT Q+PKF DD F   +  WLIPT+EV LTNL 
Sbjct: 181 FMLDLHTGEHGYTEVVPPVLVREEAMFGTAQLPKFRDDQFAAGENFWLIPTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
              I+    LPLRFT L P FR+EAG+AGRDTRGMLRQHQF K ELVSIT  E S  EHE
Sbjct: 241 RESILAEDELPLRFTALTPCFRAEAGAAGRDTRGMLRQHQFNKVELVSITAPEKSAEEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML+CAE +L++LDL YRV++LCTGD+GF++ KTYD+EVW+ GQ  YREISSCS CG FQ
Sbjct: 301 RMLACAEAVLQKLDLTYRVMTLCTGDMGFASQKTYDIEVWVPGQQTYREISSCSVCGEFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR    + + F HTLNGSGVAVGR LIA++ENY N DGSVTIP+ L+PYM  L
Sbjct: 361 ARRMNARYRAKEGRGVGFVHTLNGSGVAVGRALIAVMENYQNPDGSVTIPSALQPYMGGL 420

Query: 421 AVIK 424
             I+
Sbjct: 421 TRIE 424


>gi|218532490|ref|YP_002423306.1| seryl-tRNA synthetase [Methylobacterium chloromethanicum CM4]
 gi|254783035|sp|B7KPY5|SYS_METC4 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|218524793|gb|ACK85378.1| seryl-tRNA synthetase [Methylobacterium chloromethanicum CM4]
          Length = 428

 Score =  491 bits (1265), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 234/424 (55%), Positives = 296/424 (69%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NPE  D  L++R L P S  +++LD+  +  +   +  + RRN+ S +IG 
Sbjct: 1   MHDIRAIRENPEAFDRDLERRGLAPLSAELIALDDVRKGAVSAAQAAQERRNALSKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A    + +    L  E + LKE+ P LE  + E   +L + ++ IPN P ++VP G   +
Sbjct: 61  AKKAKDEARATELMAEVARLKEEAPGLEAAQGEAAKALDERLAAIPNRPKDDVPPGADEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+  R        +   R+HFE+GEA GLMDF+ A KLSG+RF VL G LA LERALGQ
Sbjct: 121 GNVEYRRFDSSRERLTQGRQHFELGEATGLMDFEAAAKLSGSRFVVLKGQLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT EHGYTEV  P+LVR+EAM+GT Q+PKF DD F   +  WLIPT+EV LTNL 
Sbjct: 181 FMLDLHTGEHGYTEVVPPVLVREEAMFGTAQLPKFRDDQFAAGENFWLIPTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
              I+    LPLRFT L P FR+EAG+AGRDTRGMLRQHQF K ELVSIT  E S  EHE
Sbjct: 241 RESILAEDELPLRFTALTPCFRAEAGAAGRDTRGMLRQHQFNKVELVSITAPEKSAEEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML+CAE +L++LDL YRV++LCTGD+GF++ KTYD+EVW+ GQ  YREISSCS CG FQ
Sbjct: 301 RMLACAEAVLQKLDLTYRVMTLCTGDMGFASQKTYDIEVWVPGQQTYREISSCSVCGEFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR    + + F HTLNGSGVAVGR LIA++ENY N DGSVTIP+ L+PYM  L
Sbjct: 361 ARRMNARYRAKEGRGVGFVHTLNGSGVAVGRALIAVMENYQNPDGSVTIPSALQPYMGGL 420

Query: 421 AVIK 424
             I+
Sbjct: 421 TRIE 424


>gi|328543816|ref|YP_004303925.1| Seryl-tRNA synthetase [polymorphum gilvum SL003B-26A1]
 gi|326413560|gb|ADZ70623.1| Seryl-tRNA synthetase [Polymorphum gilvum SL003B-26A1]
          Length = 426

 Score =  489 bits (1259), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 235/425 (55%), Positives = 309/425 (72%), Gaps = 2/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+WIR N +  D AL +R  E  +E +LSLD+  R  I ++++ + RRN+ S ++G+
Sbjct: 1   MFDIKWIRDNADAFDRALARRGHESAAERLLSLDDARRAHIARLQEAQERRNAASKEVGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +   AL +E + +K  +   E+EE  + +++   ++ IPN+PL+EVP G    
Sbjct: 61  AKASGDEAAAQALIDEVAKIKSFIQQGEEEERRLVAAVDAALAVIPNLPLDEVPDGADET 120

Query: 121 ENILIRSVGKKPSAI--HLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
            N++    G+K +    H  +EHFE+  A   MDF  A KLSG+RF +L G LA LERAL
Sbjct: 121 GNVVHHVWGEKLAFDFDHAPKEHFELAAAEADMDFATAAKLSGSRFVLLKGQLARLERAL 180

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTN 238
           GQFM+DLHT EHGYTEV+ PLLVR +A+YGT Q+PKF +D+F T+   +L+PT+EV LTN
Sbjct: 181 GQFMLDLHTGEHGYTEVAPPLLVRADALYGTSQLPKFEEDLFKTSSDHYLVPTAEVPLTN 240

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           + + EI+    LPLR + L   FRSEAGSAGRD RGMLRQHQF KCELVS+TR EDS +E
Sbjct: 241 MVAGEILGEGDLPLRVSALTHCFRSEAGSAGRDVRGMLRQHQFVKCELVSVTRPEDSLSE 300

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            ERML CAE +L++L LHYRVV+LCTGD+GF++ KTYD+EVWL GQN YREISSCS CG+
Sbjct: 301 LERMLGCAETVLQKLGLHYRVVTLCTGDMGFASQKTYDIEVWLPGQNAYREISSCSVCGD 360

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRMN+RYR  + K+L+  HTLNGSGVAVGR +IA++ENY NADGSVT+P  LRPYMN
Sbjct: 361 FQARRMNARYRLTDGKALRHVHTLNGSGVAVGRAMIAVMENYQNADGSVTVPEALRPYMN 420

Query: 419 NLAVI 423
            +  I
Sbjct: 421 GIERI 425


>gi|83311620|ref|YP_421884.1| seryl-tRNA synthetase [Magnetospirillum magneticum AMB-1]
 gi|123541738|sp|Q2W4A0|SYS_MAGSA RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|82946461|dbj|BAE51325.1| Seryl-tRNA synthetase [Magnetospirillum magneticum AMB-1]
          Length = 422

 Score =  488 bits (1257), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 229/423 (54%), Positives = 297/423 (70%), Gaps = 2/423 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M D++ IR NP+  D  LK+R LEP++  IL LD + R      ++++ARRN  S QIG 
Sbjct: 1   MHDLKSIRDNPDGFDAGLKRRGLEPKAAAILDLDTRRRAAQTAFQEMQARRNDASKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G  +   AL +E ++LKE++P  E+E+  + + ++ +++ IPN+P  +VP G   +
Sbjct: 61  LKKSGGDA--SALMDEVASLKERMPAAEEEDKALGAEIESILASIPNLPASDVPDGPDED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G   S    + +H  IG  LGLMDFD A KLSGARF VL G LA L+RA+GQ
Sbjct: 119 HNVELRKWGTPKSFAFTALDHDAIGAKLGLMDFDGAAKLSGARFVVLKGQLARLQRAIGQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DL T EHGYTE+  PL+V+D A +GTGQ+PKF +D+F T  G WLIPT+EV LTNL 
Sbjct: 179 FMLDLQTVEHGYTEMDPPLMVKDGAAFGTGQLPKFGEDLFKTNTGHWLIPTAEVPLTNLV 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           S EI++ K+LPLR T L P FRSEAG+AG+DTRGM+RQHQF K E+VSI   + S  EHE
Sbjct: 239 SDEILDEKALPLRMTALTPCFRSEAGAAGKDTRGMIRQHQFHKVEMVSIAHPDASGAEHE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE +L+RL L YRV+ LCTGD+GFSA KTYD+EVWL GQ  YREISSCS CG+FQ
Sbjct: 299 RMTQCAETVLQRLGLAYRVIVLCTGDMGFSAQKTYDIEVWLPGQQRYREISSCSNCGDFQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM +R+R    K  +F HTLNGSG+AVGR LIA++ENY   DG++ +P  LRPYM  L
Sbjct: 359 ARRMKARFRPEGEKGTRFVHTLNGSGLAVGRTLIAVMENYQREDGTIEVPEALRPYMGGL 418

Query: 421 AVI 423
            VI
Sbjct: 419 EVI 421


>gi|254563567|ref|YP_003070662.1| serine tRNA synthetase; also charges selenocystein tRNA with serine
           [Methylobacterium extorquens DM4]
 gi|254270845|emb|CAX26850.1| serine tRNA synthetase; also charges selenocystein tRNA with serine
           [Methylobacterium extorquens DM4]
          Length = 428

 Score =  488 bits (1257), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 234/424 (55%), Positives = 296/424 (69%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NPE  D  L++R L P S  +++LD+  +  +   +  + RRN+ S +IG 
Sbjct: 1   MHDIRAIRENPEAFDRDLERRGLGPLSAELIALDDARKAAVSAAQAAQERRNALSKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A    + +    L  E + LKE+ P LE  + E   +L + ++ IPN P ++VP G   +
Sbjct: 61  AKKAKDEARATELMAEVARLKEEAPGLEAAQGEAAKALDERLAAIPNRPKDDVPPGADEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+  R        +   R+HFE+GEA GLMDF+ A KLSG+RF VL G LA LERALGQ
Sbjct: 121 GNVEYRRFDSSRERLTQGRQHFELGEATGLMDFEAAAKLSGSRFVVLKGQLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT EHGYTEV  P+LVR+EAM+GT Q+PKF DD F   +  WLIPT+EV LTNL 
Sbjct: 181 FMLDLHTGEHGYTEVVPPVLVREEAMFGTAQLPKFRDDQFAAGENFWLIPTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
              I+    LPLRFT L P FR+EAG+AGRDTRGMLRQHQF K ELVSIT  E S  EHE
Sbjct: 241 RESILAEDELPLRFTALTPCFRAEAGAAGRDTRGMLRQHQFNKVELVSITAPEKSAEEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML+CAE +L++LDL YRV++LCTGD+GF++ KTYD+EVW+ GQ  YREISSCS CG FQ
Sbjct: 301 RMLACAEAVLQKLDLTYRVMTLCTGDMGFASQKTYDIEVWVPGQQTYREISSCSVCGEFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR    + + F HTLNGSGVAVGR LIA++ENY N DGSVTIP+ L+PYM  L
Sbjct: 361 ARRMNARYRAKEGRGVGFVHTLNGSGVAVGRALIAVMENYQNPDGSVTIPSALQPYMGGL 420

Query: 421 AVIK 424
             I+
Sbjct: 421 TRIE 424


>gi|304391793|ref|ZP_07373735.1| seryl-tRNA synthetase [Ahrensia sp. R2A130]
 gi|303296022|gb|EFL90380.1| seryl-tRNA synthetase [Ahrensia sp. R2A130]
          Length = 426

 Score =  488 bits (1256), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 231/424 (54%), Positives = 300/424 (70%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+WIR NPE  D  + +R L PQS+ +L+LDE  R  I K+++ +  RN+ S +IG 
Sbjct: 1   MFDIKWIRDNPEAFDQGMARRGLGPQSDRLLALDEARRDHISKVQEAQEARNAASKKIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+ +   A  +E + LK  L     EE  + ++L + +S + NVP ++VP G    
Sbjct: 61  AKAQGDEAGAQAAISEVAKLKSFLQTGADEERTLSAALSEALSTLDNVPADDVPDGADEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+     G++P+     +EH+E+GEALG MDFD A KLSG+RF VL   LA LERALGQ
Sbjct: 121 DNVETHRHGEQPAFAFKPKEHWELGEALGQMDFDAAAKLSGSRFVVLNRGLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLH  EH Y EV+ P+LVR E ++G G +PKF DD+F T+D R+LIPTSE  LTNL 
Sbjct: 181 FMVDLHVDEHAYHEVAPPVLVRSEVLFGVGNLPKFEDDLFKTSDDRYLIPTSEAPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
              I++ K+LP R+T L   FR+EAGSAGRDTRGMLRQHQF KCE+VSIT  ++S  E +
Sbjct: 241 RESILDEKTLPRRYTALTNCFRAEAGSAGRDTRGMLRQHQFAKCEMVSITTPDNSDAEQQ 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM+ CAEE+LKRL LHYRVV LCTGDLGFSA +T D+EVWL GQ+ +REISSCSTCG+FQ
Sbjct: 301 RMVGCAEEVLKRLGLHYRVVKLCTGDLGFSARRTLDIEVWLPGQDTFREISSCSTCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM++RYR    K     HTLNGSG+AVGR LIA++ENY N DGS+ +P VL+ YM   
Sbjct: 361 ARRMDARYRPEGEKQPVHVHTLNGSGIAVGRALIAVMENYQNEDGSIRVPDVLQSYMGGT 420

Query: 421 AVIK 424
            VI+
Sbjct: 421 TVIE 424


>gi|326386512|ref|ZP_08208135.1| seryl-tRNA synthetase [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209173|gb|EGD59967.1| seryl-tRNA synthetase [Novosphingobium nitrogenifigens DSM 19370]
          Length = 426

 Score =  488 bits (1255), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 228/420 (54%), Positives = 295/420 (70%), Gaps = 1/420 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NPE  D A+ +R L P ++ ILS D   R L+ ++++ +ARRN  S  IG 
Sbjct: 1   MHDIRLIRENPEAFDAAMARRGLAPAAQAILSADADRRDLLTRMQEAQARRNEASKAIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+ +G+    +ALK E ++LK+ LP +E++E  +   L  +++ +PN P ++VP G   +
Sbjct: 61  AMGKGDKDTAEALKAEVASLKDALPAMEEDERRLTGELNAVLAALPNRPADDVPAGEDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +   G         REH +IG ALGL DF+    +SGARF+ L G +A L RAL Q
Sbjct: 121 ANVEVLRWGTPREFAFTPREHADIGPALGL-DFETGALISGARFTFLRGQMARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D  T  +GYTE + PL+VRDEA++GTGQ+PKFA+D+F TTDGRWLIPT+EVSLTN  
Sbjct: 180 FMLDFQTGTNGYTECATPLMVRDEAVFGTGQLPKFAEDLFRTTDGRWLIPTAEVSLTNSV 239

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             +I+   +LPLR T L P FRSEAG+AGRDTRG +RQHQF K ELVSITR EDS  EHE
Sbjct: 240 REQILTDAALPLRMTALTPCFRSEAGAAGRDTRGFIRQHQFEKVELVSITRPEDSEAEHE 299

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM   A+ +L+ LDL YR V LC GD+GF+A KTYDLEVWL GQN YREISSCS CG+FQ
Sbjct: 300 RMTGAAQAVLEALDLPYRKVVLCEGDMGFTARKTYDLEVWLPGQNTYREISSCSNCGDFQ 359

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR   +K  +F HTLNGSG+AVGR L+A+LENY   DGSV +P  L PYM  +
Sbjct: 360 ARRMNARYRPEGAKGTEFVHTLNGSGLAVGRTLVAVLENYQQEDGSVEVPAALAPYMGGI 419


>gi|217976773|ref|YP_002360920.1| seryl-tRNA synthetase [Methylocella silvestris BL2]
 gi|254783037|sp|B8ELG9|SYS_METSB RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|217502149|gb|ACK49558.1| seryl-tRNA synthetase [Methylocella silvestris BL2]
          Length = 461

 Score =  488 bits (1255), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 250/446 (56%), Positives = 304/446 (68%), Gaps = 21/446 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+WIR NPE  D   K+R LEP +  +L LD+  R  I K++  + RRN+ S +IGQ
Sbjct: 1   MYDIKWIRDNPEVFDQGRKRRGLEPLAARLLELDDARRGAIAKLQVAQERRNAASKEIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  + +  DAL  E S LK  LP LE  E    + L K +S IPN+PLEEVP G   N
Sbjct: 61  AMAAKDQAKADALMAEVSALKRDLPELEAAERAAAALLDKALSEIPNLPLEEVPFGRDEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N    + G+KP       EH+E+GE LGLMDF+ A KLSGARF V  G LA LERALG 
Sbjct: 121 DNREHHTFGEKPRFSFDPAEHYELGETLGLMDFETAAKLSGARFVVNKGPLARLERALGA 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGR-------------- 226
           FM+DLHT EHGYTEV+ P+LVRD+AM+GT Q+PKF +D F    G               
Sbjct: 181 FMLDLHTGEHGYTEVNPPILVRDDAMFGTAQLPKFENDQFWARPGAHPLLIDMFGREEAE 240

Query: 227 -------WLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQH 279
                  WLIPT+EV LTNL    I++ K LPLRFT   P FR+EAGSAGRDTRGM+RQH
Sbjct: 241 EMKKNRLWLIPTAEVPLTNLVRESILDEKQLPLRFTASTPCFRAEAGSAGRDTRGMIRQH 300

Query: 280 QFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEV 339
           QF K ELVSIT  E +  EHERMLSCAEE+LKRL L YRVV+LCTGD+GF++ KTYD+EV
Sbjct: 301 QFTKVELVSITTPEQALAEHERMLSCAEEVLKRLKLPYRVVTLCTGDMGFASQKTYDIEV 360

Query: 340 WLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILEN 399
           WL GQ+ YREISS S CG+FQ+RRMN+RYR   +K+ +F HTLNGSGVAVGR L+A+LEN
Sbjct: 361 WLPGQDRYREISSVSVCGDFQARRMNARYRPEGAKNTRFVHTLNGSGVAVGRALVAVLEN 420

Query: 400 YLNADGSVTIPTVLRPYMNNLAVIKK 425
           Y   DGS+ +P  L PYM  +  I+K
Sbjct: 421 YQTEDGSIIVPDALAPYMGGITRIEK 446


>gi|85372949|ref|YP_457011.1| seryl-tRNA synthetase [Erythrobacter litoralis HTCC2594]
 gi|122545406|sp|Q2NDM7|SYS_ERYLH RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|84786032|gb|ABC62214.1| SerS, seryl-tRNA synthetase [Erythrobacter litoralis HTCC2594]
          Length = 426

 Score =  487 bits (1253), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 234/419 (55%), Positives = 296/419 (70%), Gaps = 1/419 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NPE  D AL +R  EP +  IL+LDE+ R +  K+++ ++RRN  S  IGQ
Sbjct: 1   MHDIRQIRDNPEAFDAALARRGHEPVAAEILALDEQCRAVTTKMQEAQSRRNEASKAIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+ +GN    +ALK E + LK+ LP LE E+ E+   L+  ++ IPN+PL++VP G   +
Sbjct: 61  AMGQGNTEKAEALKAEVADLKQTLPRLEDEDRELKMRLENALAVIPNLPLDDVPDGADES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +NI + + G K       REH +IG ALG MDF+   +LSGARF+ L G +A L RALGQ
Sbjct: 121 DNIEVGTWGTKREFSFEPREHADIGPALG-MDFETGARLSGARFTFLRGGMARLHRALGQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D   SE+GY E + P+LVRDEAMYGT ++PKFA+D F TTDGRWLIPT+EVSLT   
Sbjct: 180 FMLDRQVSEYGYAECAPPVLVRDEAMYGTDKLPKFAEDSFQTTDGRWLIPTAEVSLTASV 239

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             +I++  +LP+R T L P FRSEAG+AG+DTRG +RQHQF KCELVSI R E+S  EHE
Sbjct: 240 MDQILDDAALPMRLTALTPCFRSEAGAAGKDTRGFIRQHQFEKCELVSIVRPENSAAEHE 299

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM   AE +L+ LDL YR + LCTGD+GF A KTYDLEVWL GQ  YREISSCS  G+FQ
Sbjct: 300 RMTEAAESVLQALDLPYRKMLLCTGDMGFGARKTYDLEVWLPGQGAYREISSCSNTGDFQ 359

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           +RRMN+RYR    K   F HTLNGSG+AVGR L+A++ENY   DGSV +P VL PYM  
Sbjct: 360 ARRMNARYRPEGEKKTAFVHTLNGSGLAVGRTLVAVIENYQEEDGSVAVPEVLAPYMGG 418


>gi|218661766|ref|ZP_03517696.1| seryl-tRNA synthetase [Rhizobium etli IE4771]
          Length = 409

 Score =  487 bits (1253), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 224/363 (61%), Positives = 287/363 (79%)

Query: 11  PEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQAIAEGNLSLV 70
           P+ LD AL KR  EP ++ +++LDEK R  ++K +D+ +RRN  S +IG A+++ N  L 
Sbjct: 1   PKALDAALAKRGAEPLAQSLIALDEKRRSAVQKAQDLLSRRNLASKEIGAALSQKNAELA 60

Query: 71  DALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSANENILIRSVGK 130
           + LK E + LK  LP++E+E+ ++ + L   +S IPNVP ++VP+G   ++N++ R+VG+
Sbjct: 61  EKLKAEVAELKTLLPMVEEEDRQLTAELNDALSRIPNVPFDDVPVGKDEHDNVVTRTVGE 120

Query: 131 KPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEH 190
           KP   H  +EHFEIGEALG MDFDRA KLSG+RF+VLTG LA LERALGQFMIDLHT EH
Sbjct: 121 KPRWNHTPKEHFEIGEALGYMDFDRAAKLSGSRFTVLTGPLARLERALGQFMIDLHTREH 180

Query: 191 GYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLYSHEIIESKSL 250
           GYTEVS+PL+VR EA++GTG +PKF +D+F TTDGR+LIPT+EV+LTNL   EI++ + L
Sbjct: 181 GYTEVSSPLMVRAEAVFGTGSLPKFEEDLFKTTDGRYLIPTAEVTLTNLVREEILDQEEL 240

Query: 251 PLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEIL 310
           PLRFT L PSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT  E +  EHERM +CAEE+L
Sbjct: 241 PLRFTALTPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITDAESAIAEHERMTACAEEVL 300

Query: 311 KRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRD 370
           KRL LH+R ++LCTGD+GF + KTYDLEVWL GQN +REISSCS CG+FQ+RRMN+R   
Sbjct: 301 KRLGLHFRTMTLCTGDMGFGSRKTYDLEVWLPGQNTFREISSCSVCGDFQARRMNARCNA 360

Query: 371 PNS 373
           P +
Sbjct: 361 PAT 363


>gi|23014252|ref|ZP_00054079.1| COG0172: Seryl-tRNA synthetase [Magnetospirillum magnetotacticum
           MS-1]
          Length = 422

 Score =  486 bits (1250), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 228/423 (53%), Positives = 297/423 (70%), Gaps = 2/423 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M D++ IR NPE  D  L +R LEP++  IL LD + R      ++++ARRN  S QIG 
Sbjct: 1   MHDLKSIRDNPEGFDAGLARRGLEPKAAAILDLDTRRRAAQTAFQEMQARRNEASKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G  +   AL +E +++KE++P  E+E+  + + ++ +++ IPN+P  +VP G    
Sbjct: 61  LKKSGGDA--SALMDEVASMKERMPASEEEDRLLGAEIEDILASIPNLPAADVPDGPDEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G        + +H  IG  LGLMDFD A KLSGARF VL G LA L+RA+GQ
Sbjct: 119 HNVEVRKWGAPKEFAFTALDHDAIGAKLGLMDFDGAAKLSGARFVVLKGQLARLQRAIGQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DL T+EHGYTE+  PL+V+D A +GTGQ+PKF++D+F T  G WLIPT+EV LTNL 
Sbjct: 179 FMLDLQTTEHGYTEMDPPLMVKDGAAFGTGQLPKFSEDLFKTNTGHWLIPTAEVPLTNLV 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           S EI++ KSLPLR T L P FRSEAGSAG+DTRGM+RQHQF K E+VSI   + S  EHE
Sbjct: 239 SDEILDEKSLPLRMTALTPCFRSEAGSAGKDTRGMIRQHQFHKVEMVSIAHPDKSDEEHE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE +L+RL L YRV+ LCTGD+GFS+ KTYD+EVWL GQ  YREISSCS CG+FQ
Sbjct: 299 RMTKCAETVLQRLGLAYRVIVLCTGDMGFSSRKTYDIEVWLPGQQRYREISSCSNCGDFQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM +R+R    K  +F HTLNGSG+AVGR LIA++ENY   DG++ +P VLRPYM  L
Sbjct: 359 ARRMKARFRPEGEKGTRFVHTLNGSGLAVGRTLIAVMENYQREDGTIEVPEVLRPYMGGL 418

Query: 421 AVI 423
            V+
Sbjct: 419 GVV 421


>gi|288958288|ref|YP_003448629.1| seryl-tRNA synthetase [Azospirillum sp. B510]
 gi|288910596|dbj|BAI72085.1| seryl-tRNA synthetase [Azospirillum sp. B510]
          Length = 423

 Score =  485 bits (1248), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 228/424 (53%), Positives = 309/424 (72%), Gaps = 4/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M D++ IR+NPE  D  L +R L P S  +L LD + R    ++++++ARRN  + +IG 
Sbjct: 1   MHDLRAIRENPEAFDRGLGRRGLAPMSSSLLDLDGRRRAAQTQMQEMQARRNEAAKEIGL 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A  EG  +    + +E +TLK++LP +E++E  + + L  +++ +PN+P ++VP+G    
Sbjct: 61  AKREGRDA--QPILDEMATLKDRLPQVEEDERSLGAELDAILAGLPNIPADDVPLGKDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G  P+ I   ++H+E+GEALGLMDF+ A ++SGARF+VL G LA LERAL  
Sbjct: 119 ENVEVRRWGT-PANIANPKQHYELGEALGLMDFEAAARMSGARFTVLKGGLARLERALAD 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT-DGRWLIPTSEVSLTNL 239
           FM+D+HTSEHG+TE++ PL+VRD A++GTGQ+PKF +D+F TT    +LIPTSEV LTNL
Sbjct: 178 FMLDIHTSEHGFTEIAPPLMVRDTALFGTGQLPKFEEDLFKTTASDHYLIPTSEVPLTNL 237

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
            + +I+ ++ LPLR+T L P FR+EAGSAGRDTRGM+RQHQFWK E+V+IT  + S  EH
Sbjct: 238 VNDQIVAAEELPLRYTALTPCFRAEAGSAGRDTRGMIRQHQFWKVEMVAITAPDQSEDEH 297

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           +RM  CAE IL+RL L YR + LCTGD+GFS+ KTYD+EVWL GQN YREISS S CG+F
Sbjct: 298 QRMTRCAETILERLGLPYRTIVLCTGDMGFSSRKTYDVEVWLPGQNAYREISSVSNCGDF 357

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RRM +R R    K  +F HTLNGSGVAVGRCLIA+LENY   DGS+ +P  LRPYM  
Sbjct: 358 QARRMKARCRAKGEKQTQFVHTLNGSGVAVGRCLIAVLENYQQPDGSILVPEALRPYMRG 417

Query: 420 LAVI 423
           +  I
Sbjct: 418 VERI 421


>gi|158423363|ref|YP_001524655.1| seryl-tRNA synthetase [Azorhizobium caulinodans ORS 571]
 gi|172047946|sp|A8I4J4|SYS_AZOC5 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|158330252|dbj|BAF87737.1| seryl-tRNA synthetase, class IIa [Azorhizobium caulinodans ORS 571]
          Length = 445

 Score =  484 bits (1247), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 241/444 (54%), Positives = 302/444 (68%), Gaps = 19/444 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-----EYILSLDEKNRILIKKIEDIRARRNSNS 55
           M DI+WIR+ PE L  AL +R +         + +LSLD   R  + K+E + ARRN+ S
Sbjct: 1   MHDIKWIREEPEALVRALVRRQVAKDEAVALRDKLLSLDTARRETLTKLEGLLARRNAAS 60

Query: 56  AQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
            +IGQA A  + +   AL +E + LK  +P LE+    +   L  L++ IPNVPLE VP 
Sbjct: 61  KEIGQAKAAKDEARAAALMDEVAKLKVDVPELEQSAKAIEGELDGLLAAIPNVPLESVPE 120

Query: 116 GTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLE 175
           G   ++N+ ++ VG K +     ++HFE+GEALGLMDF+ A+KLSGARF V  G LA LE
Sbjct: 121 GKDEHDNVELKVVGTKRNYAFTPKQHFELGEALGLMDFETASKLSGARFVVNKGPLARLE 180

Query: 176 RALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGR--------- 226
           RALGQF +D+H  +HGYTEV+ PLLVRDE MYGT Q+PKF DD F    G          
Sbjct: 181 RALGQFFLDMHVEQHGYTEVNPPLLVRDETMYGTAQLPKFFDDQFAVYAGSTQRAIGDET 240

Query: 227 -----WLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQF 281
                WLIPT+EV LTNL    I+    LPLRFT   P FR+EAGSAGRDTRGM+RQHQF
Sbjct: 241 DAERYWLIPTAEVPLTNLVRDSILSEDELPLRFTANTPCFRAEAGSAGRDTRGMIRQHQF 300

Query: 282 WKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWL 341
            K E+VSIT  E S  EH RML+CAE +L++LDLHYRVV+LCTGD+GF++ KT+D+EVWL
Sbjct: 301 TKVEMVSITTPETSEEEHHRMLACAEAVLQKLDLHYRVVTLCTGDMGFASRKTFDIEVWL 360

Query: 342 AGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYL 401
            GQN YREISSCS CG+FQ+RRMN+RYR    K  +F HTLNGSGVAVGR L+A+LE Y 
Sbjct: 361 PGQNAYREISSCSVCGDFQARRMNARYRPAEGKGPRFVHTLNGSGVAVGRALVAVLETYQ 420

Query: 402 NADGSVTIPTVLRPYMNNLAVIKK 425
             DGS+ +P VL+ YM  + VI K
Sbjct: 421 QEDGSIVVPDVLQSYMGGVTVIAK 444


>gi|87198872|ref|YP_496129.1| seryl-tRNA synthetase [Novosphingobium aromaticivorans DSM 12444]
 gi|123736268|sp|Q2GA28|SYS_NOVAD RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|87134553|gb|ABD25295.1| seryl-tRNA synthetase [Novosphingobium aromaticivorans DSM 12444]
          Length = 426

 Score =  483 bits (1242), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 231/421 (54%), Positives = 294/421 (69%), Gaps = 1/421 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+N E  D AL +R + P ++ ILSLD + R +  ++++++ARRN  S  IG 
Sbjct: 1   MHDIRLIRENAEAFDAALARRGVGPVAQSILSLDSRRREIATRMQEVQARRNEASKAIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+ +G+    +ALK E + LK +LP LE+EE ++ +     ++  PN P  +VP G    
Sbjct: 61  AMGKGDKDTAEALKAEVAALKVELPALEEEERQLTAQQNAALAAYPNTPAADVPEGADEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         +EH ++G ALGL DF+    +SGARF+ L G +A L RAL Q
Sbjct: 121 DNVEVSRWGTPRDFAFAPKEHADLGPALGL-DFETGALISGARFTFLKGQMARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D  T E+GY E   PLLV+DEA++GTGQ+PKFA+D+F TTDGRWLIPT+EVSLTN  
Sbjct: 180 FMLDRQTGENGYMECIPPLLVKDEAVFGTGQLPKFAEDLFRTTDGRWLIPTAEVSLTNAV 239

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             +I+    LPLR T L P FRSEAG+AGRDTRG +RQHQF K ELVSITR EDS +EHE
Sbjct: 240 QGQILGEAQLPLRMTALTPCFRSEAGAAGRDTRGFIRQHQFEKVELVSITRPEDSESEHE 299

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE IL+ L L YR V LCTGD+GF+A KTYDLEVWL GQ  YREISSCS CG+FQ
Sbjct: 300 RMTQCAEGILQALGLPYRKVLLCTGDMGFTARKTYDLEVWLPGQGAYREISSCSNCGDFQ 359

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR   +K  +F HTLNGSG+AVGR L+A+LENY   DGSV +P VL PYM  L
Sbjct: 360 ARRMNARYRPEGAKGTEFVHTLNGSGLAVGRTLVAVLENYQQEDGSVAVPEVLLPYMGGL 419

Query: 421 A 421
           A
Sbjct: 420 A 420


>gi|148255774|ref|YP_001240359.1| seryl-tRNA synthetase [Bradyrhizobium sp. BTAi1]
 gi|166200604|sp|A5EJV9|SYS_BRASB RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|146407947|gb|ABQ36453.1| seryl-tRNA synthetase [Bradyrhizobium sp. BTAi1]
          Length = 442

 Score =  481 bits (1239), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 237/443 (53%), Positives = 303/443 (68%), Gaps = 19/443 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP+  D AL +R L PQS ++L++DE+ R  I   E  +ARRN+ S +IG+
Sbjct: 1   MHDIKSIRDNPQGFDAALTRRGLSPQSSHLLAIDERRRAAILASEQAQARRNAASKEIGE 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A    + +   AL  E + LK  +P LE    +    L + +S IPN+PL+EVP G   +
Sbjct: 61  AKKAKDDARASALMEEVAKLKTTMPELEAAAKQADEELARELSAIPNLPLDEVPDGKDEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+     G + +     R H EIG ALG MDF+ A KLSGARF VL   LA LERA+GQ
Sbjct: 121 DNVERHVFGARRNYAFAPRPHDEIGAALG-MDFESAAKLSGARFVVLKKGLARLERAIGQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLI----------- 229
           FM+DLHT+EHGYTE++ PLLVR++ M+GTGQ+PKF DD F    G  LI           
Sbjct: 180 FMLDLHTTEHGYTEINPPLLVRNDVMFGTGQLPKFEDDQFWAVRGELLIAPDERLKTERL 239

Query: 230 ---PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCEL 286
              PT+EV+LTNL    I++ K LP+R T L P FR+EAG+AGRDTRGM+RQHQF K EL
Sbjct: 240 GLIPTAEVALTNLVRESIVDEKELPMRLTALTPCFRAEAGAAGRDTRGMIRQHQFTKVEL 299

Query: 287 VSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQ-- 344
           VSIT  E S  EHERML+CAEE+L+RLDLHYRV++LCTGD+GFS+ KTYD+EVW+ GQ  
Sbjct: 300 VSITTPETSKDEHERMLACAEEVLRRLDLHYRVITLCTGDMGFSSQKTYDIEVWMPGQGD 359

Query: 345 -NLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNA 403
              +REISSCS CG+FQ+RRM++RYR  + K  +F HTLNGSG AVGR LIA++E Y  A
Sbjct: 360 GGAFREISSCSVCGDFQARRMDARYRASDGKP-RFVHTLNGSGTAVGRALIAVMETYQQA 418

Query: 404 DGSVTIPTVLRPYMNNLAVIKKE 426
           DGS+ +P VL+PYM  L V+  E
Sbjct: 419 DGSIAVPDVLQPYMGGLKVVAAE 441


>gi|312114334|ref|YP_004011930.1| seryl-tRNA synthetase [Rhodomicrobium vannielii ATCC 17100]
 gi|311219463|gb|ADP70831.1| seryl-tRNA synthetase [Rhodomicrobium vannielii ATCC 17100]
          Length = 461

 Score =  481 bits (1239), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 241/459 (52%), Positives = 308/459 (67%), Gaps = 36/459 (7%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++WIR+NP   D  L +R  EP S  +L+LDE+ R   K ++D++ARRN+ S +IG+
Sbjct: 1   MLDLKWIRENPADFDQGLARRGTEPLSSKVLALDEELRAHKKALQDLQARRNAASKEIGK 60

Query: 61  AIAEG-NLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNV--PLEEVPIGT 117
           A  +G + +  +AL  E + LK  +   E +E E+ +++  L++ IPN+  P  EVP G 
Sbjct: 61  AKGKGGDPAKAEALMAEVADLKGAIAAGEAKERELDAAITALLAGIPNMLLPAPEVPDGK 120

Query: 118 SANENILIRSVGKK---PSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
             +EN+ +R VG      +     ++HFE+GEALGLMDF+ A K+SGARF+VL G LA L
Sbjct: 121 DESENVELRRVGTPRDFAAEDFAPKQHFELGEALGLMDFEAAAKISGARFTVLKGKLARL 180

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD---------- 224
           ERALGQFM+D+ TSEHGYTEV+ PLLVRD A+YGT Q+PKF DD++ T            
Sbjct: 181 ERALGQFMLDVQTSEHGYTEVNPPLLVRDRALYGTAQLPKFEDDLYKTAGTTSLGDAVGA 240

Query: 225 -------------GR-------WLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSE 264
                        GR       WLIPT+EV LTNL    I+    LPLRFT L P FR+E
Sbjct: 241 FADEVDVRRNEKTGRQEAFELYWLIPTAEVPLTNLVRESILPEADLPLRFTALTPCFRAE 300

Query: 265 AGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCT 324
           AG+AGRDTRGM+RQHQF+K E+VSIT  + S  EHERM SCAEEILKRL L YRVV LC 
Sbjct: 301 AGAAGRDTRGMIRQHQFYKVEMVSITTPDASAAEHERMTSCAEEILKRLGLPYRVVVLCA 360

Query: 325 GDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNG 384
           GD GF A KT+D+EVWL GQ  YREISS S CG+FQ+RRM +R+R   +K L+F HTLNG
Sbjct: 361 GDTGFGARKTHDIEVWLPGQGAYREISSVSNCGDFQARRMQARFRPSAAKDLQFVHTLNG 420

Query: 385 SGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVI 423
           SG+AVGR LIA++ENY  ADGS+ +P  L PYM  +  I
Sbjct: 421 SGLAVGRALIAVIENYQEADGSIRVPDALLPYMGGVTRI 459


>gi|83858681|ref|ZP_00952203.1| seryl-tRNA synthetase [Oceanicaulis alexandrii HTCC2633]
 gi|83853504|gb|EAP91356.1| seryl-tRNA synthetase [Oceanicaulis alexandrii HTCC2633]
          Length = 424

 Score =  481 bits (1238), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 234/425 (55%), Positives = 297/425 (69%), Gaps = 3/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR  P   D A+ +R LEPQ++ ++ LD + R    +++++   RNS S +IG+
Sbjct: 1   MHDIRLIRDEPAAFDAAMAQRGLEPQAQRLIDLDARRREATTRLQEVETERNSKSKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+    +AL+ E  +LK ++  L +E       L + ++ +PN P E+VP G   N
Sbjct: 61  AKAQGDEDRFNALRAEVESLKSEMERLTEEARTAEEVLNQHLAALPNRPAEDVPEGADEN 120

Query: 121 ENILIRSVGKKPSAIHLSR-EHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +N  +R  G+ P A      +H  +GE LGL DF+RA  +SGARF+VL G LA LERALG
Sbjct: 121 DNEEVRGWGE-PRAFDFEPVDHVTVGERLGL-DFERAAAMSGARFAVLQGPLARLERALG 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNL 239
           QFM+DL T+EHGY E S P +VRDEA++GTGQ+PKFA+D+F TTD RWLIPT+EV LTNL
Sbjct: 179 QFMLDLQTTEHGYRETSVPYMVRDEALFGTGQLPKFAEDLFRTTDDRWLIPTAEVPLTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
               I    S P+R T L P FRSEAGSAGRDTRG++R HQF K ELVSIT  E S  E 
Sbjct: 239 VRDSIHAEDSFPIRMTALTPCFRSEAGSAGRDTRGLIRMHQFLKVELVSITTPEQSEDEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           ERM  CAEE+L+RL+L YRV+ LCTGD+GFSA +TYDLEVW+  QN YREISSCSTCG+F
Sbjct: 299 ERMTQCAEEVLRRLELPYRVMKLCTGDMGFSARRTYDLEVWMPSQNTYREISSCSTCGDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RRMN+RYR    K   F HTLNGSG+AVGR L+AILEN+  ADGSV IP  LRPYM  
Sbjct: 359 QARRMNARYRKEGEKKPDFLHTLNGSGLAVGRALVAILENHQQADGSVYIPEALRPYMGG 418

Query: 420 LAVIK 424
           +  I+
Sbjct: 419 VEAIQ 423


>gi|91977257|ref|YP_569916.1| seryl-tRNA synthetase [Rhodopseudomonas palustris BisB5]
 gi|123735378|sp|Q136H4|SYS_RHOPS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|91683713|gb|ABE40015.1| seryl-tRNA synthetase [Rhodopseudomonas palustris BisB5]
          Length = 434

 Score =  480 bits (1236), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 235/432 (54%), Positives = 297/432 (68%), Gaps = 10/432 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP   D A  +R L P ++ ++ LDE  RI I   E  +ARRN+ S +IG+
Sbjct: 1   MHDIKAIRDNPTAFDAAYTRRGLSPIADSLIKLDETRRIAILASEQAQARRNAASKEIGE 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A    + +  + L  E + LK  +P LE    +   +LK  +S IPN+PL +VP G   +
Sbjct: 61  AKKAKDNARAEVLMAEVAELKTTMPALEAAVKDADEALKTALSEIPNLPLADVPEGADEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+     G K S     + H ++GEALG+MDF+ A KLSGARF VL   LA LERA+GQ
Sbjct: 121 GNVERHHFGAKRSYTFTPKAHDDLGEALGMMDFEAAAKLSGARFVVLKNGLARLERAIGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT------TDGRWLIPTSEV 234
           F +D+HT EHGYTEV+ PLLV+D+AM+GT Q+PKF DD F         +G WLIPT+EV
Sbjct: 181 FFLDVHTGEHGYTEVNPPLLVKDDAMFGTAQLPKFRDDQFAAGAIGSGGEGYWLIPTAEV 240

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
           SLTNL    I++ K LP+R T L P FR+EAG+AGRDTRGM+RQHQF K ELVSIT  E 
Sbjct: 241 SLTNLVRESILDEKELPMRLTALTPCFRAEAGAAGRDTRGMIRQHQFTKVELVSITTPEK 300

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQ---NLYREIS 351
           S  EHERMLSCAEE+L+RL LHYRV++LCTGD+GF++ KTYD+EVW+ GQ     YREIS
Sbjct: 301 SKDEHERMLSCAEEVLRRLGLHYRVMTLCTGDMGFASQKTYDIEVWMPGQGEGGAYREIS 360

Query: 352 SCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPT 411
           SCS CG+FQ+RRM++R R P+ K  +F HTLNGSG AVGR LIA++ENY   DGS+ +P 
Sbjct: 361 SCSVCGDFQARRMDARSRGPDGKP-RFVHTLNGSGTAVGRALIAVIENYQQEDGSIAVPD 419

Query: 412 VLRPYMNNLAVI 423
           VL PYM  L VI
Sbjct: 420 VLLPYMGGLKVI 431


>gi|294011256|ref|YP_003544716.1| seryl-tRNA synthetase [Sphingobium japonicum UT26S]
 gi|292674586|dbj|BAI96104.1| seryl-tRNA synthetase [Sphingobium japonicum UT26S]
          Length = 425

 Score =  479 bits (1234), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/424 (53%), Positives = 302/424 (71%), Gaps = 1/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+++R+NP   D  L +R LEP S  +L+LDE++R +   ++  +ARRN  S  IGQ
Sbjct: 1   MHDIRFLRENPAAFDAGLARRGLEPLSAELLALDERSRAIKTALQQGQARRNEASKAIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ +++  +ALK E + LKE+LP LE E+ E+  +L   ++ IPN+P ++VP G    
Sbjct: 61  AMAQKDMATAEALKAEVAALKEKLPALEAEDREIGEALAARLAAIPNLPADDVPPGEDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G+  S     ++H + G ALGL DF+    LSGARF+ L G +A L RAL Q
Sbjct: 121 QNVEVARWGEPRSFPFTPQDHADFGPALGL-DFEGGAALSGARFTALRGQMARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D  + E+GY EV+ PLLV+DEA++GTGQ+PKFA+D+F TTDGRWLIPT+EVSLTNL 
Sbjct: 180 FMLDRQSRENGYEEVNPPLLVKDEALFGTGQLPKFAEDLFRTTDGRWLIPTAEVSLTNLV 239

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             +I+ ++SLPLR T L P FRSEAGSAGRDTRG +RQHQF K ELV+I + E+S  EHE
Sbjct: 240 REQIVPTESLPLRLTALTPCFRSEAGSAGRDTRGFIRQHQFEKVELVAICKPEESEAEHE 299

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM + AE +L+ L L YR + LCTGD+GF A KT+DLEVWL  Q  YREISS S CG+FQ
Sbjct: 300 RMCAAAEGVLQALGLPYRKMLLCTGDMGFGARKTWDLEVWLPSQQTYREISSVSNCGDFQ 359

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RY+    K  +F HTLNGSG+AVGR L+A+LENY   DGSV +P VL PYM  L
Sbjct: 360 ARRMNARYKPEGEKQTRFLHTLNGSGLAVGRTLVAVLENYQQEDGSVIVPEVLAPYMGGL 419

Query: 421 AVIK 424
             ++
Sbjct: 420 TRLR 423


>gi|163793135|ref|ZP_02187111.1| Seryl-tRNA synthetase [alpha proteobacterium BAL199]
 gi|159181781|gb|EDP66293.1| Seryl-tRNA synthetase [alpha proteobacterium BAL199]
          Length = 429

 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 230/428 (53%), Positives = 302/428 (70%), Gaps = 6/428 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ +R++    D AL KR L P +E IL+ D   R +  +++  + RRN  S  IG 
Sbjct: 1   MHDIRRLREDGAAFDAALAKRGLAPVAETILTRDADWRRVTTELQLAQQRRNEASKLIGT 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G  +  DAL  E + LKE++  LE++E  +   +++L++ IPN+P ++ P+G   +
Sbjct: 61  AKRNGESA--DALMAEVAELKERMAQLEEDERRLAGEVEELLAGIPNLPADDAPVGADED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R +GK       +++H  IGE LGLMDF+ A +L+GARF VL   LA +ERAL  
Sbjct: 119 ANVELRRIGKPRERNFRAQDHVAIGEGLGLMDFEAAARLTGARFVVLKAELARMERALAA 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D+HT E GYTE++ P+LVRD+A+YGTGQ+PKFA+D F TTDG WLIPT+EV LTNL 
Sbjct: 179 FMLDIHTGEFGYTEIAPPVLVRDQALYGTGQLPKFAEDQFRTTDGYWLIPTAEVPLTNLV 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + +I+E   LPLR+T   P FRSEAGSAGRDTRGM+RQHQF K ELVSI   + S  EHE
Sbjct: 239 ADQILEEAELPLRYTAYTPCFRSEAGSAGRDTRGMIRQHQFGKVELVSIAHPDRSDGEHE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQN----LYREISSCSTC 356
           RM  CAE +LKRLDL YRV++L TGD+GFSA +TYD+EVWL GQ+     YREISSCS C
Sbjct: 299 RMTGCAETVLKRLDLPYRVMALSTGDMGFSARRTYDIEVWLPGQDDGAGRYREISSCSVC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +R+R    K+ +F HTLNGSG+A+GR LIAILENY  ADGSVTIP  L+PY
Sbjct: 359 GDFQARRMKARFRRKGEKATEFVHTLNGSGLAIGRTLIAILENYQEADGSVTIPDALKPY 418

Query: 417 MNNLAVIK 424
           +  L  I+
Sbjct: 419 LKGLERIE 426


>gi|148259967|ref|YP_001234094.1| seryl-tRNA synthetase [Acidiphilium cryptum JF-5]
 gi|166200591|sp|A5FX43|SYS_ACICJ RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|146401648|gb|ABQ30175.1| seryl-tRNA synthetase [Acidiphilium cryptum JF-5]
          Length = 433

 Score =  476 bits (1224), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 242/430 (56%), Positives = 295/430 (68%), Gaps = 13/430 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHL-------EPQSEYILSLDEKNRILIKKIEDIRARRNS 53
           M D++ IR +      A+++R L       E  +  I +LDE+ R    +++    RRN 
Sbjct: 1   MHDLKAIRDDAAAFGAAMRRRGLAGPEGADEGAAAPIRALDEERRRAQTELQGHETRRNE 60

Query: 54  NSAQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEV 113
            +  IGQA   G  +   AL+ E + L++ +        E    L +L++ +PNV   +V
Sbjct: 61  LARAIGQAKRAGEDTT--ALEAEGTALRQSIETANAWLAESARKLDELLAVLPNVLDADV 118

Query: 114 PIGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAH 173
           P G     N+  + VG  PS    +R+HFE+GEALGLMDF  A KL+GARF+VL G LA 
Sbjct: 119 PDGPDETANVEQKRVGAPPSFDFEARQHFELGEALGLMDFAGAAKLAGARFTVLRGDLAR 178

Query: 174 LERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSE 233
           LERALGQFM+DLH +EHGYTEVS PLLV D  MYGTGQ+PKFA+D+F TTDGRWLIPT+E
Sbjct: 179 LERALGQFMLDLHVNEHGYTEVSPPLLVNDATMYGTGQLPKFAEDLFRTTDGRWLIPTAE 238

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V LTNL + EI+++ SLPLR T L PSFRSEAGSAGRDTRGMLRQHQFWK ELVS+T  E
Sbjct: 239 VPLTNLAAGEILDAASLPLRMTALTPSFRSEAGSAGRDTRGMLRQHQFWKVELVSLTTPE 298

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S  EHERM SCAE +L+RL L YR + LC GD GFS+ KTYDLEVWL GQ  YREISSC
Sbjct: 299 ASADEHERMTSCAESVLERLGLPYRRMLLCAGDTGFSSAKTYDLEVWLPGQGAYREISSC 358

Query: 354 STCGNFQSRRMNSRYRDPNS--KSLK--FTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           S C  FQ+RRMN+RYR P +  K  K  F HTLNGSGVA GR LIA++ENY NADGS+T+
Sbjct: 359 SNCRAFQARRMNARYRPPQTGPKPAKPDFVHTLNGSGVATGRALIAVMENYQNADGSITV 418

Query: 410 PTVLRPYMNN 419
           P  LRPYM  
Sbjct: 419 PDALRPYMRG 428


>gi|332184963|ref|ZP_08386712.1| seryl-tRNA synthetase [Sphingomonas sp. S17]
 gi|332014687|gb|EGI56743.1| seryl-tRNA synthetase [Sphingomonas sp. S17]
          Length = 425

 Score =  475 bits (1222), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/424 (54%), Positives = 297/424 (70%), Gaps = 1/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR +P   D AL KR  EPQ+E ++++DE+ R +I + +  + RRN  S QIGQ
Sbjct: 1   MHDIRLIRDDPAAFDAALAKRGAEPQAETLIAIDERRRAIIAEAQAAQTRRNELSKQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A  + +   AL  E + LK +LP LE++E  V + L   ++ +PN+P  +VP G   +
Sbjct: 61  AKAARDEARAQALMEEVAGLKARLPELEEQERSVEAELNTALAALPNLPAADVPEGADED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N L+   G+  S    +REH  I  ALG MDFD    LSGARF++L G +A L RALGQ
Sbjct: 121 DNALVHQKGEPTSFAFEAREHDVIAPALG-MDFDTGVALSGARFTLLRGAMARLSRALGQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D  T +HG+  V  PLLVRDEA +GTGQ+PKFA+D+F TTDGRWLIPT+EVSLTN+ 
Sbjct: 180 FMLDRMTEQHGFELVQPPLLVRDEAAFGTGQLPKFAEDLFRTTDGRWLIPTAEVSLTNIV 239

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
              I+  + LPLRFT L P FRSEAG+AGRDTRG++RQHQF K E+VSIT  E S  EHE
Sbjct: 240 REAILSEQELPLRFTALTPCFRSEAGAAGRDTRGLIRQHQFDKVEMVSITTPEQSDAEHE 299

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM + AE +L+ L L YR + LCTGD+GFSA +T+DLEVWL GQ  YREISSCSTC +FQ
Sbjct: 300 RMTAAAEGVLEALGLPYRRMLLCTGDMGFSAARTFDLEVWLPGQARYREISSCSTCTDFQ 359

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM +RYR    K  +F HTLNGSG+AVGR L+A++ENY  ADGSV +P  LRPY+   
Sbjct: 360 ARRMMARYRPTEGKGTRFVHTLNGSGLAVGRTLVAVIENYQQADGSVVVPEALRPYLGGQ 419

Query: 421 AVIK 424
           AV++
Sbjct: 420 AVLE 423


>gi|144899900|emb|CAM76764.1| Seryl-tRNA synthetase [Magnetospirillum gryphiswaldense MSR-1]
          Length = 420

 Score =  474 bits (1221), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 222/423 (52%), Positives = 295/423 (69%), Gaps = 4/423 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M D++WIR+NP+  D  L +R L+P+S  ++ LD + R    ++++++A RN  S QIG 
Sbjct: 1   MHDLKWIRENPDAFDAGLARRGLDPRSAALIRLDGERRAAQTRLQELQASRNETSKQIGI 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G    V A+ +E + LKE +P+LE +E  +   +  +++ IPN+P  +VP G    
Sbjct: 61  IKKQGGD--VSAIMDEIAKLKEDIPLLEAQEKSLSEEIDGILAAIPNLPGADVPDGPDEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ IR  G+  +      EH  IG  LGLMDFD A KLSGARF VL G LA LERAL Q
Sbjct: 119 HNVEIRRWGQPGAFDFQPLEHDAIGAKLGLMDFDGAAKLSGARFVVLKGKLARLERALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D+ T +HGYTE+S P LV+D A++GTGQ+PKF DD+F T  G WLIPT+EV LTNL 
Sbjct: 179 FMLDVQTEQHGYTEISPPTLVKDGALFGTGQLPKFGDDLFKTNTGHWLIPTAEVPLTNLV 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
              I++  +LP+R T L   +RSEAG+AG+DTRGM+RQHQFWK E+VSI   + S  EH+
Sbjct: 239 GDSIVDEAALPIRMTALTLCYRSEAGAAGKDTRGMIRQHQFWKVEMVSIAHPDQSEAEHQ 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAE IL++L+L YR + LCTGD+GFS+ KTYD+EVWL GQ  YREISSCS CG+FQ
Sbjct: 299 RMTACAETILQKLELPYRTIVLCTGDMGFSSQKTYDIEVWLPGQGRYREISSCSNCGDFQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM +R++    K  +F HTLNGSG+AVGR L+A+LENY  ADGSV +P  L+PYM  L
Sbjct: 359 ARRMKARFK--GDKGNRFVHTLNGSGLAVGRTLVAVLENYQQADGSVRVPEALKPYMGGL 416

Query: 421 AVI 423
            VI
Sbjct: 417 EVI 419


>gi|146340973|ref|YP_001206021.1| seryl-tRNA synthetase [Bradyrhizobium sp. ORS278]
 gi|166200605|sp|A4YV70|SYS_BRASO RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|146193779|emb|CAL77796.1| Seryl-tRNA synthetase (Serine--tRNA ligase) [Bradyrhizobium sp.
           ORS278]
          Length = 442

 Score =  474 bits (1220), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 234/440 (53%), Positives = 299/440 (67%), Gaps = 19/440 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP+  D AL +R L P S  +L++DE+ R  I   E  +ARRN+ S +IG+
Sbjct: 1   MHDIKSIRDNPQDFDAALTRRGLSPLSSQLLAIDERRRAAILASEQAQARRNAASREIGE 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A    +     AL  E + LK  +P LE    +    L + +S IPN+PL+EVP G   +
Sbjct: 61  AKKAKDEGRASALMEEVAKLKTTMPELEAAAKQADEELARELSAIPNLPLDEVPDGKDEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+     G + +     + H +IG ALG MDF+ A KLSGARF VL   LA LERA+GQ
Sbjct: 121 DNVERHVFGARRNYAFAPKAHDDIGTALG-MDFESAAKLSGARFVVLKKGLARLERAIGQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLI----------- 229
           FM+DLHT+EHGYTEV+ PLLVR++ M+GTGQ+PKF DD F    G  LI           
Sbjct: 180 FMLDLHTTEHGYTEVNPPLLVRNDVMFGTGQLPKFEDDQFWAVRGELLIAPDERLKAERL 239

Query: 230 ---PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCEL 286
              PT+EV+LTNL    I++ K LP+R T L P FR+EAG+AGRDTRGM+RQHQF K EL
Sbjct: 240 GLIPTAEVALTNLVRESIVDEKELPMRLTALTPCFRAEAGAAGRDTRGMIRQHQFTKVEL 299

Query: 287 VSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQ-- 344
           VSIT  E S  EHERML+CAEE+L+RLDLHYRV++LCTGD+GFS+ KTYD+EVW+ GQ  
Sbjct: 300 VSITTPETSKDEHERMLACAEEVLRRLDLHYRVITLCTGDMGFSSQKTYDIEVWMPGQGD 359

Query: 345 -NLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNA 403
              +REISSCS CG+FQ+RRM++RYR  + K  +F HTLNGSG AVGR LIA++E Y  A
Sbjct: 360 GGAFREISSCSVCGDFQARRMDARYRASDGKP-RFVHTLNGSGTAVGRALIAVMETYQQA 418

Query: 404 DGSVTIPTVLRPYMNNLAVI 423
           DGS+ +P VL+PYM  L V+
Sbjct: 419 DGSIAVPDVLQPYMGGLKVV 438


>gi|85716192|ref|ZP_01047167.1| seryl-tRNA synthetase [Nitrobacter sp. Nb-311A]
 gi|85697025|gb|EAQ34908.1| seryl-tRNA synthetase [Nitrobacter sp. Nb-311A]
          Length = 479

 Score =  473 bits (1218), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 242/479 (50%), Positives = 305/479 (63%), Gaps = 54/479 (11%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP+  D ALK+R LEPQ+++++S+DE  R  I+  E  +ARRN+ S +IG 
Sbjct: 1   MHDIKAIRDNPQAFDAALKRRGLEPQADHLISIDELRRARIRVAESFQARRNAASKEIGD 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A    + +    L  E + LK  +P +E         LKK +S IPN+PL+EVP G   +
Sbjct: 61  AKKMKDEARAAKLMAEVAELKTTMPEMEAAAKAADEELKKALSEIPNLPLDEVPYGADEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+     GKK       + H ++G ALG MDF+ A KLSGARF VL   LA LERA+GQ
Sbjct: 121 SNVQHHIFGKKRDYAFAPKPHDDLGGALGDMDFEAAAKLSGARFVVLKRGLARLERAIGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG--------------- 225
           F +D+HT EHGYTEV+ PLLVRD+AM+GT Q+PKF +D F T  G               
Sbjct: 181 FFLDVHTGEHGYTEVNPPLLVRDDAMFGTAQLPKFLEDQFATFAGPIDLSEDRKGMAEVW 240

Query: 226 -------------------------------RWLIPTSEVSLTNLYSHEIIESKSLPLRF 254
                                           WLIPT+EVSLTNL    I++ K LPLRF
Sbjct: 241 QRALDEAERYGVEKARTVEFNFEELQYHEDRYWLIPTAEVSLTNLVRESILDEKELPLRF 300

Query: 255 TTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLD 314
           T L P FR+EAG+AGRDTRGM+RQHQF K ELVSIT  E S  EHERMLSCAEE+L+RLD
Sbjct: 301 TALTPCFRAEAGAAGRDTRGMIRQHQFTKVELVSITTPETSKDEHERMLSCAEEVLRRLD 360

Query: 315 LHYRVVSLCTGDLGFSACKTYDLEVWLAGQ-------NLYREISSCSTCGNFQSRRMNSR 367
           LHYRV++LCTGD+GF++ KTYD+EVW+ GQ         YREISSCS CG+FQ+RRM++R
Sbjct: 361 LHYRVMTLCTGDMGFASQKTYDIEVWMPGQISGQGEGGAYREISSCSVCGDFQARRMDAR 420

Query: 368 YRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVIKKE 426
           YR  + K  +F HTLNGSG AVGR LIA++E Y  ADGS+ +P VL+PYM  L +I +E
Sbjct: 421 YRASDGKP-RFVHTLNGSGTAVGRALIAVMETYQQADGSIAVPDVLQPYMGGLKMIGRE 478


>gi|307294312|ref|ZP_07574156.1| seryl-tRNA synthetase [Sphingobium chlorophenolicum L-1]
 gi|306880463|gb|EFN11680.1| seryl-tRNA synthetase [Sphingobium chlorophenolicum L-1]
          Length = 425

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 224/420 (53%), Positives = 297/420 (70%), Gaps = 1/420 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+++R+NP   D  L +R LEP S  +L+LDE++R +   ++  +ARRN  S  IGQ
Sbjct: 1   MHDIRFLRENPAAFDAGLARRGLEPLSAELLALDERSRAIKTALQQGQARRNEASKAIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ +++  +ALK E + LK+ +P LE E+ EV  +L   ++ +PN+P ++VP G    
Sbjct: 61  AMAQKDMATAEALKAEVAALKDSMPALEAEDREVGEALNARLAAVPNLPADDVPPGEDEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G+  S     ++H + G ALGL DF+    LSGARF+ L G +A L RAL Q
Sbjct: 121 QNVEVARWGEPRSFPFTPQDHADFGPALGL-DFEGGAALSGARFTALRGQMARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D  + E+GY EV+ PLLV+D+A++GTGQ+PKFA+D+F TTDGRWLIPT+EVSLTNL 
Sbjct: 180 FMLDRQSGENGYEEVNPPLLVKDDALFGTGQLPKFAEDLFRTTDGRWLIPTAEVSLTNLV 239

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
              I+   SLPLR T L P FRSEAGSAGRDTRG +RQHQF K ELV+I + E+S  EHE
Sbjct: 240 RERIVPVDSLPLRLTALTPCFRSEAGSAGRDTRGFIRQHQFEKVELVAICKPEESEAEHE 299

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM + AE +L+ L L YR + LCTGD+GF A KT+DLEVWL  Q  YREISS S CG+FQ
Sbjct: 300 RMCAAAEGVLQALGLPYRKMLLCTGDMGFGARKTWDLEVWLPSQQTYREISSVSNCGDFQ 359

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RY+    K+ +F HTLNGSG+AVGR L+A+LENY   DGSV +P VL PYM  L
Sbjct: 360 ARRMNARYKPEGEKNTRFLHTLNGSGLAVGRTLVAVLENYQQEDGSVIVPEVLAPYMGGL 419


>gi|326403078|ref|YP_004283159.1| seryl-tRNA synthetase [Acidiphilium multivorum AIU301]
 gi|325049939|dbj|BAJ80277.1| seryl-tRNA synthetase [Acidiphilium multivorum AIU301]
          Length = 433

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 241/430 (56%), Positives = 294/430 (68%), Gaps = 13/430 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHL-------EPQSEYILSLDEKNRILIKKIEDIRARRNS 53
           M D++ IR +      A+++R L       E  +  I +LDE+ R    +++    RRN 
Sbjct: 1   MHDLKAIRDDAAAFGAAMRRRGLAGPEGADEGAAAPIRALDEERRRAQTELQGHETRRNE 60

Query: 54  NSAQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEV 113
            +  IGQA   G  +   AL+ E + L++ +        E    L +L++ +PNV   +V
Sbjct: 61  LARAIGQAKRAGEDTT--ALEAEGTALRQSIETANAWLAESARKLDELLAVLPNVLDADV 118

Query: 114 PIGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAH 173
           P G     N+  + VG  PS    +R+HFE+GEALGLMDF  A KL+GARF+VL   LA 
Sbjct: 119 PDGPDETANVEQKRVGAPPSFDFEARQHFELGEALGLMDFAGAAKLAGARFTVLRSDLAR 178

Query: 174 LERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSE 233
           LERALGQFM+DLH +EHGYTEVS PLLV D  MYGTGQ+PKFA+D+F TTDGRWLIPT+E
Sbjct: 179 LERALGQFMLDLHVNEHGYTEVSPPLLVNDTTMYGTGQLPKFAEDLFRTTDGRWLIPTAE 238

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V LTNL + EI+++ SLPLR T L PSFRSEAGSAGRDTRGMLRQHQFWK ELVS+T  E
Sbjct: 239 VPLTNLAAGEILDAASLPLRMTALTPSFRSEAGSAGRDTRGMLRQHQFWKVELVSLTTPE 298

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S  EHERM SCAE +L+RL L YR + LC GD GFS+ KTYDLEVWL GQ  YREISSC
Sbjct: 299 ASADEHERMTSCAESVLERLGLPYRRMLLCAGDTGFSSAKTYDLEVWLPGQGAYREISSC 358

Query: 354 STCGNFQSRRMNSRYRDPNS--KSLK--FTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           S C  FQ+RRMN+RYR P +  K  K  F HTLNGSGVA GR LIA++ENY NADGS+T+
Sbjct: 359 SNCRAFQARRMNARYRPPQTGPKPAKPDFVHTLNGSGVATGRALIAVMENYQNADGSITV 418

Query: 410 PTVLRPYMNN 419
           P  LRPYM  
Sbjct: 419 PDALRPYMRG 428


>gi|86749859|ref|YP_486355.1| seryl-tRNA synthetase [Rhodopseudomonas palustris HaA2]
 gi|123004117|sp|Q2IWG6|SYS_RHOP2 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|86572887|gb|ABD07444.1| seryl-tRNA synthetase [Rhodopseudomonas palustris HaA2]
          Length = 476

 Score =  472 bits (1214), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 239/477 (50%), Positives = 302/477 (63%), Gaps = 53/477 (11%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP+  D A  +R L P ++ ++ LDE  R  I + E  +ARRN+ S +IG 
Sbjct: 1   MHDIKAIRDNPQAFDAAFTRRGLAPIADSLIKLDETRRAAILESEKAQARRNAASKEIGD 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A    + +  DAL  E + LK  +P LE    E   +LKK +S IPN+PL+EVP G   +
Sbjct: 61  AKKAKDNARADALMAEVAELKTTMPALEAAVKEADEALKKALSEIPNLPLDEVPEGADEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+     G K       + H+++GEALG+MDF+ A K+SGARF VL   LA LERA+GQ
Sbjct: 121 GNVDHHRFGAKRDYAFTPKAHYDLGEALGMMDFEAAAKISGARFVVLKKGLARLERAIGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT------------------ 222
           F +D+HT EHGYTEV+ PLLVRD+AM+GT Q+PKF +D F T                  
Sbjct: 181 FFLDVHTGEHGYTEVNPPLLVRDDAMFGTAQLPKFREDQFQTVTEEVRRRTIVEFVSSAM 240

Query: 223 ------TDGR-------------------------WLIPTSEVSLTNLYSHEIIESKSLP 251
                 TD                           WLIPT+EVSLTNL    I++ K LP
Sbjct: 241 KLGASATDAGGSEFARQLANEELVDFSYAKMPERFWLIPTAEVSLTNLVRESILDEKELP 300

Query: 252 LRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILK 311
           +R T L P FR+EAG+AGRDTRGM+RQHQF K ELVSIT  E S  EHERMLSCAEE+L+
Sbjct: 301 MRLTALTPCFRAEAGAAGRDTRGMIRQHQFTKVELVSITTPEQSKDEHERMLSCAEEVLR 360

Query: 312 RLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQ---NLYREISSCSTCGNFQSRRMNSRY 368
           RL LHYRV++LCTGD+GF++ KTYD+EVW+ GQ     YREISSCS CG+FQ+RRM++R 
Sbjct: 361 RLGLHYRVMTLCTGDMGFASQKTYDIEVWMPGQGEGGAYREISSCSVCGDFQARRMDARS 420

Query: 369 RDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVIKK 425
           R P+ K  +F HTLNGSG AVGR LIA++ENY   DGS+ +P  L+PYM  L VI K
Sbjct: 421 RGPDGKP-RFVHTLNGSGTAVGRALIAVIENYQQEDGSIAVPDALQPYMGGLKVIAK 476


>gi|39935910|ref|NP_948186.1| seryl-tRNA synthetase [Rhodopseudomonas palustris CGA009]
 gi|192291558|ref|YP_001992163.1| seryl-tRNA synthetase [Rhodopseudomonas palustris TIE-1]
 gi|67461786|sp|Q6N5X5|SYS_RHOPA RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|229890230|sp|B3Q6H9|SYS_RHOPT RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|39649764|emb|CAE28286.1| seryl-tRNA synthetase [Rhodopseudomonas palustris CGA009]
 gi|192285307|gb|ACF01688.1| seryl-tRNA synthetase [Rhodopseudomonas palustris TIE-1]
          Length = 434

 Score =  472 bits (1214), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 235/434 (54%), Positives = 303/434 (69%), Gaps = 10/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP+  D A  +R L P +  ++ LDE  R  ++  E  +ARRN+ S +IG 
Sbjct: 1   MHDIKAIRDNPQAFDAAFTRRGLAPIAGSLMKLDEVRRAAVQAAEQAQARRNAASKEIGD 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A    + +  +AL  E + LK  +P L+    E   +LKK +S IPN+PL EVP G   +
Sbjct: 61  AKKAKDNARAEALMAEVTELKTTMPALDAAVKEADEALKKALSEIPNLPLPEVPEGADEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+     G+KPS     + H+++GEALG+MDF+ A KLSGARF+VL   LA LERA+GQ
Sbjct: 121 GNVEHHRFGEKPSYSFTPKPHYDLGEALGMMDFEAAAKLSGARFTVLKKGLARLERAIGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT------TDGRWLIPTSEV 234
           F +D+HT +HGYTEV+ PLLV+D+AM+GT Q+PKF +D F         +G WLIPT+EV
Sbjct: 181 FFLDVHTGDHGYTEVNPPLLVKDDAMFGTAQLPKFREDQFAAGAIGSGGEGYWLIPTAEV 240

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
           SLTNL    I++ K LP+R T L P FR+EAG+AGRDTRGM+RQHQF K ELVSIT  E 
Sbjct: 241 SLTNLVRESILDEKELPMRLTALTPCFRAEAGAAGRDTRGMIRQHQFTKVELVSITTPEQ 300

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQ---NLYREIS 351
           S  EHERMLSCAEE+L+RL LHYRV++LCTGD+GF++ KTYD+EVW+ GQ     YREIS
Sbjct: 301 SKDEHERMLSCAEEVLRRLGLHYRVMTLCTGDMGFASQKTYDIEVWMPGQGEGGAYREIS 360

Query: 352 SCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPT 411
           SCS CG+FQ+RRM++R R  + K  +F HTLNGSG AVGR LIA++ENY   DGS+ +P 
Sbjct: 361 SCSVCGDFQARRMDARSRGSDGKP-RFVHTLNGSGTAVGRALIAVIENYQQEDGSIAVPD 419

Query: 412 VLRPYMNNLAVIKK 425
           VL+PYM  L VI K
Sbjct: 420 VLQPYMGGLKVIAK 433


>gi|92117336|ref|YP_577065.1| seryl-tRNA synthetase [Nitrobacter hamburgensis X14]
 gi|122417947|sp|Q1QME2|SYS_NITHX RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|91800230|gb|ABE62605.1| seryl-tRNA synthetase [Nitrobacter hamburgensis X14]
          Length = 470

 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 241/469 (51%), Positives = 299/469 (63%), Gaps = 45/469 (9%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP   D ALK+R L P S  +L++DEK R  I   E  +ARRN+ S +IG+
Sbjct: 1   MHDIKAIRDNPAAFDAALKRRGLAPLSSSLLAIDEKRRAAILASEQAQARRNAASKEIGE 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A    + +    L  E + LK  +P ++         L+K ++ IPN+PL+EVP GT  +
Sbjct: 61  AKKAKDEARAAKLMAEVAELKTSMPEMDAAAKAADEKLRKALAEIPNLPLDEVPDGTDEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            NI     GKK       + H ++G ALG MDF+ A KLSGARF VL   LA LERA+GQ
Sbjct: 121 GNIQHHVFGKKRDYAFTPKPHEDLGGALGDMDFEAAAKLSGARFVVLKRGLARLERAIGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-------------------- 220
           F +D+HT EHGYTEV+ PLLVRD+AM+GT Q+PKFA+D F                    
Sbjct: 181 FFLDVHTGEHGYTEVNPPLLVRDDAMFGTAQLPKFAEDQFDFIKDRTISEQLEQTVVEID 240

Query: 221 ---------------------CTTDGRWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAP 259
                                   D  WLIPT+EV LTNL    I++ K LPLRFT L P
Sbjct: 241 QRKVRPGHFDMEQKVTPLSAPTRKDRLWLIPTAEVPLTNLVRESILDEKELPLRFTALTP 300

Query: 260 SFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRV 319
            FR+EAG+AGRDTRGM+RQHQF K ELVSIT  E S  EHERMLSCAEE+L+RLDLHYRV
Sbjct: 301 CFRAEAGAAGRDTRGMIRQHQFTKVELVSITTPETSKDEHERMLSCAEEVLRRLDLHYRV 360

Query: 320 VSLCTGDLGFSACKTYDLEVWLAGQ---NLYREISSCSTCGNFQSRRMNSRYRDPNSKSL 376
           ++LCTGD+GF++ KTYD+EVW+ GQ     YREISSCS CG+FQ+RRM++R R P+ K  
Sbjct: 361 MTLCTGDMGFASQKTYDIEVWMPGQGEGGAYREISSCSVCGDFQARRMDARSRGPDGKP- 419

Query: 377 KFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVIKK 425
           +F HTLNGSG AVGR LIA++E Y  ADGS+ +P VL PYM  L VI K
Sbjct: 420 RFVHTLNGSGTAVGRALIAVMETYQQADGSIAVPDVLLPYMGGLKVIAK 468


>gi|94497464|ref|ZP_01304034.1| seryl-tRNA synthetase [Sphingomonas sp. SKA58]
 gi|94423095|gb|EAT08126.1| seryl-tRNA synthetase [Sphingomonas sp. SKA58]
          Length = 425

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 230/420 (54%), Positives = 290/420 (69%), Gaps = 1/420 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI++IR+NP   D AL +R L P S  I++LDEK+R L  + +  +ARRN  S  IGQ
Sbjct: 1   MHDIRFIRENPAAFDAALGRRGLSPMSAEIITLDEKSRALKTEWQQAQARRNEASKAIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  + +  DALK E + LK+++P LE EE      L  L+S IPN+P ++VP GT   
Sbjct: 61  AMAAKDSATADALKAEVAELKDRMPALEGEERAAGEQLTALLSAIPNLPAQDVPDGTDEV 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G   +     ++H + G ALGL DF+    LSGARF+ L G +A L RAL Q
Sbjct: 121 DNVEVARWGTPRAFAFPPQDHADFGPALGL-DFEGGAALSGARFTALRGQMARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D  T  +GY E   PLLV+D A++GTGQ+PKFA+D+F TTDGRWLIPT+EVSLTNL 
Sbjct: 180 FMLDQQTVANGYEETIVPLLVKDAALFGTGQLPKFAEDLFKTTDGRWLIPTAEVSLTNLV 239

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + +I+  + LPLR T L P FRSEAGSAGRDTRG +RQHQF K ELV+I R E+S  EHE
Sbjct: 240 ADQIVPEERLPLRLTALTPCFRSEAGSAGRDTRGFIRQHQFEKVELVTICRPEESEAEHE 299

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM++ AE IL+ L L YR + LCTGD+GF A KTYDLEVWL  Q+ YREISS S CG+FQ
Sbjct: 300 RMVAAAEGILQALALPYRKMLLCTGDMGFGARKTYDLEVWLPSQDTYREISSVSNCGDFQ 359

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R R    K   F HTLNGSG+AVGR L+A+LEN   ADGSV IP  L PYM  +
Sbjct: 360 ARRMNARMRPDGGKQTVFLHTLNGSGLAVGRTLVAVLENCQQADGSVVIPDALAPYMGGV 419


>gi|296535523|ref|ZP_06897707.1| serine--tRNA ligase [Roseomonas cervicalis ATCC 49957]
 gi|296264149|gb|EFH10590.1| serine--tRNA ligase [Roseomonas cervicalis ATCC 49957]
          Length = 426

 Score =  469 bits (1208), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 230/427 (53%), Positives = 298/427 (69%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ +R +P   D AL +R L P +E IL+ D   R      ++++ARRN  S +IG 
Sbjct: 1   MHDIRIVRADPAAFDAALARRGLAPVAEAILAQDTARRAAQTAAQEVQARRNQISKEIGM 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A  +G  +   AL+ E +TL+ ++  LE E  +  ++   L+  +PN+   EVP G   +
Sbjct: 61  AKRQGGDTA--ALEAEGATLRGRMEALEAEAKQADAAQTALLEALPNLLDAEVPEGRDES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+++   G+ P+     ++HFE+GEALGLMDF  A KL+GARF+VL G LA LERALGQ
Sbjct: 119 DNVVLHQQGEPPALDFAPKQHFELGEALGLMDFGAAAKLAGARFTVLRGALARLERALGQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           +MI LH  EHGYTE S PLLV D  MYGTGQ+PKF +D+F TTDGRWLIPT+EV LTNL 
Sbjct: 179 YMISLHVEEHGYTETSVPLLVNDATMYGTGQLPKFEEDLFRTTDGRWLIPTAEVPLTNLV 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + E++  ++LPLR+T L+P FRSEAGSAGRDTRGMLRQHQF K E+V+ITR EDS  EHE
Sbjct: 239 AGELLAEQALPLRYTALSPCFRSEAGSAGRDTRGMLRQHQFTKVEMVAITRAEDSAAEHE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE +L  L L +R V LC GD GFSA +TYDLEVWL GQ  +REISSCS C +FQ
Sbjct: 299 RMTRCAERVLTELGLVWRRVLLCAGDTGFSAARTYDLEVWLPGQGAWREISSCSNCRDFQ 358

Query: 361 SRRMNSRYRD---PNSKSL-KFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           +RRMN+RYR    P +K+   + HTLNGSG+AVGR LIA++E +  ADGS+ +P VL P+
Sbjct: 359 ARRMNARYRPEAAPGTKAAPAYLHTLNGSGIAVGRALIAVMETHQQADGSIRVPPVLAPW 418

Query: 417 MNNLAVI 423
           M  +  I
Sbjct: 419 MGGVTSI 425


>gi|209964355|ref|YP_002297270.1| seryl-tRNA synthetase [Rhodospirillum centenum SW]
 gi|238065106|sp|B6ISM1|SYS_RHOCS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|209957821|gb|ACI98457.1| seryl-tRNA synthetase SerS [Rhodospirillum centenum SW]
          Length = 424

 Score =  469 bits (1208), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 237/419 (56%), Positives = 298/419 (71%), Gaps = 3/419 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M D++ IR NPE  D  L +R L P S  IL LD++ R      ++ +ARRN  S  IG 
Sbjct: 1   MHDLRAIRDNPEAFDTGLARRGLPPASAAILDLDQRRRAAQTSFQECQARRNEASRLIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G  +    L +E + LKE++P LE+E+  + + L  L++ +PN+P  +VP G   +
Sbjct: 61  YKKDGKDA--QPLLDEVAALKERIPALEEEDRRLGAELDALLAALPNLPAADVPEGKDEH 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ IR VG  P  I  +++HFE+GEALGLMDF+ A ++SGARF+VL G LA LERALG 
Sbjct: 119 DNVEIRRVGT-PRDIPGAKQHFELGEALGLMDFEGAARMSGARFTVLKGQLARLERALGD 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT E GYTEVS PLLVRDEA++GTGQ+PKFADD+F TT G WLIPT+EV+LTNL 
Sbjct: 178 FMLDLHTREFGYTEVSPPLLVRDEAVFGTGQLPKFADDLFRTTTGHWLIPTAEVTLTNLA 237

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           +  II++++LP R T   P FRSEAGSAG+DTRGM+RQHQF K ELVSIT  E S  EHE
Sbjct: 238 NDSIIDAEALPWRLTARTPCFRSEAGSAGKDTRGMIRQHQFMKVELVSITLPEQSEAEHE 297

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM   AE +L+RL L +R V LCTGD+GFSA KTYD+EVWL GQ  YREISSCS CG+FQ
Sbjct: 298 RMTKAAETVLERLGLPFRTVVLCTGDMGFSARKTYDIEVWLPGQGAYREISSCSNCGDFQ 357

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           +RRM +R R    K  +  HTLNGSGVAVGR LIA++ENY   DGS+ +P  LRPYM  
Sbjct: 358 ARRMKARSRPKGEKGTQVVHTLNGSGVAVGRALIAVMENYQQPDGSILVPEALRPYMGG 416


>gi|300022787|ref|YP_003755398.1| seryl-tRNA synthetase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299524608|gb|ADJ23077.1| seryl-tRNA synthetase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 462

 Score =  468 bits (1203), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 228/457 (49%), Positives = 295/457 (64%), Gaps = 34/457 (7%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+WIR N +  D +L++R L PQ+  +++LD+K R  +  ++D ++RRN+ S +IG+
Sbjct: 1   MFDIKWIRDNADAFDASLQRRGLAPQAAALVALDDKRRATLTALQDAQSRRNAASKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A    + +    L  E + LK+ +   E +E ++ + +K  +  IPN+P  +VP G    
Sbjct: 61  AKGAKDEATAARLMAEVADLKDTIARGEDDERKLDAEIKAALEVIPNLPRADVPDGADET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R VG         ++HFEIGEALGLMDF+ A K+SGARF VL G LA LERAL  
Sbjct: 121 GNVEVRRVGTPARLDFTPKQHFEIGEALGLMDFEAAQKISGARFVVLKGALARLERALAS 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG--------------- 225
           FM+DLHTSE GYTEV+ P+LVR EAM+GT Q+PKF  D F    G               
Sbjct: 181 FMLDLHTSEFGYTEVNPPILVRREAMFGTAQLPKFEIDQFWALSGIQFFDMGEIEKRSAS 240

Query: 226 -------------------RWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAG 266
                              + LIPT+EV LTNL   +II+   LP+R T   P FRSEAG
Sbjct: 241 KTDPQIAFQIAREAALEAAKGLIPTAEVPLTNLVREQIIDEAQLPMRVTAWTPCFRSEAG 300

Query: 267 SAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGD 326
           +AG+DTRGM+RQHQF K ELVSIT  + S  EHERM SCAEE+LKRL L +R + LCTGD
Sbjct: 301 AAGKDTRGMIRQHQFSKVELVSITTPDASLDEHERMTSCAEEVLKRLGLPFRTIVLCTGD 360

Query: 327 LGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSG 386
           +GF++ KTYD+EVWL GQN YREISSCS CG+FQ+RRM++R+R  +     + HTLNGSG
Sbjct: 361 MGFASQKTYDIEVWLPGQNAYREISSCSVCGDFQARRMDARFRPKDGGKPVYVHTLNGSG 420

Query: 387 VAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVI 423
           +AVGR LIA+LENY  ADGSV IP  LRPYM  L  I
Sbjct: 421 LAVGRTLIAVLENYQQADGSVIIPDALRPYMGGLTKI 457


>gi|154248324|ref|YP_001419282.1| seryl-tRNA synthetase [Xanthobacter autotrophicus Py2]
 gi|238686792|sp|A7INN1|SYS_XANP2 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|154162409|gb|ABS69625.1| seryl-tRNA synthetase [Xanthobacter autotrophicus Py2]
          Length = 468

 Score =  466 bits (1200), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 238/466 (51%), Positives = 293/466 (62%), Gaps = 41/466 (8%)

Query: 1   MLDIQWIRQNPEHLDIALKKR---------HLEPQSEYILSLDEKNRILIKKIEDIRARR 51
           M DI+WIR  P  L  AL +R           E    Y++ LDE+ R  +  +E   ARR
Sbjct: 1   MHDIKWIRDEPVGLITALVRRGGGSDEAKSAAEKLVAYLIGLDEQRRRTLTDLEGKLARR 60

Query: 52  NSNSAQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLE 111
           N+ S +IGQA A+ +      L  E + LK  +P LE    +   SL   ++ IPN PL 
Sbjct: 61  NAASKEIGQAKAQKDEERASRLMAEVANLKADIPTLEALAKDWEKSLDNALAAIPNAPLA 120

Query: 112 EVPIGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHL 171
           EVP G   ++N+     G   S     ++HFE+GEALG MDF+ A KLSGARF V  G L
Sbjct: 121 EVPPGADEHDNVEKSRFGVARSYAFTPKQHFEVGEALGQMDFETAAKLSGARFVVNKGPL 180

Query: 172 AHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC--TTD----- 224
           A LERALGQF +D+HT EHGY EV+ PLLVRD+AM+GT Q+PKF +D F   T D     
Sbjct: 181 ARLERALGQFFLDVHTGEHGYMEVNPPLLVRDDAMFGTAQLPKFREDQFFVNTVDGIEAI 240

Query: 225 -------------------------GRWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAP 259
                                    GRWLIPT+EV LTNL    I+  + LPLR T   P
Sbjct: 241 SAETKGFETFSDEFKSKLTEAMSYQGRWLIPTAEVPLTNLVRESILSEEELPLRLTACTP 300

Query: 260 SFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRV 319
            FR+EAG+AGRDTRGM+RQHQF K ELVSIT  E S  EHERML+CAE +LK+LDLHYRV
Sbjct: 301 CFRAEAGAAGRDTRGMIRQHQFTKVELVSITTPEKSAEEHERMLACAEAVLKKLDLHYRV 360

Query: 320 VSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFT 379
           V+LCTGD+GF++ KTYD+EVWL GQ  +REISSCS CG+FQ+RRMN+RYR    K  +F 
Sbjct: 361 VTLCTGDMGFASQKTYDIEVWLPGQGAFREISSCSVCGDFQARRMNARYRPAEGKGPRFV 420

Query: 380 HTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVIKK 425
           HTLNGSGVAVGR L+A+LE Y   +G+VT+P  L PYM  L  I+K
Sbjct: 421 HTLNGSGVAVGRALVAVLETYQQENGAVTVPDALLPYMGGLKTIEK 466


>gi|296282871|ref|ZP_06860869.1| seryl-tRNA synthetase [Citromicrobium bathyomarinum JL354]
          Length = 427

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 230/428 (53%), Positives = 293/428 (68%), Gaps = 3/428 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI  IR+ PE  D AL +R  EP +  +L LD + R ++ +++D + RRN+ S  IGQ
Sbjct: 1   MHDIATIRREPEAFDAALARRGAEPVTARLLDLDTRRRAVLTELQDAQNRRNAASKAIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQ-LPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           A+  GN    D LK E + LK   LP LE++   + + +  +++ IPN+P E+VP G   
Sbjct: 61  AMGSGNTEEADRLKAEVTELKATTLPRLEEDARVLGAEMDDMLAAIPNLPAEDVPEGAGE 120

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            EN+ + + G+K       REH +IG  LGL DF+    ++GARF+ L G +A L RALG
Sbjct: 121 EENVELSTWGEKREFDFEPREHADIGPMLGL-DFEIGANIAGARFTFLRGGIARLHRALG 179

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNL 239
           QFM+D   +E+GY E + PLLVRD+A++GTGQ+PKFADD+F TTDGRWLIPT+EVSLTN 
Sbjct: 180 QFMLDRQVTENGYLECNPPLLVRDDAVFGTGQLPKFADDLFHTTDGRWLIPTAEVSLTNA 239

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
               IIE   LPLR T L P FRSEAG+AG+DTRG +RQHQF K ELVSI R EDS  EH
Sbjct: 240 VRGHIIEEAHLPLRMTALTPCFRSEAGAAGKDTRGFIRQHQFEKVELVSIVRPEDSEAEH 299

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           ERM  CAE +L+ L L YR + LCTGD+GF A KTYDLEVWL GQ  YREISSCS  G+F
Sbjct: 300 ERMTQCAEGVLQALGLPYRKMLLCTGDMGFGARKTYDLEVWLPGQGAYREISSCSNVGDF 359

Query: 360 QSRRMNSRYR-DPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           Q+RRM++RYR +   K  +F HTLNGSG+AVGR L+A+LENY + DGS+ +P  L PYM 
Sbjct: 360 QARRMSARYRPESGDKKTEFVHTLNGSGLAVGRTLVAVLENYQSEDGSIDVPEALHPYMG 419

Query: 419 NLAVIKKE 426
            L  I  E
Sbjct: 420 GLTRISPE 427


>gi|170744612|ref|YP_001773267.1| seryl-tRNA synthetase [Methylobacterium sp. 4-46]
 gi|238688057|sp|B0UD12|SYS_METS4 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|168198886|gb|ACA20833.1| seryl-tRNA synthetase [Methylobacterium sp. 4-46]
          Length = 435

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 237/435 (54%), Positives = 297/435 (68%), Gaps = 9/435 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP   D  L++R LEP +  +++LD+  +  I   +  + RRN+ S +IG 
Sbjct: 1   MHDIRVIRDNPAAFDAGLRRRGLEPLAAELVALDDARKAAISAAQVAQERRNALSKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A    +     AL  E + LKEQ P L+        +L   ++ IPN P  EVP G   +
Sbjct: 61  AKKARDEERARALMAEVARLKEQAPGLDAAADAAARALDARLAAIPNTPGPEVPEGRDEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R    +  A    R+HFE+GEA GLMDF+ A +LSG+RF VL G LA LERALGQ
Sbjct: 121 DNVELRRFEGRGRA-ESGRQHFELGEAAGLMDFEAAARLSGSRFVVLKGRLARLERALGQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLHT+EHGYTEV+ PLLVRDEAM+GT Q+PKF DD F            GRWLIPT+
Sbjct: 180 FMLDLHTAEHGYTEVAPPLLVRDEAMFGTAQLPKFRDDQFAAQPGAVEPGAPGRWLIPTA 239

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL    I+    LPLRFT L P FR+EAG+AGRDTRGMLRQHQF K ELVSIT  
Sbjct: 240 EVPLTNLVRESILSEDELPLRFTALTPCFRAEAGAAGRDTRGMLRQHQFTKVELVSITAP 299

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E S  EHERML+CAE +L+RLDL YRV++LCTGD+GF++ KTYD+EVWL GQ  YREISS
Sbjct: 300 EQSAEEHERMLACAEAVLRRLDLPYRVMTLCTGDMGFASQKTYDIEVWLPGQGTYREISS 359

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS CG+FQ+RRM +R+R    + L + H+LNGSGVAVGR LIA++ENY N DGSVT+P+ 
Sbjct: 360 CSVCGDFQARRMEARFRRREDRGLGYVHSLNGSGVAVGRALIAVMENYQNPDGSVTVPSA 419

Query: 413 LRPYMNNLAVIKKEH 427
           L PYM  +  I+  H
Sbjct: 420 LAPYMGGVTRIEGPH 434


>gi|114327916|ref|YP_745073.1| seryl-tRNA synthetase [Granulibacter bethesdensis CGDNIH1]
 gi|122327121|sp|Q0BSQ2|SYS_GRABC RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|114316090|gb|ABI62150.1| seryl-tRNA synthetase [Granulibacter bethesdensis CGDNIH1]
          Length = 423

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 224/424 (52%), Positives = 293/424 (69%), Gaps = 4/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ +R +P   D AL +R L   +  +L+LD   R+   +++D +ARRN+ + +IGQ
Sbjct: 1   MHDIRALRADPAAFDAALGRRGLPASASSLLALDADRRMAQTRLQDYQARRNALAKEIGQ 60

Query: 61  AIAEG-NLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
              +G + S+++A       L++++  LE     + +  K L+  +PN    EVP G   
Sbjct: 61  GKRQGIDTSMLEA---TAVALRDEMEALEARSASLDAEQKSLLERLPNTLDAEVPTGPDE 117

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           + N++++ VG+  S    +R+HFE+GEALG+M FD A +LSGARF VL G LA LERALG
Sbjct: 118 SANVILKQVGEPISLPFSARQHFELGEALGMMLFDAAARLSGARFVVLRGALARLERALG 177

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNL 239
           Q+M+DLH++EHG+TE+  P LV D   YGTGQ+PKF +D+F TTDGRWLIPT+EV LTNL
Sbjct: 178 QYMLDLHSTEHGFTEMQVPALVNDATAYGTGQLPKFTEDLFRTTDGRWLIPTAEVPLTNL 237

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
            +  +++  SLP+R T L   FRSEAGSAGRDTRGMLRQHQF K E+V ITR EDS  EH
Sbjct: 238 VADSVVDEASLPMRMTALTDCFRSEAGSAGRDTRGMLRQHQFHKVEMVCITRPEDSDAEH 297

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           ERM  CAE +L+ L L YR V LC+GD GFSA +TYDLEVWL GQ  +REISSCS C +F
Sbjct: 298 ERMTRCAETVLENLGLAYRRVFLCSGDTGFSAARTYDLEVWLPGQQAWREISSCSNCRDF 357

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RRM++RYR  + K     HTLNGSGVAVGR LIA++E Y   DGS+ +P VLRPYM  
Sbjct: 358 QARRMSARYRGADGKVAGVPHTLNGSGVAVGRALIAVMETYQREDGSIDVPAVLRPYMGG 417

Query: 420 LAVI 423
           L  I
Sbjct: 418 LERI 421


>gi|27379859|ref|NP_771388.1| seryl-tRNA synthetase [Bradyrhizobium japonicum USDA 110]
 gi|46577251|sp|Q89L00|SYS_BRAJA RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|27353012|dbj|BAC50013.1| seryl-tRNA synthetase [Bradyrhizobium japonicum USDA 110]
          Length = 443

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 230/444 (51%), Positives = 296/444 (66%), Gaps = 19/444 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP+  D  L +R L+P S  +L++DE+ R  I   E  +ARRN+ S +IG 
Sbjct: 1   MHDIKSIRDNPQAFDAGLARRGLKPLSASLLAIDERRRAAILASEQAQARRNAASKEIGD 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A    + +    L  E + LK  +P LE         L K +S IPN+P +EVP G   +
Sbjct: 61  AKKAKDEARAATLMAEVAELKTTMPQLEAAAKAADEELTKELSAIPNIPFDEVPDGVDEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+     G K +     + H ++G ALG MDF+ A KLSGARF VL   LA LERA+GQ
Sbjct: 121 GNVQHHVFGNKRNYGFAPKLHDDLGNALGYMDFEAAAKLSGARFVVLKKGLARLERAIGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW------------- 227
           FM+DLHT+EHGYTE++ PLLVR+E M+GTGQ+PKF DD F    G               
Sbjct: 181 FMLDLHTTEHGYTEINPPLLVRNEVMFGTGQLPKFEDDQFWAIKGELLASPDHERLKTER 240

Query: 228 --LIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCE 285
             LIPT+EVSLTNL    I++ K LP+R T L P FR+EAG+AGRDTRGM+RQHQF K E
Sbjct: 241 LGLIPTAEVSLTNLARESILDEKQLPMRLTALTPCFRAEAGAAGRDTRGMIRQHQFTKVE 300

Query: 286 LVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQ- 344
           LVSIT  E S  E ERMLSCAE++L++LDLHYRV++LC GD+GFS+ KTYD+EVW+ GQ 
Sbjct: 301 LVSITTPEASKDELERMLSCAEQVLQKLDLHYRVMTLCAGDMGFSSQKTYDIEVWMPGQG 360

Query: 345 --NLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLN 402
              ++REISSCS CG+FQ+RRM++R R P+ K  +F HTLNGSG AVGR LIA++E Y  
Sbjct: 361 DGGMFREISSCSVCGDFQARRMDARSRGPDGKP-RFVHTLNGSGTAVGRALIAVMETYQQ 419

Query: 403 ADGSVTIPTVLRPYMNNLAVIKKE 426
            DGS+ +P+VL+PYM  L VI ++
Sbjct: 420 EDGSIAVPSVLQPYMGGLKVISRD 443


>gi|56551882|ref|YP_162721.1| seryl-tRNA synthetase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241761798|ref|ZP_04759884.1| seryl-tRNA synthetase [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|67461650|sp|Q5NNV0|SYS_ZYMMO RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|56543456|gb|AAV89610.1| seryl-tRNA synthetase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241373712|gb|EER63272.1| seryl-tRNA synthetase [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 425

 Score =  461 bits (1186), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 222/420 (52%), Positives = 292/420 (69%), Gaps = 1/420 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR  PE+ D AL +R  EP S+ IL +D + R L  +++ ++ +RN  S QIGQ
Sbjct: 1   MHDIRLIRSEPENFDKALSRRGFEPVSKTILEMDGERRTLALELQTLQTKRNEVSRQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+ +G     + +K E S +KE++  LE EE  +   L++ +S IPN+  E+VP G    
Sbjct: 61  AMKQGEKDKAEEMKAEVSAIKEKMAALEGEEAALGDKLQRFLSTIPNLAAEDVPEGKDEQ 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N  +   G+        +EH +   ALGL DFD A  +SGARF+++ G +A L RA+GQ
Sbjct: 121 DNKEVFRWGEPRQFSFKPKEHADFAPALGL-DFDTAAAMSGARFALMKGAMARLNRAIGQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           +M+D  T ++G+TE++ PLLVRD A++GTGQ+PKF +D+F TTD RWLIPT+EV LTN+ 
Sbjct: 180 YMLDCQTEKNGFTEIAPPLLVRDHALFGTGQLPKFEEDLFHTTDDRWLIPTAEVCLTNIV 239

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
              I++ K+LPLRFT L P FR+EAG+AGRDTRG++RQHQF K E+V+IT  E S  E  
Sbjct: 240 RESILDEKALPLRFTALTPCFRAEAGAAGRDTRGLIRQHQFDKVEMVAITTPEQSTAEQM 299

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM+ CAE+IL+ L L YR V LCTGD+GFSA +TYDLEVWL GQN YREISS S CG FQ
Sbjct: 300 RMVECAEQILQNLKLPYRRVLLCTGDMGFSATRTYDLEVWLPGQNCYREISSISDCGAFQ 359

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR    K     HTLNGSG+AVGR L+AILENY   DG+VTIP VL PYMN +
Sbjct: 360 ARRMNTRYRPEEGKGNAAVHTLNGSGLAVGRTLVAILENYQEEDGTVTIPEVLHPYMNGI 419


>gi|260752559|ref|YP_003225452.1| seryl-tRNA synthetase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|258551922|gb|ACV74868.1| seryl-tRNA synthetase [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 425

 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 221/420 (52%), Positives = 292/420 (69%), Gaps = 1/420 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR  P++ D AL +R  EP S+ IL +D + R L  +++ ++ +RN  S QIGQ
Sbjct: 1   MHDIRLIRSEPDNFDKALSRRGFEPVSKTILEMDGERRTLALELQTLQTKRNEVSRQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+ +G     + +K E S +KE++  LE EE  +   L++ +S IPN+  E+VP G    
Sbjct: 61  AMKQGEKDKAEEMKAEVSAIKEKMAALEGEEAALGDKLQRFLSTIPNLAAEDVPEGKDEQ 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N  +   G+        +EH +   ALGL DFD A  +SGARF+++ G +A L RA+GQ
Sbjct: 121 DNKEVFRWGEPRQFSFKPKEHADFAPALGL-DFDTAAAMSGARFALMKGAMARLNRAIGQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           +M+D  T ++G+TE++ PLLVRD A++GTGQ+PKF +D+F TTD RWLIPT+EV LTN+ 
Sbjct: 180 YMLDCQTEKNGFTEIAPPLLVRDHALFGTGQLPKFEEDLFHTTDDRWLIPTAEVCLTNIV 239

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
              I++ K+LPLRFT L P FR+EAG+AGRDTRG++RQHQF K E+V+IT  E S  E  
Sbjct: 240 RESILDEKALPLRFTALTPCFRAEAGAAGRDTRGLIRQHQFDKVEMVAITTPEQSTAEQM 299

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM+ CAE+IL+ L L YR V LCTGD+GFSA +TYDLEVWL GQN YREISS S CG FQ
Sbjct: 300 RMVECAEQILQNLKLPYRRVLLCTGDMGFSATRTYDLEVWLPGQNCYREISSISDCGAFQ 359

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR    K     HTLNGSG+AVGR L+AILENY   DG+VTIP VL PYMN +
Sbjct: 360 ARRMNTRYRPEEGKGNAAVHTLNGSGLAVGRTLVAILENYQEEDGTVTIPEVLHPYMNGI 419


>gi|115524706|ref|YP_781617.1| seryl-tRNA synthetase [Rhodopseudomonas palustris BisA53]
 gi|122296078|sp|Q07N47|SYS_RHOP5 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|115518653|gb|ABJ06637.1| seryl-tRNA synthetase [Rhodopseudomonas palustris BisA53]
          Length = 476

 Score =  459 bits (1181), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 234/474 (49%), Positives = 301/474 (63%), Gaps = 52/474 (10%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP+  D A  +R L P ++ ++ LDE  RI I   E  +ARRN+ S +IG+
Sbjct: 1   MHDIKSIRDNPQAFDAAFTRRGLAPIADSLIKLDETRRIAIIASEQAQARRNAASKEIGE 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A    + +  +AL  E + LK  +P L++      ++LKK +S IPN+PL EVP G   +
Sbjct: 61  AKKAKDNARAEALMAEVTELKTTMPALDEAVKAADAALKKALSEIPNLPLAEVPQGADEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N++    G   S     + H+E+GEALG MDF+ A K+SGARF VL   LA LERA+GQ
Sbjct: 121 GNVVRSHFGAPRSYAFTPKPHYELGEALGQMDFEAAAKMSGARFVVLKKGLARLERAIGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-------------------- 220
           F +D+HT EHGYTEV+ PLLV+D+AM+GT Q+PKF++D F                    
Sbjct: 181 FFLDVHTGEHGYTEVNPPLLVKDDAMFGTAQLPKFSNDQFRVDTEEIQIKSAYEEFEKAK 240

Query: 221 ----------------------------CTTDGRWLIPTSEVSLTNLYSHEIIESKSLPL 252
                                          D RWLIPT+EVSLTNL    I++ K LP+
Sbjct: 241 NAILNYVEEAGIKSAREEKLEVLGFAYEPNPDRRWLIPTAEVSLTNLVRESILDEKELPM 300

Query: 253 RFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKR 312
           R T L P FR+EAG+AGRDTRGM+RQHQF K ELVSIT  E S  EHERML+CAEE+L+R
Sbjct: 301 RLTALTPCFRAEAGAAGRDTRGMIRQHQFTKVELVSITTPEQSKDEHERMLACAEEVLRR 360

Query: 313 LDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQ---NLYREISSCSTCGNFQSRRMNSRYR 369
           L LHYRV++LCTGD+GF++ KTYD+EVW+ GQ     YREISSCS CG+FQ+RRM++R R
Sbjct: 361 LGLHYRVMTLCTGDMGFASQKTYDIEVWMPGQGEGGAYREISSCSVCGDFQARRMDARSR 420

Query: 370 DPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVI 423
            P+ K  +F HTLNGSG AVGR LIA++ENY   DGS+ +P  L PYM  L VI
Sbjct: 421 GPDGKP-RFVHTLNGSGTAVGRALIAVIENYQQEDGSIAVPDALLPYMGGLKVI 473


>gi|170748700|ref|YP_001754960.1| seryl-tRNA synthetase [Methylobacterium radiotolerans JCM 2831]
 gi|170655222|gb|ACB24277.1| seryl-tRNA synthetase [Methylobacterium radiotolerans JCM 2831]
          Length = 467

 Score =  457 bits (1176), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 231/446 (51%), Positives = 294/446 (65%), Gaps = 23/446 (5%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP+  D  L++R L P S  +++LDE  +  +   +  + RRN+ + +IG 
Sbjct: 20  MHDIRAIRENPDAFDRDLQRRGLAPLSAELIALDEARKSSVSAAQANQERRNALAKEIGG 79

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A    +     AL  E + LK   P L+  +     +L   ++ IPN P  +VP G   +
Sbjct: 80  AKKAKDEDRAAALMAEVAALKAAEPELKAAQDAADRTLADRLAAIPNRPKPDVPEGADEH 139

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+L RS       +   REHFE+GEA GLMDF+ A KLSG+RF VL G LA LERALGQ
Sbjct: 140 GNVLYRSHAATRERLTEGREHFELGEASGLMDFEAAAKLSGSRFVVLKGQLARLERALGQ 199

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGR-------------- 226
           FM+DLHT EHGY EV+ P+LVRD AM+GT Q+PKF DD F    G               
Sbjct: 200 FMLDLHTQEHGYLEVAPPVLVRDAAMFGTAQLPKFEDDQFSVFKGLDYVRSLQGQAGADT 259

Query: 227 --------WLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQ 278
                   WL+PT+EV LTNL    I+  + LPLRFT L P FR+EAG+AGRDTRGMLRQ
Sbjct: 260 APVSDEHFWLVPTAEVPLTNLVREAILREEELPLRFTALTPCFRAEAGAAGRDTRGMLRQ 319

Query: 279 HQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLE 338
           HQF K ELVSIT  E+S  EHERML+ AE +LK+LDL YRV++LCTGD+GF++ KTYD+E
Sbjct: 320 HQFSKVELVSITTPEESANEHERMLTSAEAVLKKLDLPYRVMTLCTGDMGFASQKTYDIE 379

Query: 339 VWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILE 398
           VW+ GQ  +REISSCS CG+FQ+RRMN+RYR  + K   + HTLNGSGVAVGR LIA++E
Sbjct: 380 VWVPGQRTHREISSCSVCGDFQARRMNARYRGKDGKP-AYVHTLNGSGVAVGRALIAVME 438

Query: 399 NYLNADGSVTIPTVLRPYMNNLAVIK 424
           NY N DGS+T+P+VL PYM  L  I+
Sbjct: 439 NYQNPDGSITVPSVLHPYMGGLNRIE 464


>gi|83593105|ref|YP_426857.1| seryl-tRNA synthetase [Rhodospirillum rubrum ATCC 11170]
 gi|123526569|sp|Q2RTH5|SYS_RHORT RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|83576019|gb|ABC22570.1| seryl-tRNA synthetase [Rhodospirillum rubrum ATCC 11170]
          Length = 423

 Score =  457 bits (1176), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 221/421 (52%), Positives = 296/421 (70%), Gaps = 4/421 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M D++ IR+ PE  D+AL +R LEP+S  +L LD + R +  ++ D++ARRN  S +IG 
Sbjct: 1   MHDLKAIRETPEAFDLALARRRLEPRSALVLDLDSQRRAVQTELNDLQARRNEASKRIGL 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG  +   AL +E + +K  +  LE    ++   L   +  +PN+  + VP G   +
Sbjct: 61  VKKEGGDA--QALVDEVAGIKATMAALEARLGDLDRDLDGHLMGLPNILDDGVPEGPDES 118

Query: 121 ENILIRSVGKKPSAIHLS-REHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            N+ +R  G  P A   + R+HFEIGE+LG MDF+ A +LSGARF VL G +A LERALG
Sbjct: 119 ANVEVRRWGT-PRAFEFTPRQHFEIGESLGGMDFEAAARLSGARFVVLKGQIARLERALG 177

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNL 239
           QFM+DLH +EHGY EV  P+LVR  A+ GTGQ+PKFA+D+F      +LIPT+EV++TNL
Sbjct: 178 QFMLDLHITEHGYQEVQTPVLVRAPALQGTGQLPKFAEDLFRVEGDFFLIPTAEVTVTNL 237

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
            + +++ + +LPLR T     FRSEAG+AG+DTRGM+RQHQF K E+VSI   +DS  E 
Sbjct: 238 VAGQVLAATALPLRMTAFTQCFRSEAGAAGKDTRGMIRQHQFEKVEMVSIVHPDDSAAEL 297

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           ERM +CAE++LKRL+L YRV++LC GD+GFSA +TYDLEVWL GQ+ YREISSCS  G+F
Sbjct: 298 ERMTACAEDVLKRLELPYRVMALCAGDVGFSARQTYDLEVWLPGQDRYREISSCSNTGDF 357

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RRMN R++    K  +F HTLNGSGVAVGRCL+A+LENY NADG+V++P  LR YM  
Sbjct: 358 QARRMNGRFKVEGEKGTRFVHTLNGSGVAVGRCLVAVLENYQNADGTVSVPEALRGYMGG 417

Query: 420 L 420
           L
Sbjct: 418 L 418


>gi|220927137|ref|YP_002502439.1| seryl-tRNA synthetase [Methylobacterium nodulans ORS 2060]
 gi|254783036|sp|B8IN20|SYS_METNO RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|219951744|gb|ACL62136.1| seryl-tRNA synthetase [Methylobacterium nodulans ORS 2060]
          Length = 437

 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 237/437 (54%), Positives = 296/437 (67%), Gaps = 11/437 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D  L KR LEP S  +++LD+  +  I   +  + RRN+ S +IG 
Sbjct: 1   MHDIRVIRENPAAFDEGLAKRGLEPLSAELIALDDARKAAISAAQGAQERRNALSKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A    + +    L  E + LK++ P LE        +L   ++ IPN P  EVP+G   +
Sbjct: 61  AKKAKDEARAQDLMAEVARLKDEAPALEAAADAAAKALDARLAAIPNTPKAEVPLGRDEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+  R    +  A    R+HFE+GEA GLMDF+ A KLSGARF VL GHLA LERALGQ
Sbjct: 121 DNVEYRRFEGRGRA-EAGRQHFELGEATGLMDFEAAAKLSGARFVVLKGHLARLERALGQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG----------RWLIP 230
           FM+DLHT+EHGYTEV+ PLLVRDE M+GT Q+PKF DD F    G          RWLIP
Sbjct: 180 FMLDLHTTEHGYTEVAPPLLVRDEVMFGTAQLPKFRDDQFAAMPGSVEAEGGAPTRWLIP 239

Query: 231 TSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT 290
           T+EV LTNL    I+    LPLRFT L P FR+EAG+AGRDTRGMLRQHQF K ELVS+T
Sbjct: 240 TAEVPLTNLVRESILSEDELPLRFTALTPCFRAEAGAAGRDTRGMLRQHQFTKVELVSVT 299

Query: 291 REEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREI 350
             E S  EHERML+ AE +LK+LDL YRVV+LCTGD+GF++ KTYD+EVWL GQ  +REI
Sbjct: 300 TPEQSDEEHERMLASAEAVLKKLDLPYRVVTLCTGDMGFASQKTYDIEVWLPGQGTFREI 359

Query: 351 SSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIP 410
           SSCS CG+FQ+RRM++R+R    + +   HTLNGSGVAVGR LIA++ENY N DGSVT+P
Sbjct: 360 SSCSVCGDFQARRMDARFRRREGRGVAHVHTLNGSGVAVGRALIAVMENYQNPDGSVTVP 419

Query: 411 TVLRPYMNNLAVIKKEH 427
           + L PYM  +  I+  H
Sbjct: 420 SALVPYMGGITRIEGPH 436


>gi|103486215|ref|YP_615776.1| seryl-tRNA synthetase [Sphingopyxis alaskensis RB2256]
 gi|123253474|sp|Q1GV79|SYS_SPHAL RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|98976292|gb|ABF52443.1| seryl-tRNA synthetase [Sphingopyxis alaskensis RB2256]
          Length = 426

 Score =  456 bits (1172), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 230/420 (54%), Positives = 280/420 (66%), Gaps = 1/420 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP   D  L +R L P S  IL+ D + R L   I+   ARRN  S  IGQ
Sbjct: 1   MHDIRLIRDNPHAFDAGLARRGLAPLSAEILAADAELRALQTDIQAALARRNEASKLIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A G+    +ALK E + LK  LP  E+ E    ++L   ++ +PN+P ++VP G    
Sbjct: 61  AMAAGDKDKAEALKAEVAALKAALPAREEAERAQLAALHDRLAALPNLPADDVPDGEDEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +   G   S      EH +   ALGL DF+ A K+SGARF+ L G +A LERALGQ
Sbjct: 121 GNVELSRWGTPRSFDFTPLEHADFAPALGL-DFETAAKMSGARFAFLKGPMARLERALGQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D  T E GYTE + PLLVRD+A +GT Q+PKF +D+F TTDG WLI TSE+SLTN  
Sbjct: 180 FMLDRQTIEAGYTECATPLLVRDDAAFGTTQLPKFREDLFQTTDGLWLISTSEMSLTNAV 239

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             +I+    LP+R T L P FRSEAGSAGRDTRG +RQHQFWK ELVSITR EDS  E E
Sbjct: 240 REQILAEADLPIRMTALTPCFRSEAGSAGRDTRGYIRQHQFWKVELVSITRPEDSDAELE 299

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           R    AE IL+ L+L YR + LC GD+GF+A KTYDLEVWL GQN YREISSCS CG+FQ
Sbjct: 300 RKTRAAESILEALELPYRKMLLCAGDMGFAARKTYDLEVWLPGQNAYREISSCSNCGDFQ 359

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R+R    K  +F HTLNGSG+AVGR L+AILENY  ADGSV IP  L PYM  +
Sbjct: 360 ARRMNARFRREGGKGNEFVHTLNGSGLAVGRTLVAILENYQQADGSVDIPAALLPYMGGI 419


>gi|149186947|ref|ZP_01865256.1| SerS, seryl-tRNA synthetase [Erythrobacter sp. SD-21]
 gi|148829456|gb|EDL47898.1| SerS, seryl-tRNA synthetase [Erythrobacter sp. SD-21]
          Length = 426

 Score =  453 bits (1166), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 223/426 (52%), Positives = 292/426 (68%), Gaps = 1/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI +IR NP+  D ALK+R  EP ++ I++LD K R    ++++ ++RRN  S  IGQ
Sbjct: 1   MHDIAFIRANPDAFDAALKRRGAEPVADRIVALDAKKREAQTRVQEAQSRRNEASKAIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+ +G+    +ALK E + +K  +P  E+ E E  S L  L++ +PN+P ++VP G   +
Sbjct: 61  AMGQGDKEKAEALKAEVADIKASMPAWEEAEQEAASELTDLLARLPNMPADDVPDGADES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ + + G+K +     +EH +IG ALG MDF+    LSGARF+ L G +A L RAL Q
Sbjct: 121 DNVEVATWGEKRAFAFEPKEHADIGPALG-MDFETGASLSGARFTFLRGDIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D  T ++GY E + P+LV DEAMYGT ++PKFA+D F TTDGRWL+PTSEV LT   
Sbjct: 180 FMLDTQTRKNGYAECNPPVLVHDEAMYGTDKLPKFAEDSFQTTDGRWLVPTSEVPLTASV 239

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + +I++    P+R T     FRSEAGSAGRDTRG +RQHQF K ELVSI R EDS  EHE
Sbjct: 240 AGQILDEPVQPIRLTAHTLCFRSEAGSAGRDTRGFIRQHQFEKVELVSICRPEDSEAEHE 299

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAE IL+ L L YR V LC GD+GF A KTYDLEVWL GQ  YREISSCS  G FQ
Sbjct: 300 RMTACAEGILQALGLPYRKVLLCVGDMGFGAKKTYDLEVWLPGQGAYREISSCSNTGEFQ 359

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR    K  +F HTLNGSG+AVGR L+A++ENY   DGSVT+P  L PYM  +
Sbjct: 360 ARRMNARYRPEGEKKTRFVHTLNGSGLAVGRTLVAVMENYQEEDGSVTVPECLAPYMGGV 419

Query: 421 AVIKKE 426
           A ++ +
Sbjct: 420 AKLEPQ 425


>gi|162148003|ref|YP_001602464.1| seryl-tRNA synthetase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209542619|ref|YP_002274848.1| seryl-tRNA synthetase [Gluconacetobacter diazotrophicus PAl 5]
 gi|189083571|sp|A9HLG2|SYS_GLUDA RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|161786580|emb|CAP56162.1| Seryl-tRNA synthetase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530296|gb|ACI50233.1| seryl-tRNA synthetase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 424

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 221/423 (52%), Positives = 288/423 (68%), Gaps = 2/423 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M D++ +R +P   D AL +R   P + +I SLDE  R  +  ++D +ARR S S ++G 
Sbjct: 1   MHDLRALRADPAAFDAALARRGEAPAAIHIASLDEDRRAAVTALQDKQARRKSLSKEVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G  S   AL+ E   L+E +  LE    E+ + ++  +  +PN   + VP G   +
Sbjct: 61  LRRTGEDST--ALEAEAVQLREDIEKLEVLVRELDAEIRDCLVVLPNRLDDGVPEGADES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+++  VG++       REHF +GEALGLMDF+ A KLSGARF VL G LA +ERALGQ
Sbjct: 119 ANVVVHQVGERRDFAFPPREHFALGEALGLMDFETAGKLSGARFVVLRGALARMERALGQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLH  EHGYTE + P+LV + AM+GT ++PKFAD  F T DGRWLIPT+EV LT   
Sbjct: 179 FMLDLHVQEHGYTETAVPVLVNEAAMFGTDKLPKFADQSFRTEDGRWLIPTAEVPLTASV 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + +I+ + +LP R   L+  FRSEAG+AGRDTRGMLRQHQF K E+VSIT   DS  EHE
Sbjct: 239 AGDILPASALPRRMVALSSCFRSEAGAAGRDTRGMLRQHQFQKVEMVSITAPGDSDAEHE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE++L+RL + YR + LC GD GF A +T+DLE WL GQ+ +REISSCST  +FQ
Sbjct: 299 RMTRCAEKVLERLGIPYRRMLLCAGDTGFGAARTFDLEAWLPGQDAWREISSCSTTRDFQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR  +    +F HTLNGSG+AVGR LIA++ENY NADGS+T+P  LRPYMN L
Sbjct: 359 ARRMNARYRPADGAGPEFVHTLNGSGLAVGRTLIAVMENYQNADGSITVPQALRPYMNGL 418

Query: 421 AVI 423
           A I
Sbjct: 419 AAI 421


>gi|299134937|ref|ZP_07028128.1| seryl-tRNA synthetase [Afipia sp. 1NLS2]
 gi|298589914|gb|EFI50118.1| seryl-tRNA synthetase [Afipia sp. 1NLS2]
          Length = 486

 Score =  451 bits (1160), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 235/487 (48%), Positives = 301/487 (61%), Gaps = 61/487 (12%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP   D ALK+R LEP S  +L++DE+ R  I++ E   ARRN+ S +IG+
Sbjct: 1   MHDIRSIRDNPAAFDAALKRRGLEPLSASLLAIDERRRGAIQEAEQALARRNAASKEIGE 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A    + +  D L  E +TLK +LP LE    +    LK +++ IPN+PL+EVP G   +
Sbjct: 61  AKKNKDAARADTLMAEVATLKVKLPELEAAAKQSEDELKTVLAQIPNLPLDEVPDGADEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+     G   S     +EH E+GE LG MDF+ A KLSGARF VL   LA LERA+GQ
Sbjct: 121 GNVQHHIYGAARSYSFKPKEHVELGEGLGFMDFETAAKLSGARFVVLKKGLARLERAIGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLI----------- 229
           F +D+HT EHGY EV+ PLLVRD+AM+GT Q+PKF DD F    G + I           
Sbjct: 181 FFLDVHTGEHGYAEVNPPLLVRDDAMFGTAQLPKFEDDQFFAAPGSFNIRKLVEILEREA 240

Query: 230 --------PTSEVSLTNLYSH------------EIIES---------------------- 247
                   P S   L  ++              E++E                       
Sbjct: 241 IDHEIDAAPFSLAKLGAIFDFNNASERAKTLLAEMVEDSRVRRWLIPTAEVPLTNLVRES 300

Query: 248 ----KSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERML 303
               K LP+R T L P FR+EAG+AGRDTRGM+RQHQF K ELVSIT  E+S  EHERML
Sbjct: 301 ILDEKELPMRLTALTPCFRAEAGAAGRDTRGMIRQHQFTKVELVSITTPEESKNEHERML 360

Query: 304 SCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQ---NLYREISSCSTCGNFQ 360
           SCAEE+LKRL LHYRV++LCTGD+GF++ KTYD+EVW+ GQ    +YREISSCS CG+FQ
Sbjct: 361 SCAEEVLKRLGLHYRVMTLCTGDMGFASQKTYDIEVWMPGQGENGMYREISSCSVCGDFQ 420

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM++RYR  ++K  +F HTLNGSG AVGR LIA++E Y   DGS+ +P VL+PYM  L
Sbjct: 421 ARRMDARYRGSDNKP-RFVHTLNGSGTAVGRALIAVMETYQQEDGSIAVPDVLQPYMGGL 479

Query: 421 AVIKKEH 427
            VI K++
Sbjct: 480 KVIAKDN 486


>gi|114570456|ref|YP_757136.1| seryl-tRNA synthetase [Maricaulis maris MCS10]
 gi|122315709|sp|Q0AND9|SYS_MARMM RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|114340918|gb|ABI66198.1| seryl-tRNA synthetase [Maricaulis maris MCS10]
          Length = 425

 Score =  451 bits (1160), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 219/424 (51%), Positives = 287/424 (67%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP+  D  L  R L  QS  ++ LD   R  + K +D    RN+ S QIG+
Sbjct: 1   MHDIKLIRDNPDAFDAGLAMRGLPAQSATLIELDASRREALGKQQDAETERNALSKQIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  + L++E   LK  L    ++       L + ++ +PN+P  +VP G    
Sbjct: 61  AKASGDEAEFNRLRSEVDRLKAVLEESGQQARHFDEVLNQHLAALPNLPHADVPQGADEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+  R  G+  +     R+H ++GE+LG MDF +A ++SG+RF  L G LA LERAL Q
Sbjct: 121 DNVEERRWGEPRTMAFTPRDHVDLGESLGQMDFKKAAEISGSRFVALRGGLARLERALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGY EVS P +VRDEA++GTGQ+PKFA+D+F TTD  WLIPT+EV LTNL 
Sbjct: 181 FMLDLHTTEHGYEEVSPPYMVRDEAVFGTGQLPKFAEDLFRTTDDHWLIPTAEVPLTNLA 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
              I     LP+R T   P FRSEAGSAGRDTRGM+R HQF K E+VSI   ++S  E E
Sbjct: 241 RETIHAEADLPMRMTAYTPCFRSEAGSAGRDTRGMIRLHQFQKVEMVSIVTPDESDAELE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE++L+ L+L YRV+ LCTGD+GF+A +TYDLEVW+  Q+ YREISSCSTCG+FQ
Sbjct: 301 RMTGCAEKVLQLLELPYRVMKLCTGDMGFAARRTYDLEVWMPSQDCYREISSCSTCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM++R+R    K   F HTLNGSGVAVGR L+A+LEN+ N DGS+TIP  LRPYM  +
Sbjct: 361 ARRMDARFRKEGEKRPAFLHTLNGSGVAVGRALVAVLENHQNEDGSITIPAALRPYMGGV 420

Query: 421 AVIK 424
             I+
Sbjct: 421 ERIE 424


>gi|297717880|gb|ADI50083.1| seryl-tRNA synthetase [Candidatus Odyssella thessalonicensis L13]
          Length = 429

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 222/431 (51%), Positives = 294/431 (68%), Gaps = 7/431 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++ IR +PE LD +LK+R  EP +  +L++DE  R  + ++++++ +RN  +   G+
Sbjct: 1   MLDLKLIRSHPEILDASLKRRGKEPLAHRLLAMDETYRSALTELQELQTKRNQIAKSFGE 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G  +    L  E   +K  +  LE + +++   L   +S IPN+  ++ P G    
Sbjct: 61  AKRTGQDT--TGLAAEAEQIKASIADLEVKANQLNQELMDEMSTIPNLVADDTPDGLDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ IR VG+  +     + H+E+GE LG MDF+ A KLSG+RF VL   LA LERAL  
Sbjct: 119 ANLEIRQVGEISNFSFQPKPHYELGEDLGKMDFEVAAKLSGSRFVVLYSELARLERALAA 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMID+HTS++GY EV AP+LV ++ MYGTGQ+PKF +D F TT G W+IPT+EV LTNL 
Sbjct: 179 FMIDIHTSQYGYQEVYAPVLVHEKTMYGTGQLPKFREDQFQTTTGHWIIPTAEVVLTNLV 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           +  I+  + LPLR+T   P FR+EAG+AGRDTRGM+R HQF K ELVSIT   +S  EHE
Sbjct: 239 AEAILAEEQLPLRYTAYTPCFRAEAGAAGRDTRGMIRLHQFGKVELVSITHPSESKAEHE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM   AEEILK+L L YRV++LC GD+GFSA KTYDLEVWL  QN YREISSCS C NFQ
Sbjct: 299 RMTMAAEEILKQLKLPYRVMALCAGDMGFSAQKTYDLEVWLPSQNTYREISSCSNCSNFQ 358

Query: 361 SRRMNSRYR-----DPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
           +RRMN+RYR     +    + +F HTLNGSG+AVGR ++AILENY  +DGS+ IP VLRP
Sbjct: 359 ARRMNARYRPMATPETPKPAPEFVHTLNGSGLAVGRTIVAILENYQRSDGSIEIPEVLRP 418

Query: 416 YMNNLAVIKKE 426
           YM  + VI K+
Sbjct: 419 YMGGVEVITKK 429


>gi|294852237|ref|ZP_06792910.1| seryl-tRNA synthetase [Brucella sp. NVSL 07-0026]
 gi|294820826|gb|EFG37825.1| seryl-tRNA synthetase [Brucella sp. NVSL 07-0026]
          Length = 352

 Score =  447 bits (1151), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 211/352 (59%), Positives = 266/352 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 1   MLDIKWIRENPETLDKALAKRGAAPLSSELIALDEKRREHVGKVQAAQERRNAASKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LK+ L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 61  AMAAKDMGTAEKLKAEVGELKDFLAHAEEDERRLSKELSDALSTIPNIPLDDVPLGKDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 121 DNVELRRIGNPHNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 181 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K E+VSIT  E S  EHE
Sbjct: 241 AEEIVDMKGLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSITDAESSVAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISS
Sbjct: 301 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISS 352


>gi|197105423|ref|YP_002130800.1| seryl-tRNA synthetase [Phenylobacterium zucineum HLK1]
 gi|238690162|sp|B4RDI1|SYS_PHEZH RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|196478843|gb|ACG78371.1| seryl-tRNA synthetase [Phenylobacterium zucineum HLK1]
          Length = 426

 Score =  447 bits (1149), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 221/423 (52%), Positives = 287/423 (67%), Gaps = 1/423 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+ PE  + A   +    +   IL LDE  R     ++  +A RN  S +IGQ
Sbjct: 1   MHDIRAIRETPELYEKAWAAKGSPGKVAEILKLDEALRAAQTALQAAQAERNEASKKIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+ + +    L     TLK+ L    + E     +L+ L++ +PN+P  EVP G   +
Sbjct: 61  AKAQKDEAEATRLMAHVETLKKALEEQGEVERSAGEALRALLAGLPNIPAAEVPDGADEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G+ P AI   ++H  +GEA+GLMDF+ A ++SGARF VL G LA LERALGQ
Sbjct: 121 DNVEVRRWGE-PRAIAAPKDHATLGEAMGLMDFEAAARMSGARFVVLKGQLARLERALGQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DL T EHGYTEV+ PLLV D A YGT ++PKFA+D+F TTDGRWLIPT+EV LT+L 
Sbjct: 180 FMLDLQTQEHGYTEVNPPLLVNDAAAYGTDKLPKFAEDLFQTTDGRWLIPTAEVPLTSLV 239

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             +I+  + LPLR+T L P FRSEAG++GRDTRGM+RQHQF K ELVSIT  E S  EHE
Sbjct: 240 MGQIVAEEELPLRYTALTPCFRSEAGASGRDTRGMIRQHQFNKVELVSITTPEQSADEHE 299

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM+ CAE +LKRL+L +R + LC GD+GF A KTYDLEVWL  Q  YREISSCS  G+FQ
Sbjct: 300 RMVGCAEAVLKRLELPFRTMLLCRGDMGFGARKTYDLEVWLPSQEKYREISSCSNTGDFQ 359

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM++R +    K  ++ HTLNGSG+AVGR L+A+LENY +  G + IP  LRPYM  +
Sbjct: 360 ARRMDARAKKAGEKGTRYVHTLNGSGLAVGRTLVAVLENYQDEGGRIAIPEALRPYMPGM 419

Query: 421 AVI 423
             I
Sbjct: 420 THI 422


>gi|90424017|ref|YP_532387.1| seryl-tRNA synthetase [Rhodopseudomonas palustris BisB18]
 gi|122476273|sp|Q214W8|SYS_RHOPB RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|90106031|gb|ABD88068.1| seryl-tRNA synthetase [Rhodopseudomonas palustris BisB18]
          Length = 481

 Score =  446 bits (1147), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 234/479 (48%), Positives = 297/479 (62%), Gaps = 57/479 (11%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP   D A  +R L P ++ ++  D+  R  I   E  +ARRN+ S +IG 
Sbjct: 1   MHDIKAIRDNPTAFDDAYTRRGLAPIAQSLIDKDDARRKAILASEQAQARRNAASKEIGD 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A    +    +AL  E + LK  +P L+    +  ++LKK +S IPN+PL +VP G   +
Sbjct: 61  AKKAKDNVRAEALMAEVAELKTTMPALDAAVKDADAALKKALSEIPNLPLADVPEGKDEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N +    G K S     + H+E+GEAL  MDF+ A KLSGARF VL   LA LERA+GQ
Sbjct: 121 DNEVRSHYGVKRSYAFTPKPHYELGEALKQMDFEAAAKLSGARFVVLKKGLARLERAIGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG--------------- 225
           F +D+HT EHGYTEV+ PLLVRDEAM+GT Q+PKF DD F   +G               
Sbjct: 181 FFLDVHTEEHGYTEVNPPLLVRDEAMFGTAQLPKFEDDQFFVGNGNNVRRLQQEMRATIE 240

Query: 226 --------------------------------------RWLIPTSEVSLTNLYSHEIIES 247
                                                 RWLIPT+EV LTNL    I++ 
Sbjct: 241 ADDVKNIPDMFVPKSKYDRLLENYLRLETEQIALELTRRWLIPTAEVPLTNLVRESILDE 300

Query: 248 KSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAE 307
           K LPLR T L   FR+EAG+AGRDTRGM+RQHQF K ELVS+T  E S  EHERMLSCAE
Sbjct: 301 KELPLRMTALTQCFRAEAGAAGRDTRGMIRQHQFTKVELVSVTTPEQSKDEHERMLSCAE 360

Query: 308 EILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQ---NLYREISSCSTCGNFQSRRM 364
           E+L+RL+LHYRV++LCTGD+GF++ KTYD+EVW+ GQ     YREISSCS CG+FQ+RRM
Sbjct: 361 EVLRRLELHYRVMTLCTGDMGFASQKTYDIEVWMPGQGEGGAYREISSCSVCGDFQARRM 420

Query: 365 NSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVI 423
           ++R R P+ K  +F HTLNGSG AVGR LIA++ENY   DGS+ +PTVL+ YM  L VI
Sbjct: 421 DARSRGPDGKP-RFVHTLNGSGTAVGRALIAVIENYQQEDGSIAVPTVLQRYMGGLKVI 478


>gi|148553561|ref|YP_001261143.1| seryl-tRNA synthetase [Sphingomonas wittichii RW1]
 gi|166223292|sp|A5V3Y9|SYS_SPHWW RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|148498751|gb|ABQ67005.1| seryl-tRNA synthetase [Sphingomonas wittichii RW1]
          Length = 425

 Score =  444 bits (1143), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 227/425 (53%), Positives = 292/425 (68%), Gaps = 3/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR++P   D A+ +R  E  S  +L+LDE+ R +  +++  + RRN  S  IGQ
Sbjct: 1   MHDIRLIREDPAAFDAAIARRGAESASSRLLALDERRRAIATELQAAQTRRNEASKAIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+ + +   AL  E + LKE++P LE E  EV ++L   ++ IPN+P  +VP G    
Sbjct: 61  AKAQKDEATASALMAEVAALKERMPALEAEGAEVEAALDAALAAIPNLPAADVPDGADEQ 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N      G  P+    +REH +    LGL DF+ A  +SGARF+VL G +A L+RALG 
Sbjct: 121 DNAEQHRWGTPPAFAFEAREHADFAGPLGL-DFEAAAAISGARFAVLKGGIARLQRALGA 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D  T+  G+TEV  PLLVRDEA++GTGQ+PKFA+D+F TTDGRWLIPT+EVSLTNL 
Sbjct: 180 FMLDRQTA-AGFTEVIPPLLVRDEAVFGTGQLPKFAEDLFRTTDGRWLIPTAEVSLTNLV 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             +I+    LP++ T L P FRSEAG+AGRDTRG++RQHQF K ELV+IT  E S   HE
Sbjct: 239 REQIVAEAELPMKMTALTPCFRSEAGAAGRDTRGLIRQHQFEKVELVAITTPEQSDAVHE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
            M   AE IL+ L L YR V LCTGD+GF+A KT+DLEVWL GQ  YREISS S CG+FQ
Sbjct: 299 AMTKAAEAILEALGLPYRRVLLCTGDMGFTARKTFDLEVWLPGQGCYREISSVSNCGDFQ 358

Query: 361 SRRMNSRYRDPN-SKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           +RRMN+RYR    SK  +F HTLNGSG+AVGR L+A+LENY  ADGSVTIP  L PYM  
Sbjct: 359 ARRMNARYRPAGESKGTRFVHTLNGSGLAVGRTLVAVLENYQQADGSVTIPEALVPYMGG 418

Query: 420 LAVIK 424
           +A ++
Sbjct: 419 IAELR 423


>gi|85707597|ref|ZP_01038663.1| seryl-tRNA synthetase [Erythrobacter sp. NAP1]
 gi|85689131|gb|EAQ29134.1| seryl-tRNA synthetase [Erythrobacter sp. NAP1]
          Length = 426

 Score =  442 bits (1136), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 210/420 (50%), Positives = 285/420 (67%), Gaps = 1/420 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP   D  + +R LEP +  IL+LDE+ R L  K+++ ++RRN  S  IG 
Sbjct: 1   MHDIRMIRDNPHEFDAVMARRGLEPVAAQILALDEERRALTTKLQEAQSRRNEASKAIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+ +G+    +ALK E + +K  +P LE+ E EV   L  ++  +PN+    VP G   +
Sbjct: 61  AMGKGDKDAAEALKAEVAQIKADMPALEESEREVAKRLDDMMLALPNLLDPSVPDGEDED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G+KPS +   +EH +I  ALG MDF+ A K+SGARF+ L G +A L RALGQ
Sbjct: 121 DNVYLREWGEKPSFVFDPQEHADIAPALG-MDFETAAKISGARFTFLRGDMARLHRALGQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D +T EHG+TE + PLL+ +EA YGTGQ+PKF +D+F TTDGR LI TSE+ L N +
Sbjct: 180 FMLDNNTREHGFTECNPPLLINEEAGYGTGQLPKFGEDLFRTTDGRLLISTSEMVLGNSF 239

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             ++      P+R T L P FRSEAG+AGRDTRG +RQHQF K E++  +  E +  E +
Sbjct: 240 REQLFAESDFPMRLTALTPCFRSEAGAAGRDTRGFIRQHQFEKVEMIVASLPEKAEEELD 299

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           R+ + AE IL++L LHYRVV+LC+GD+G +  KTYD+EVWL GQ  YREISSCS  G +Q
Sbjct: 300 RITAIAEGILQKLGLHYRVVALCSGDMGAAMMKTYDIEVWLPGQGAYREISSCSNGGTYQ 359

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR   SK  ++ H LNGSG+AVGR L+A++ENY  ADGSV +P  L PYM  +
Sbjct: 360 PRRMNARYRPEGSKKSEYFHLLNGSGLAVGRTLVALIENYQQADGSVLVPEALAPYMGGV 419


>gi|329850424|ref|ZP_08265269.1| seryl-tRNA synthetase [Asticcacaulis biprosthecum C19]
 gi|328840739|gb|EGF90310.1| seryl-tRNA synthetase [Asticcacaulis biprosthecum C19]
          Length = 427

 Score =  442 bits (1136), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 214/426 (50%), Positives = 289/426 (67%), Gaps = 3/426 (0%)

Query: 1   MLDIQWIRQNPE---HLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQ 57
           M DI+ +R NP+   H   +  +   +  ++ ++SLD + R      ++ +ARRN  S Q
Sbjct: 1   MHDIKALRDNPQVYVHGWNSRGRESSQADADSLISLDSELRAAQTAFQNAQARRNEASKQ 60

Query: 58  IGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGT 117
           IGQA A+ + +   AL  E  +LK  L   + ++ ++   L+  ++ +PN+P E+VP G 
Sbjct: 61  IGQAKAQKDEAKAQALMAEVESLKTTLETEDAKQRDLGEKLRTELASLPNLPFEDVPQGE 120

Query: 118 SANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
               N+  R  G   + I   ++H ++GEA+ +MDF+ A K+SG+RF  L G LA LERA
Sbjct: 121 DEAGNVEQRRWGDPRNFIFTPKDHADLGEAMKMMDFEAAAKISGSRFVFLKGQLARLERA 180

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLT 237
           +GQFM+D+ T+EHGYTEV+ P+LV+D AM+GTGQ+PKF +D+F T +  +LIPT+EVSLT
Sbjct: 181 IGQFMLDVQTNEHGYTEVNPPVLVKDHAMFGTGQLPKFEEDLFKTAEPFYLIPTAEVSLT 240

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           NL    I   + LPLR T L   FR+EAGSAGRDT+GM+RQHQF K ELVSIT  E S  
Sbjct: 241 NLIREAITAEEELPLRLTALTNCFRAEAGSAGRDTKGMIRQHQFQKVELVSITTPEQSSE 300

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           EHERM  CAE ILKRL+L YR + LCTGD+GF A KTYDLEVWL  QN YREISSCS CG
Sbjct: 301 EHERMTGCAESILKRLELPYRTMLLCTGDMGFGARKTYDLEVWLPSQNTYREISSCSNCG 360

Query: 358 NFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +FQ+RRM++R R    K  +F HTLNGSG+AVGR L+A++ENY + +G + +P VL+PYM
Sbjct: 361 DFQARRMDARTRKAGEKGTRFVHTLNGSGLAVGRTLVAVMENYQDENGKIAVPVVLQPYM 420

Query: 418 NNLAVI 423
             L  I
Sbjct: 421 GGLTQI 426


>gi|88599731|gb|ABD45200.1| seryl-tRNA synthetase [Ehrlichia chaffeensis str. Arkansas]
          Length = 426

 Score =  442 bits (1136), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 228/429 (53%), Positives = 294/429 (68%), Gaps = 11/429 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI +I+QNPE  D A++ R+ E  ++ I+ LD K R L+ ++  ++  RN  + +I +
Sbjct: 4   MHDIDFIKQNPELFDNAMQVRNSEKVAKKIIELDVKKRHLLTQLYSLQKERNQITQEI-E 62

Query: 61  AIAEGNLSL---VDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGT 117
            + + NL     ++  KN TS + +   +++++     S L  L++ +PN+P E VPIG 
Sbjct: 63  KLKKNNLQCNIQIELSKNVTSKINDINNMIKED-----SQLVNLLNMLPNIPDERVPIGK 117

Query: 118 SANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
             N N+ +R  G K S     + H+E+GE L LMDF +A KLSG+RF +L   LA L+RA
Sbjct: 118 DENSNVELRRHGNKTSFDFPIKTHYELGENLNLMDFKQAAKLSGSRFVILKNQLAQLDRA 177

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLT 237
           L  FM+D+HT E GY+E+S P+LV + AMYG GQ+PKFADD F TT+   LIPTSEV+LT
Sbjct: 178 LSNFMLDIHTKEFGYSEISHPILVHESAMYGVGQLPKFADDSFKTTENFRLIPTSEVALT 237

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           NL S+  I    LPLRFT  +P FRSEAGSAGRDTRGM+RQHQF K ELVSI  EE S  
Sbjct: 238 NLVSNMNINGCDLPLRFTACSPCFRSEAGSAGRDTRGMMRQHQFNKVELVSIVTEEQSAP 297

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E ERM   AEEILKRL+L YRV+ LCTGD+GFSA  TYD+EVW+  QN YREISSCS C 
Sbjct: 298 ELERMTQIAEEILKRLELPYRVMMLCTGDMGFSASITYDIEVWIPSQNQYREISSCSNCK 357

Query: 358 NFQSRRMNSRYRD--PNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
            FQ+RRMN++Y     N K  KF HTLNGS +A+GR +IAILENY N DGS+TIP +LR 
Sbjct: 358 AFQARRMNTKYTTIINNVKVSKFVHTLNGSALAIGRTIIAILENYQNRDGSITIPHILRK 417

Query: 416 YMNNLAVIK 424
           YM+N  VIK
Sbjct: 418 YMDNQEVIK 426


>gi|161486749|ref|YP_507395.2| seryl-tRNA synthetase [Ehrlichia chaffeensis str. Arkansas]
          Length = 423

 Score =  442 bits (1136), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 228/429 (53%), Positives = 294/429 (68%), Gaps = 11/429 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI +I+QNPE  D A++ R+ E  ++ I+ LD K R L+ ++  ++  RN  + +I +
Sbjct: 1   MHDIDFIKQNPELFDNAMQVRNSEKVAKKIIELDVKKRHLLTQLYSLQKERNQITQEI-E 59

Query: 61  AIAEGNLSL---VDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGT 117
            + + NL     ++  KN TS + +   +++++     S L  L++ +PN+P E VPIG 
Sbjct: 60  KLKKNNLQCNIQIELSKNVTSKINDINNMIKED-----SQLVNLLNMLPNIPDERVPIGK 114

Query: 118 SANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
             N N+ +R  G K S     + H+E+GE L LMDF +A KLSG+RF +L   LA L+RA
Sbjct: 115 DENSNVELRRHGNKTSFDFPIKTHYELGENLNLMDFKQAAKLSGSRFVILKNQLAQLDRA 174

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLT 237
           L  FM+D+HT E GY+E+S P+LV + AMYG GQ+PKFADD F TT+   LIPTSEV+LT
Sbjct: 175 LSNFMLDIHTKEFGYSEISHPILVHESAMYGVGQLPKFADDSFKTTENFRLIPTSEVALT 234

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           NL S+  I    LPLRFT  +P FRSEAGSAGRDTRGM+RQHQF K ELVSI  EE S  
Sbjct: 235 NLVSNMNINGCDLPLRFTACSPCFRSEAGSAGRDTRGMMRQHQFNKVELVSIVTEEQSAP 294

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E ERM   AEEILKRL+L YRV+ LCTGD+GFSA  TYD+EVW+  QN YREISSCS C 
Sbjct: 295 ELERMTQIAEEILKRLELPYRVMMLCTGDMGFSASITYDIEVWIPSQNQYREISSCSNCK 354

Query: 358 NFQSRRMNSRYRD--PNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
            FQ+RRMN++Y     N K  KF HTLNGS +A+GR +IAILENY N DGS+TIP +LR 
Sbjct: 355 AFQARRMNTKYTTIINNVKVSKFVHTLNGSALAIGRTIIAILENYQNRDGSITIPHILRK 414

Query: 416 YMNNLAVIK 424
           YM+N  VIK
Sbjct: 415 YMDNQEVIK 423


>gi|304319796|ref|YP_003853439.1| seryl-tRNA synthetase [Parvularcula bermudensis HTCC2503]
 gi|303298699|gb|ADM08298.1| seryl-tRNA synthetase [Parvularcula bermudensis HTCC2503]
          Length = 425

 Score =  441 bits (1134), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 212/419 (50%), Positives = 284/419 (67%), Gaps = 1/419 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ I+ +P+  D A+ +R +  ++  +++LDE+     K + + +A +   S  IGQ
Sbjct: 1   MHDIRAIKDDPDGFDAAMSRRGVAIKAADLIALDERRVANTKAMNEAQAAQKQASKAIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+  G+ +  +ALK E + LK  +   E ++  +   L+  +  IPN    +VP G S +
Sbjct: 61  AMGAGDQAKAEALKAEVAALKASVQEREADDRRLSDELRAALLPIPNRLAPDVPDGESED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ IR  G  P  I   ++H ++GE LG MDF+ A K+SG+RF++LTG LA LERAL  
Sbjct: 121 DNVEIRRWGTPPD-IATPQDHVDLGEGLGQMDFETAAKISGSRFALLTGDLARLERALAT 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLH  E GY EVS P+LVRD+A+ GTGQ+PKF +D+F TT G +L PT+EV LTNL 
Sbjct: 180 FMLDLHRHEFGYIEVSPPVLVRDDALVGTGQLPKFEEDLFKTTSGHYLTPTAEVPLTNLV 239

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
              ++E  SLP R+T   P FRSEAGSAGRDTRGM+R HQF K ELVSIT  E+   EHE
Sbjct: 240 RDSLLEEDSLPRRYTAYTPCFRSEAGSAGRDTRGMIRLHQFSKVELVSITTPEEGHQEHE 299

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM   AE +L+RLDL YRVV+LC GD+GF A KTYDLEVWL  QN YREISSCS  G+FQ
Sbjct: 300 RMTQAAETVLQRLDLPYRVVTLCAGDIGFGALKTYDLEVWLPAQNTYREISSCSYVGDFQ 359

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           +RRMN+R+R    K   + HTLNGSG+AVGR L+A+LENY  ADG++ +P  L+PY+  
Sbjct: 360 ARRMNARFRREGEKKPLYVHTLNGSGLAVGRTLVAVLENYQEADGAIRVPDALQPYIGQ 418


>gi|42519946|ref|NP_965861.1| seryl-tRNA synthetase [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|67461816|sp|Q73IW5|SYS_WOLPM RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|42409683|gb|AAS13795.1| seryl-tRNA synthetase [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 425

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 223/434 (51%), Positives = 301/434 (69%), Gaps = 18/434 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHL-EPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQI- 58
           M DI++IR+NPE  + A+K R + E  +E IL +D + R L  K++D+  +RN  + +I 
Sbjct: 1   MHDIEYIRKNPEGFEKAMKSRGIRESTAEEILEIDHEKRSLTTKLQDLNRQRNEITEEIK 60

Query: 59  ----GQAIAEGNLSLVDALKNETS--TLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEE 112
                ++  E  + L  ++ NE    +LKEQ    EK++      L  ++S +PN+P ++
Sbjct: 61  KLKMSKSPCEEQIELSKSITNEIEAISLKEQA---EKDK------LVNVLSNLPNIPAQD 111

Query: 113 VPIGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLA 172
           VPIG   N N+ +R  G K     +   H+E+GE LGLMDF++A ++SG+RF++L G LA
Sbjct: 112 VPIGADENSNLEVRRYGGKRQFDFVPESHYELGEKLGLMDFEQAARISGSRFTILKGQLA 171

Query: 173 HLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTS 232
            L RAL   M+++H +E GYTEV  P LV++EAMY  GQ+PKF+DD + TTD   LIPTS
Sbjct: 172 KLGRALINCMLEMHVNEFGYTEVYHPALVKNEAMYNVGQLPKFSDDSYLTTDELRLIPTS 231

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL + +I+E K LP+RFT  +  FR EAGSAGRDTRGM+RQHQF K ELVSIT E
Sbjct: 232 EVFLTNLVADKIMEEKELPIRFTAYSECFRKEAGSAGRDTRGMIRQHQFGKVELVSITTE 291

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           + S  E ERM S AEEILK+L+L YRV+ LC+GD+GF+A +TYD+EVWL GQN YREISS
Sbjct: 292 DQSNDELERMTSVAEEILKKLELPYRVMLLCSGDMGFAAQRTYDIEVWLPGQNKYREISS 351

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSL-KFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPT 411
           CS CG FQ+RRMN++Y     K + K+ HTLNGS +A+GR +IAI+ENY N+DGS+ IP 
Sbjct: 352 CSNCGAFQARRMNTKYSSETDKKMKKYIHTLNGSALAIGRTIIAIMENYQNSDGSIAIPN 411

Query: 412 VLRPYMNNLAVIKK 425
           VL+ YM+N  VI K
Sbjct: 412 VLQKYMSNDTVISK 425


>gi|114771849|ref|ZP_01449242.1| seryl-tRNA synthetase [alpha proteobacterium HTCC2255]
 gi|114547665|gb|EAU50556.1| seryl-tRNA synthetase [alpha proteobacterium HTCC2255]
          Length = 430

 Score =  440 bits (1131), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 216/430 (50%), Positives = 293/430 (68%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR +P   D ALK+R  E  S  IL +D   R  I   E   A RN+ S  +G 
Sbjct: 1   MHDIRTIRDDPNKFDAALKRRGAEAISSVILDIDLDRRAKITSAEAALAERNTASKMVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  + L+N  S  K ++  LE+   E+ + L+ L+  IPN+P ++VP G+  N
Sbjct: 61  AKASGDETEFNRLRNLVSEKKAEIASLEESAKEIDNKLRNLLLTIPNLPYDDVPTGSDEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G+ P+    + EH++I      MDF+ A K+SG+RF +L+G +A + RAL Q
Sbjct: 121 DNVEVHKWGELPAFEFDALEHYDIKSVSKGMDFETAAKMSGSRFVILSGAIARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D HT+E+G TEV+ P+LVRDEAM+GTGQ+PKF++D + T++G WL+PTSEV+LTN+ 
Sbjct: 181 FMLDTHTTENGLTEVNTPVLVRDEAMFGTGQLPKFSEDSYQTSNGWWLVPTSEVTLTNIA 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           +       +LP RFT  +  FRSEAGSAGRDT GMLRQHQF K E+VSI + EDS  E +
Sbjct: 241 ADTTTTEDNLPRRFTAHSLCFRSEAGSAGRDTSGMLRQHQFEKVEMVSIVKPEDSDLELD 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CA+ IL++L+L YR V LCTGD+GFSA +T D+EVWL GQN YREISSCSTCG+FQ
Sbjct: 301 RMTKCAQGILEKLELPYRTVKLCTGDMGFSAKRTNDIEVWLPGQNAYREISSCSTCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           SRRMN+R++   +K  +F HTLNGSG+AVGRCLIA+LEN    DGSV +P VL  ++   
Sbjct: 361 SRRMNARFKRTGAKKPEFVHTLNGSGLAVGRCLIAVLENGQQEDGSVILPKVLTQHLGGK 420

Query: 421 AVIKKEHILE 430
             +  + ILE
Sbjct: 421 TRLNTKGILE 430


>gi|225629896|ref|YP_002726687.1| seryl-tRNA synthetase [Wolbachia sp. wRi]
 gi|225591877|gb|ACN94896.1| seryl-tRNA synthetase [Wolbachia sp. wRi]
          Length = 432

 Score =  438 bits (1127), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 222/434 (51%), Positives = 301/434 (69%), Gaps = 18/434 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHL-EPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQI- 58
           M DI++IR+NPE  + A+K R + E  +E IL +D + R L  K++D+  +RN  + +I 
Sbjct: 8   MHDIEYIRKNPEGFEKAMKSRGIRESTAEEILEIDHEKRSLTTKLQDLNRQRNEITEEIK 67

Query: 59  ----GQAIAEGNLSLVDALKNETS--TLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEE 112
                ++  E  + L  ++ NE    +LKEQ    EK++      L  ++S +PN+P ++
Sbjct: 68  KLKMSKSPCEEQIELSKSITNEIEAISLKEQA---EKDK------LVNVLSNLPNIPAQD 118

Query: 113 VPIGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLA 172
           VPIG   N N+ +R  G K     +   H+E+GE LGL+DF++A ++SG+RF++L G LA
Sbjct: 119 VPIGADENSNLEVRRYGGKRQFDFVPESHYELGEKLGLIDFEQAARISGSRFTILKGQLA 178

Query: 173 HLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTS 232
            L RAL   M+++H +E GYTEV  P LV++EAMY  GQ+PKF+DD + TTD   LIPTS
Sbjct: 179 KLGRALINCMLEMHVNEFGYTEVYHPALVKNEAMYNVGQLPKFSDDSYLTTDELRLIPTS 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL + +I+E K LP+RFT  +  FR EAGSAGRDTRGM+RQHQF K ELVSIT E
Sbjct: 239 EVFLTNLVADKIMEEKELPIRFTAYSECFRKEAGSAGRDTRGMIRQHQFGKVELVSITTE 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           + S  E ERM S AEEILK+L+L YRV+ LC+GD+GF+A +TYD+EVWL GQN YREISS
Sbjct: 299 DQSNDELERMTSVAEEILKKLELPYRVMLLCSGDMGFAAQRTYDIEVWLPGQNKYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSL-KFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPT 411
           CS CG FQ+RRMN++Y     K + K+ HTLNGS +A+GR +IAI+ENY N+DGS+ IP 
Sbjct: 359 CSNCGAFQARRMNAKYSSETDKKIKKYVHTLNGSALAIGRTIIAIMENYQNSDGSIAIPN 418

Query: 412 VLRPYMNNLAVIKK 425
           VL+ YM+N  VI K
Sbjct: 419 VLQKYMSNDTVISK 432


>gi|289523031|ref|ZP_06439885.1| serine--tRNA ligase [Anaerobaculum hydrogeniformans ATCC BAA-1850]
 gi|289503574|gb|EFD24738.1| serine--tRNA ligase [Anaerobaculum hydrogeniformans ATCC BAA-1850]
          Length = 430

 Score =  438 bits (1126), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 216/425 (50%), Positives = 289/425 (68%), Gaps = 3/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           +LDI+WIR+NP+     L+ R  E   + +L LD   R  + ++E ++A+RN  S ++ +
Sbjct: 5   LLDIKWIRENPDEARRMLQNRGYEYPLDELLDLDSLRRQKLIEVEGLKAKRNEGSKEVAK 64

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
             ++G       L  E   + E + +L+KE  ++  +L+ L+  IPN P E VP+G S  
Sbjct: 65  LKSKGEDP--SNLMEEIRNINEDIKVLDKEVQDIEENLRDLLLQIPNKPHESVPVGKSEE 122

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+++RSVG+ P      + H+E+GE +GLMDF+   KL+G+RF+VL G+ A L RAL  
Sbjct: 123 DNVVVRSVGELPKFDFEPKPHWELGEKMGLMDFEAGIKLAGSRFTVLRGNGARLARALIN 182

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGRWLIPTSEVSLTNL 239
           FM+DLHT EHGY E   P +V  + M GTGQ+PKFA+D++ C +D  WLIPT+EV LTN+
Sbjct: 183 FMLDLHTREHGYLEFEPPFIVNSKTMTGTGQLPKFANDLYHCESDDLWLIPTAEVPLTNM 242

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           ++ EI++   LPL +T   P FR EAGS GRD RGMLRQHQF K ELV I   E S+ E 
Sbjct: 243 HAEEILDEDVLPLYYTAYTPCFRREAGSHGRDVRGMLRQHQFDKVELVKICTPETSYDEL 302

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++   AEE+LKRL L YRVV LCTGD+GF+A KTYDLEVWL  QN YREISSCS C +F
Sbjct: 303 EKLTQNAEEVLKRLGLPYRVVCLCTGDMGFAASKTYDLEVWLPSQNTYREISSCSNCEDF 362

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RRMN+RY+   +K  +F HTLNGSG+AVGRCLIAI+ENY  ADGS+ IP  L PYM  
Sbjct: 363 QARRMNTRYKPRGAKGTRFVHTLNGSGIAVGRCLIAIMENYQQADGSIKIPDALVPYMKG 422

Query: 420 LAVIK 424
           L  I+
Sbjct: 423 LTEIR 427


>gi|58584721|ref|YP_198294.1| seryl-tRNA synthetase [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
 gi|67461610|sp|Q5GSH2|SYS_WOLTR RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|58419037|gb|AAW71052.1| Seryl-tRNA synthetase [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
          Length = 425

 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 220/434 (50%), Positives = 300/434 (69%), Gaps = 18/434 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHL-EPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQI- 58
           M DI++IRQN E  + A++ R + E  +E IL +D K R+L  K++D+  +RN  + +I 
Sbjct: 1   MHDIEYIRQNSEEFEKAMESRGMKEFSAEEILKVDHKKRLLTTKLQDLNRQRNEITKKIK 60

Query: 59  ----GQAIAEGNLSLVDALKNETS--TLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEE 112
                ++  E  +     + NE    +LKEQ+   EK++      L  ++S +PN+P++ 
Sbjct: 61  ELKMSKSPCEKQIKSSKNITNEIEAISLKEQM---EKDK------LVNILSNLPNIPVQG 111

Query: 113 VPIGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLA 172
           VPIG   N N+ +R   +K     + + H+E+GE LGLMDF++A K+SG+RF++L G LA
Sbjct: 112 VPIGAGENSNLEVRRYREKRQFDFVPKSHYELGERLGLMDFEQAAKISGSRFAILKGQLA 171

Query: 173 HLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTS 232
            L RAL  FM+++H +E GYTEV  P+LV++EAMY  GQ+PKF+DD + TTD   LIPT 
Sbjct: 172 KLGRALINFMLEMHVNEFGYTEVYHPVLVKNEAMYNVGQLPKFSDDSYLTTDELRLIPTG 231

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTN  + +I+E K LP+RFT  +  FR EAGSAG+ TRGM+RQHQF K ELVSIT E
Sbjct: 232 EVVLTNSVADKIVEEKKLPIRFTAYSECFRKEAGSAGQSTRGMIRQHQFGKVELVSITTE 291

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           + S  E ERM   AEEILKRL+L YRV+ LC+GD+GF+A KTYD+EVWL  QN YREISS
Sbjct: 292 DQSNDELERMTGVAEEILKRLELPYRVILLCSGDMGFAAQKTYDIEVWLPEQNRYREISS 351

Query: 353 CSTCGNFQSRRMNSRYR-DPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPT 411
           CS CGNFQ+RRMN++Y  + N K  K+ HTLNGS +A+GR +IA++ENY N DGS+TIP 
Sbjct: 352 CSNCGNFQARRMNAKYSLEANKKVKKYVHTLNGSALAIGRTIIAVMENYQNPDGSITIPN 411

Query: 412 VLRPYMNNLAVIKK 425
           VL+ Y++N  VI K
Sbjct: 412 VLQKYISNGTVISK 425


>gi|330993311|ref|ZP_08317246.1| Seryl-tRNA synthetase [Gluconacetobacter sp. SXCC-1]
 gi|329759341|gb|EGG75850.1| Seryl-tRNA synthetase [Gluconacetobacter sp. SXCC-1]
          Length = 423

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 213/424 (50%), Positives = 283/424 (66%), Gaps = 3/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M D++ +R +P+  D  LK+R     ++ +L LD   R     +++++ARRN  S +IG 
Sbjct: 1   MHDLRALRADPDGFDADLKRRGEPAVAQAVLLLDHDRRAAETALQELQARRNQISREIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G  +   AL+ E +  K  +  L+    ++   ++  +  +PN   E VP G   +
Sbjct: 61  MRRSG--ADTSALEAEVTGAKAHMEALQARVDDLDGQIRGTLERLPNRLDESVPAGADES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +   G  P     +REHFE+GEALGLMDF+ A++LSGARF VL G LA +ERALGQ
Sbjct: 119 GNVQVHQHGTPPEFAFAAREHFELGEALGLMDFETASRLSGARFVVLRGQLARMERALGQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT E+GY E + P+LV +EAMYGT ++PKFAD  F T DGRWLIPT+EV LT   
Sbjct: 179 FMLDLHTGENGYEETAVPVLVNNEAMYGTDKLPKFADQSFRTEDGRWLIPTAEVPLTASV 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + +I+    LP R   L+  FRSEAG+AGRDTRGMLRQHQF K E+VSIT  E+S  EHE
Sbjct: 239 AGQILPVGVLPQRLVALSSCFRSEAGAAGRDTRGMLRQHQFQKVEMVSITTPEESDAEHE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE +L++L + YR + LC GD GF A +T+DLE WL GQ  +REISSCST  +FQ
Sbjct: 299 RMTRCAEMVLEKLGIPYRRMLLCAGDTGFGAARTFDLEAWLPGQKAWREISSCSTTRDFQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RR+N+RYR  + K   F HTLNGSG+AVGR LIA++ENY  ADGS+T+P VLRPYM  +
Sbjct: 359 ARRLNARYRAADGKP-AFVHTLNGSGLAVGRTLIAVMENYQTADGSITVPDVLRPYMGGI 417

Query: 421 AVIK 424
            VI+
Sbjct: 418 EVIR 421


>gi|146276505|ref|YP_001166664.1| seryl-tRNA synthetase [Rhodobacter sphaeroides ATCC 17025]
 gi|145554746|gb|ABP69359.1| seryl-tRNA synthetase [Rhodobacter sphaeroides ATCC 17025]
          Length = 430

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 215/430 (50%), Positives = 282/430 (65%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP+  D AL +R L   S  IL++DE  R  I   E  +A +N  S  +G 
Sbjct: 1   MHDIRAIRENPDRFDTALARRGLSALSGEILAIDEARRSKILAAETAQAEQNRASKDVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  + L+   +  K ++  L +E     + L+ ++  +PN+PL++VP G   +
Sbjct: 61  AKARGDEAEFERLRALVAEKKAEIARLNEEAAAEDARLRDMLVALPNLPLDDVPDGPDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ IR  G   +     +EHFEI      MDF  A KLSG+RF +LTG +  + RAL Q
Sbjct: 121 ANVEIRRWGAPRNFSFTPKEHFEIAGVKPGMDFATAAKLSGSRFVMLTGAVIRVHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H +EHG TE   P+LV+DEAM+GTGQ+PKF++D + TT+G WLIPT+EV+LTN  
Sbjct: 181 FMLDTHVAEHGLTETWTPVLVKDEAMFGTGQLPKFSEDSYQTTNGWWLIPTAEVTLTNTV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI+E   LP+R T     FRSEAGSAG+DT GMLRQHQF K E+VSIT  E S  EHE
Sbjct: 241 AGEILEEAQLPIRMTAHTQCFRSEAGSAGKDTAGMLRQHQFEKVEMVSITTPETSRAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE IL++L L YR + LCTGD+GF A +T+DLEVWL GQN YREISS S CG+FQ
Sbjct: 301 RMTRCAEAILEKLGLPYRTIVLCTGDMGFGATRTHDLEVWLPGQNTYREISSVSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R+R       +F HTLNGSG+AVGRCLIA+LEN    DG+V +P VL PY+   
Sbjct: 361 ARRMNARFRPAGGGKPEFVHTLNGSGLAVGRCLIAVLENGQQEDGAVELPAVLHPYLGGK 420

Query: 421 AVIKKEHILE 430
             I  +  LE
Sbjct: 421 GRIAADGTLE 430


>gi|89053561|ref|YP_509012.1| seryl-tRNA synthetase [Jannaschia sp. CCS1]
 gi|123286896|sp|Q28TH5|SYS_JANSC RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|88863110|gb|ABD53987.1| seryl-tRNA synthetase [Jannaschia sp. CCS1]
          Length = 430

 Score =  432 bits (1111), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 212/426 (49%), Positives = 284/426 (66%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+ P   D AL  R L   S  IL++DE  R  I + E  +A RN+ S ++G+
Sbjct: 1   MHDIRAIRETPAAFDAALALRGLSAASADILAIDEARRAAITQAETAQADRNAASKEVGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  + L+   ST K+++  L++E     + L  ++  +PN+P  +VP G   +
Sbjct: 61  AKASGDEAEFERLRALVSTKKDEIARLDEEAKAKDAELTAILEALPNLPSPDVPAGADED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+     G   +      EHF+I      MDF+ A KLSGARF  L G +A + RAL Q
Sbjct: 121 DNVEQHRRGTPRAFDFKPLEHFDIPGIAASMDFETAAKLSGARFVTLKGAVARVHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D HT E+G TE++AP+LVRDE MYGTGQ+PKFA+D + TT+G WLIPTSEV+LT+L 
Sbjct: 181 FMLDTHTEENGLTEINAPVLVRDETMYGTGQLPKFAEDSYQTTNGWWLIPTSEVTLTSLD 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           S  I++  +LP R+   +  FRSEAGSAGRDT GMLRQHQF K E+VS+T  + S  E +
Sbjct: 241 SGNIVDEATLPHRYAAHSLCFRSEAGSAGRDTAGMLRQHQFEKVEMVSVTHPDQSNAEQQ 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML+CAE IL +L++ YR V LC GD+GF A +TYD+E WL GQ+ YREISS STCG FQ
Sbjct: 301 RMLACAEGILDKLEIPYRTVLLCAGDMGFGATRTYDIEAWLPGQDTYREISSVSTCGAFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++  +    +F HTLNGSG+AVGRCLIA+LEN  NADGSVT+P  L P++   
Sbjct: 361 ARRMNARFKPSDGGKPEFVHTLNGSGLAVGRCLIAVLENGQNADGSVTLPAALHPWLGGK 420

Query: 421 AVIKKE 426
             I  E
Sbjct: 421 TRITAE 426


>gi|126461215|ref|YP_001042329.1| seryl-tRNA synthetase [Rhodobacter sphaeroides ATCC 17029]
 gi|126102879|gb|ABN75557.1| seryl-tRNA synthetase [Rhodobacter sphaeroides ATCC 17029]
          Length = 430

 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 217/430 (50%), Positives = 279/430 (64%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+ P+  D AL +R L   S  IL++DE  R  I   E  +A +N  S ++G 
Sbjct: 1   MHDIRIIREFPDRFDTALSRRGLSALSGEILAIDEARRSKILAAETAQAEQNRASKEVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  + L+   +  K ++  L +E     + L+ ++  IPN+PL+EVP G   +
Sbjct: 61  AKARGDEAEFERLRALVAEKKAEVARLNEEAAAEDARLRDMLVAIPNLPLDEVPEGPDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ IR  G         +EHFEI      MDF  A KLSG+RF +L G +  + RAL Q
Sbjct: 121 ANVEIRRWGTPRGFNFAPKEHFEIAGVKPGMDFATAAKLSGSRFVMLKGAVIRVHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H +EHG TE   P+LV+DEAM+GTGQ+PKF++D + TT+G WLIPTSEV+LTN  
Sbjct: 181 FMLDTHVTEHGLTETWTPVLVKDEAMFGTGQLPKFSEDSYQTTNGWWLIPTSEVTLTNTV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           S EI++   LP+R T     FRSEAGSAG+DT GMLRQHQF K E+VSIT  E S  EHE
Sbjct: 241 SGEILDEAQLPVRMTAHTQCFRSEAGSAGKDTSGMLRQHQFEKVEMVSITTPETSLAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE IL++L L YR + LCTGD+GF A KT+DLEVWL GQN YREISS S CG+FQ
Sbjct: 301 RMTGCAEAILQKLGLPYRTIVLCTGDMGFGATKTHDLEVWLPGQNTYREISSVSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R+R       +F HTLNGSG+AVGRCLIA+LEN    DGSV +P  L PY+   
Sbjct: 361 ARRMNARFRPAGGGKPEFVHTLNGSGLAVGRCLIAVLENGQQEDGSVELPEALHPYLGGK 420

Query: 421 AVIKKEHILE 430
             I  +  LE
Sbjct: 421 TRISADGTLE 430


>gi|77462339|ref|YP_351843.1| seryl-tRNA synthetase [Rhodobacter sphaeroides 2.4.1]
 gi|77386757|gb|ABA77942.1| seryl-tRNA synthetase [Rhodobacter sphaeroides 2.4.1]
          Length = 430

 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 216/430 (50%), Positives = 280/430 (65%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+ P+  D AL +R L   S  IL++DE  R  I   E  +A +N  S ++G 
Sbjct: 1   MHDIRIIREFPDRFDTALSRRGLSALSGEILAIDEARRSKILAAETAQAEQNRASKEVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  + L+   +  K ++  L +E     + L+ +++ IPN+PL+EVP G   +
Sbjct: 61  AKARGDEAEFERLRALVAEKKAEVARLNEEAAAEDARLRDMLAAIPNLPLDEVPEGPDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ IR  G         +EHFEI      MDF  A KLSG+RF +L G +  + RAL Q
Sbjct: 121 ANVEIRRWGTPRGFNFAPKEHFEIAGVKPGMDFATAAKLSGSRFVMLKGAVIRVHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H +EHG TE   P+LV+DEAM+GTGQ+PKF++D + TT+G WLIPTSEV+LTN  
Sbjct: 181 FMLDTHVTEHGLTETWTPVLVKDEAMFGTGQLPKFSEDSYQTTNGWWLIPTSEVTLTNSV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++   LP+R T     FRSEAGSAG+DT GMLRQHQF K E+VSIT  E S  EHE
Sbjct: 241 AGEILDEAQLPIRMTAHTQCFRSEAGSAGKDTSGMLRQHQFEKVEMVSITTPETSLAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE IL++L L YR + LCTGD+GF A KT+DLEVWL GQN YREISS S CG+FQ
Sbjct: 301 RMTGCAEAILQKLGLPYRTIVLCTGDMGFGATKTHDLEVWLPGQNTYREISSVSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R+R       +F HTLNGSG+AVGRCLIA+LEN    DGSV +P  L PY+   
Sbjct: 361 ARRMNARFRPAGGGKPEFVHTLNGSGLAVGRCLIAVLENGQQEDGSVELPEALHPYLGGK 420

Query: 421 AVIKKEHILE 430
             I  +  LE
Sbjct: 421 TRISADGTLE 430


>gi|254486623|ref|ZP_05099828.1| seryl-tRNA synthetase [Roseobacter sp. GAI101]
 gi|214043492|gb|EEB84130.1| seryl-tRNA synthetase [Roseobacter sp. GAI101]
          Length = 430

 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 209/429 (48%), Positives = 285/429 (66%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP+  D AL +R   P +  IL+LD   R +I   E  +A +N  S  +G 
Sbjct: 1   MHDIKAIRENPDAFDAALARRGDAPVTGEILALDTARRGMINAAETAQAEQNKASKLVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+ +  + L+   S  K ++  ++ E  ++ + L  +++ IPN+P ++VP G   N
Sbjct: 61  AKAKGDEAEFERLRTLVSDKKAEVTRMQAEAKDLDAQLTDMLARIPNLPADDVPEGADEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G  PS    ++EHFEI      MDF+ A K SGARF +L G +A + RAL Q
Sbjct: 121 DNVEVNRWGDVPSYDFAAKEHFEIASVAASMDFETAAKTSGARFVMLKGAVARVHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H   +G TE + P+LVRDEAMYGT ++PKF DD + TT+G WLIPTSEV+LT   
Sbjct: 181 FMVDTHVDHNGLTEYATPVLVRDEAMYGTDKLPKFGDDSYQTTNGWWLIPTSEVTLTYSV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           S +++E  +LP R T     FRSEAGSAGRDT GMLRQHQF K E+VSIT  + S  E +
Sbjct: 241 SGDVLEEAALPRRMTAHTLCFRSEAGSAGRDTSGMLRQHQFEKVEMVSITHPDASDDEQK 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML CAE++L+RL + YR V LCTGD+GF A +T+D+E WL GQN YREISS ST G+FQ
Sbjct: 301 RMLRCAEDLLERLGVPYRTVLLCTGDMGFGARRTFDIEAWLPGQNAYREISSVSTTGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++  +    +F HTLNGSG+AVGRCLIA+LEN   ADGSV +P VL PY+   
Sbjct: 361 ARRMNARFKPADGSKPQFVHTLNGSGLAVGRCLIAVLENGQQADGSVQLPDVLAPYLGGK 420

Query: 421 AVIKKEHIL 429
            ++  + +L
Sbjct: 421 TLLGADGVL 429


>gi|332560222|ref|ZP_08414544.1| seryl-tRNA synthetase [Rhodobacter sphaeroides WS8N]
 gi|332277934|gb|EGJ23249.1| seryl-tRNA synthetase [Rhodobacter sphaeroides WS8N]
          Length = 430

 Score =  431 bits (1107), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 216/430 (50%), Positives = 279/430 (64%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+ P+  D AL +R L   S  IL++DE  R  I   E  +A +N  S ++G 
Sbjct: 1   MHDIRIIREFPDRFDTALSRRGLSALSGEILAIDEARRSKILAAETAQAEQNRASKEVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  + L+   +  K ++  L +E     + L+ ++  IPN+PL+EVP G   +
Sbjct: 61  AKARGDEAEFERLRALVAEKKAEVARLNEEAAAEDARLRDMLVAIPNLPLDEVPEGPDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ IR  G         +EHFEI      MDF  A KLSG+RF +L G +  + RAL Q
Sbjct: 121 ANVEIRRWGTPRGFNFAPKEHFEIAGVKPGMDFATAAKLSGSRFVMLKGAVIRVHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H +EHG TE   P+LV+DEAM+GTGQ+PKF++D + TT+G WLIPTSEV+LTN  
Sbjct: 181 FMLDTHVTEHGLTETWTPVLVKDEAMFGTGQLPKFSEDSYQTTNGWWLIPTSEVTLTNSV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++   LP+R T     FRSEAGSAG+DT GMLRQHQF K E+VSIT  E S  EHE
Sbjct: 241 AGEILDEAQLPIRMTAHTQCFRSEAGSAGKDTSGMLRQHQFEKVEMVSITTPETSLAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE IL++L L YR + LCTGD+GF A KT+DLEVWL GQN YREISS S CG+FQ
Sbjct: 301 RMTGCAEAILQKLGLPYRTIVLCTGDMGFGATKTHDLEVWLPGQNTYREISSVSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R+R       +F HTLNGSG+AVGRCLIA+LEN    DGSV +P  L PY+   
Sbjct: 361 ARRMNARFRPAGGGKPEFVHTLNGSGLAVGRCLIAVLENGQQEDGSVELPEALHPYLGGK 420

Query: 421 AVIKKEHILE 430
             I  +  LE
Sbjct: 421 TRISADGTLE 430


>gi|163731955|ref|ZP_02139402.1| seryl-tRNA synthetase [Roseobacter litoralis Och 149]
 gi|161395409|gb|EDQ19731.1| seryl-tRNA synthetase [Roseobacter litoralis Och 149]
          Length = 430

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 210/429 (48%), Positives = 285/429 (66%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D AL +R   P S+ IL+LD   R  I   E+ +A +N  S ++GQ
Sbjct: 1   MHDIRAIRENPAAFDAALARRGEAPMSQAILALDTARRAKINAAENAQAEQNKASKEVGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+ +  + L+   S  K  +  ++ +   + + L + +S I N+P ++VP G   +
Sbjct: 61  AKAKGDEATFEQLRALVSEKKALIAQMQADAKTLDAELTEKLSWIANIPADDVPDGADED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G  P      +EH+EIG     MDFD A K SGARF +L G +A + RAL Q
Sbjct: 121 DNVEVRRWGHLPDFEFTPKEHYEIGGVAASMDFDTAAKTSGARFVMLKGAVARIHRALSQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMID H   +G TE+++P+LVRD+AMYGT ++PKFA+D + TT+G WL+ TSE+ LT   
Sbjct: 181 FMIDTHVDHNGLTEINSPVLVRDDAMYGTDKLPKFAEDSYQTTNGWWLVSTSEIPLTYTV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + +I+++ +LP+R T     FRSEAGSAGRDT GMLRQHQF K E+VSIT  + S  E +
Sbjct: 241 AGDILDAAALPIRMTAHTLCFRSEAGSAGRDTAGMLRQHQFEKVEMVSITEPDQSEAEQQ 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML CAE+IL+RL L YR V LCTGD+GF A +T+D+E WL GQN YREISS ST G+FQ
Sbjct: 301 RMLRCAEDILERLGLPYRTVLLCTGDMGFGARRTFDIEAWLPGQNNYREISSVSTTGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RY+  +    +F HTLNGSG+AVGRCLIA+LEN   ADGSV +P VL  Y+   
Sbjct: 361 ARRMNARYKPADGGKPQFVHTLNGSGLAVGRCLIAVLENGQQADGSVVLPPVLASYLGGK 420

Query: 421 AVIKKEHIL 429
            V+  E  L
Sbjct: 421 TVLSAEGTL 429


>gi|110679777|ref|YP_682784.1| seryl-tRNA synthetase [Roseobacter denitrificans OCh 114]
 gi|123065549|sp|Q166J5|SYS_ROSDO RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|109455893|gb|ABG32098.1| seryl-tRNA synthetase [Roseobacter denitrificans OCh 114]
          Length = 430

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 210/429 (48%), Positives = 285/429 (66%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D AL +R   P S+ IL+LD   R  I   E+ +A +N  S ++GQ
Sbjct: 1   MHDIRAIRENPAAFDAALARRGEAPMSQAILALDTARRAKINAAENAQAEQNKASKEVGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+ +  + L+   S  K  +  ++ +   + + L + +S I N+P ++VP G   +
Sbjct: 61  AKAQGDEATFEKLRALVSEKKALVAEMQADAKALDAELTEKLSWIANIPADDVPDGADED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G  P      +EH+EIG     MDFD A K SGARF +L G +A + RAL Q
Sbjct: 121 DNVEVRRWGHLPDFEFTPKEHYEIGGVAASMDFDTAAKTSGARFVMLKGAVARIHRALSQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMID H   +G TE+++P+LVRD+AMYGT ++PKFA+D + TT+G WL+ TSE+ LT   
Sbjct: 181 FMIDTHVDHNGLTEINSPVLVRDDAMYGTDKLPKFAEDSYQTTNGWWLVSTSEIPLTYTV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + +I+++ +LP+R T     FRSEAGSAGRDT GMLRQHQF K E+VSIT  + S  E +
Sbjct: 241 AGDILDAAALPIRLTAHTLCFRSEAGSAGRDTAGMLRQHQFEKVEMVSITEPDQSEAEQQ 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML CAE+IL+RL L YR V LCTGD+GF A +T+D+E WL GQN YREISS ST G+FQ
Sbjct: 301 RMLRCAEDILERLGLPYRTVLLCTGDMGFGARRTFDIEAWLPGQNNYREISSVSTTGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RY+  +    +F HTLNGSG+AVGRCLIA+LEN   ADGSV +P VL  Y+   
Sbjct: 361 ARRMNARYKPADGGKPQFVHTLNGSGLAVGRCLIAVLENGQQADGSVVLPPVLAGYLGGK 420

Query: 421 AVIKKEHIL 429
            V+  E  L
Sbjct: 421 TVLSAEGTL 429


>gi|229816611|ref|ZP_04446909.1| hypothetical protein COLINT_03668 [Collinsella intestinalis DSM
           13280]
 gi|229807817|gb|EEP43621.1| hypothetical protein COLINT_03668 [Collinsella intestinalis DSM
           13280]
          Length = 430

 Score =  429 bits (1104), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 208/428 (48%), Positives = 291/428 (67%), Gaps = 5/428 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+++R+NPE LD A+  R      E   +LDE+ R +I ++ED++A RN+ S +IG 
Sbjct: 1   MLDIKFVRENPEALDAAMANRQGSWDRERFFALDEERRSVIAEVEDLQATRNAESKKIGV 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            + EG     +A K+    + E++ +L     E+ + +   ++ IPN+P +  P+G   N
Sbjct: 61  LMKEGKRDEAEAAKDAVRQVNEKIEVLGARRAELDAEVSDFMARIPNIPADVTPVGKDEN 120

Query: 121 ENILIRSVGKK---PSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
           EN   R VG+     +     + H+++G   G++DFDR  KLSGARF+VL+G  A L+RA
Sbjct: 121 ENPERRRVGEPRDFAAEGFEPKAHWDLGAETGILDFDRGAKLSGARFTVLSGAGATLDRA 180

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLT 237
           L  F ++ H S  G+TE   P++V  E MYGTGQ+PKF DD + T + ++LIPT+EV+LT
Sbjct: 181 LQNFFLNTHIS-RGFTEFIPPVIVNREIMYGTGQLPKFEDDAYHTGEDQFLIPTAEVALT 239

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           NL++ E++++  LPLR+T   P FR EAGSAGRDTRG++RQHQF K E+V   + E+S  
Sbjct: 240 NLHAGEVLDASQLPLRYTAGTPCFREEAGSAGRDTRGIIRQHQFTKVEMVKFAKPEESDD 299

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E E M++ AE IL++L L YRV+SLCTGDLGFSA +TYD+EVWL   N Y+EISSCS CG
Sbjct: 300 ELESMVAEAEFILQQLGLPYRVISLCTGDLGFSARQTYDIEVWLPSYNAYKEISSCSNCG 359

Query: 358 NFQSRRMNSRYRDP-NSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           +FQ+RR N +YRDP N K  +F HTLNGSG+  GR + AI+ENY NADGS+T+P VLRPY
Sbjct: 360 DFQARRANIKYRDPENFKGQRFVHTLNGSGLPTGRTMAAIMENYQNADGSITVPEVLRPY 419

Query: 417 MNNLAVIK 424
           M  +  I+
Sbjct: 420 MGGIERIE 427


>gi|258543173|ref|YP_003188606.1| seryl-tRNA synthetase [Acetobacter pasteurianus IFO 3283-01]
 gi|256634251|dbj|BAI00227.1| seryl-tRNA synthetase [Acetobacter pasteurianus IFO 3283-01]
 gi|256637311|dbj|BAI03280.1| seryl-tRNA synthetase [Acetobacter pasteurianus IFO 3283-03]
 gi|256640363|dbj|BAI06325.1| seryl-tRNA synthetase [Acetobacter pasteurianus IFO 3283-07]
 gi|256643420|dbj|BAI09375.1| seryl-tRNA synthetase [Acetobacter pasteurianus IFO 3283-22]
 gi|256646475|dbj|BAI12423.1| seryl-tRNA synthetase [Acetobacter pasteurianus IFO 3283-26]
 gi|256649528|dbj|BAI15469.1| seryl-tRNA synthetase [Acetobacter pasteurianus IFO 3283-32]
 gi|256652514|dbj|BAI18448.1| seryl-tRNA synthetase [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655572|dbj|BAI21499.1| seryl-tRNA synthetase [Acetobacter pasteurianus IFO 3283-12]
          Length = 422

 Score =  429 bits (1104), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 212/423 (50%), Positives = 282/423 (66%), Gaps = 2/423 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ +R +P   D  L +R +EP S  +L+ DE+ R     +++ + RR + + +IG 
Sbjct: 1   MHDIRALRADPAAFDADLARRGVEPVSAKLLAWDEERRQAQTVLQEKQGRRKALAREIGT 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G  S    L+ E   L+ ++  LE++ + +      L++ +PN     VP G   +
Sbjct: 61  LKRNGGDS--SDLEAEGLALRAEMEALEEQVNVLGRESTALLANLPNRLDATVPEGPDES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N++    G KP+     ++HFE+GE L  MDF  A KLSG+RF VL G +A L RALGQ
Sbjct: 119 ANVVQHEWGTKPTFTFTPKQHFELGETLKQMDFATAAKLSGSRFVVLRGGIARLARALGQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLH +EHGYTE   P++V D+AMYGT ++PKFAD  F T DGRWLIPT+EV LT   
Sbjct: 179 FMLDLHVTEHGYTETQVPVMVNDDAMYGTDKLPKFADQSFRTEDGRWLIPTAEVPLTASV 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           S +I+E+ +LPLR T L+  FRSEAG+AGRD RGMLRQHQF K E+VS+T  E+S  EHE
Sbjct: 239 SGDILEASALPLRMTALSQCFRSEAGAAGRDVRGMLRQHQFEKVEMVSVTTPEESDAEHE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE++L++L++ YR V LC GD GF A KT+DLE WL GQ+ +REISSCS   +FQ
Sbjct: 299 RMTRCAEKVLEKLNIPYRRVLLCAGDTGFGAAKTFDLEAWLPGQDAWREISSCSNTRDFQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR     +  F HTLNGSG+AVGR LIA++ENY N DGSVT+P VLRPYM  +
Sbjct: 359 ARRMNARYRPQAGAAPAFVHTLNGSGLAVGRTLIAVMENYQNEDGSVTVPDVLRPYMGGI 418

Query: 421 AVI 423
             I
Sbjct: 419 EKI 421


>gi|295688845|ref|YP_003592538.1| seryl-tRNA synthetase [Caulobacter segnis ATCC 21756]
 gi|295430748|gb|ADG09920.1| seryl-tRNA synthetase [Caulobacter segnis ATCC 21756]
          Length = 479

 Score =  429 bits (1104), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 218/475 (45%), Positives = 290/475 (61%), Gaps = 52/475 (10%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP+  D     +     +   + LD + R     +++ +A+RN +S  IG 
Sbjct: 1   MHDIKAIRDNPKAFDRQWSAKGRSGAAAEAVKLDAQLRAAQTALQEAQAKRNESSKLIGM 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+ + +    L  E  TLK  +    +EE  V   LK L++ +PN+P  EVP+G    
Sbjct: 61  AKAKKDEAEAQRLMAEVETLKGVMATASEEEALVGGKLKDLLASLPNIPAPEVPVGEDEA 120

Query: 121 ENILIRSVG---KKPSA-IHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLER 176
            N+  R  G   K P+  ++  ++H ++G ALG MDF+ A ++SGARF VL   +A LER
Sbjct: 121 GNVEQRRWGDAAKLPAGKLNKPKDHVDLGAALGGMDFEAAARMSGARFVVLKKEIARLER 180

Query: 177 ALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD------------ 224
           A+GQFM+DL T EHGYTE+S PLLVRDEA++GTGQ+PKF DD+F T +            
Sbjct: 181 AIGQFMLDLQTVEHGYTEISPPLLVRDEALFGTGQLPKFEDDLFFTGNVTEVERGVTEAL 240

Query: 225 ------------------------------------GRWLIPTSEVSLTNLYSHEIIESK 248
                                                RWLIPT+EVSLTN+   +++  +
Sbjct: 241 AYLDQHQPVAEGSSLASQIAEQNELRGIRELVLKHSRRWLIPTAEVSLTNIVREQLVAEE 300

Query: 249 SLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEE 308
            LP+R T L PSFR+EAGSAGRDTRGM+RQHQF+K ELVSIT  + S  EH+RM+ CAE 
Sbjct: 301 ELPMRLTALTPSFRAEAGSAGRDTRGMIRQHQFYKVELVSITTPDQSEAEHQRMVECAET 360

Query: 309 ILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRY 368
           +LK+L+L +R + LCTGD+GF A KTYDLEVWL  Q++YREISSCS CG FQ+RRM +RY
Sbjct: 361 VLKKLELPFRTMLLCTGDMGFGARKTYDLEVWLPSQDMYREISSCSNCGEFQARRMEARY 420

Query: 369 RDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVI 423
           R    K   F HTLNGSG+AVGR L+A+LENY +  G + IP VL+PYM  +  I
Sbjct: 421 RKTGEKGGHFVHTLNGSGLAVGRTLVAVLENYQDEGGRIHIPAVLQPYMGGITHI 475


>gi|213019481|ref|ZP_03335287.1| seryl-tRNA synthetase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|212994903|gb|EEB55545.1| seryl-tRNA synthetase [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 433

 Score =  429 bits (1104), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 222/435 (51%), Positives = 299/435 (68%), Gaps = 18/435 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHL-EPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQI- 58
           M DI+ IR+NP+  + A+K R + E  ++ IL +D K R L  K++ +  +RN  + +I 
Sbjct: 8   MHDIEHIRKNPKGFEKAIKSRGVKEFTAKEILEIDHKKRSLTTKLQALNKQRNEVTEEIK 67

Query: 59  ----GQAIAEGNLSLVDALKNETST--LKEQLPILEKEEHEVCSSLKKLISCIPNVPLEE 112
                ++  E  + L  ++ +E  T  LKEQ    EK      + L  ++S +PN+  + 
Sbjct: 68  RLKMNKSPCEEQVKLSKSITSEIETISLKEQT---EK------NKLVDILSNLPNISAQN 118

Query: 113 VPIGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLA 172
           VPIG   + N+ IR  GKK       + H+E+GE LGLMDF++A K+SG+RF++L G LA
Sbjct: 119 VPIGEDESSNVEIRKYGKKRKFDFTPKFHYELGERLGLMDFEQAAKISGSRFTILKGQLA 178

Query: 173 HLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTS 232
            L RAL  FM++ H +E  YTEV  P LV++EAMY  GQ+PKF+DD + TTD   LIPTS
Sbjct: 179 KLGRALINFMLETHVNEFAYTEVYHPALVKNEAMYNVGQLPKFSDDSYLTTDKLRLIPTS 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL + +IIE K LP+RFT  +  FR EAGSAGRDTRGM+RQHQF K ELVSIT E
Sbjct: 239 EVVLTNLVADKIIEEKELPIRFTAYSECFRKEAGSAGRDTRGMIRQHQFGKVELVSITTE 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           + S  E ERM + AEEILK+L+L YR++ LC+GD+GF+A KTYD+EVWL  QN YREISS
Sbjct: 299 DQSKDELERMTNAAEEILKKLELPYRIMLLCSGDMGFAAQKTYDIEVWLPEQNKYREISS 358

Query: 353 CSTCGNFQSRRMNSRY-RDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPT 411
           CS CG FQ+RRMN++Y  + + K+ K+ HTLNGS +A+GR ++AI+ENY N+DGSVTIP 
Sbjct: 359 CSNCGTFQARRMNTKYFLETDRKTKKYVHTLNGSALAIGRTIVAIMENYQNSDGSVTIPN 418

Query: 412 VLRPYMNNLAVIKKE 426
           VL+ YM+N  VI K+
Sbjct: 419 VLQRYMSNDTVISKQ 433


>gi|190570965|ref|YP_001975323.1| seryl-tRNA synthetase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|238065111|sp|B3CQ06|SYS_WOLPP RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|190357237|emb|CAQ54659.1| seryl-tRNA synthetase [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
          Length = 426

 Score =  429 bits (1103), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 222/435 (51%), Positives = 299/435 (68%), Gaps = 18/435 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHL-EPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQI- 58
           M DI+ IR+NP+  + A+K R + E  ++ IL +D K R L  K++ +  +RN  + +I 
Sbjct: 1   MHDIEHIRKNPKGFEKAIKSRGVKEFTAKEILEIDHKKRSLTTKLQALNKQRNEVTEEIK 60

Query: 59  ----GQAIAEGNLSLVDALKNETST--LKEQLPILEKEEHEVCSSLKKLISCIPNVPLEE 112
                ++  E  + L  ++ +E  T  LKEQ    EK      + L  ++S +PN+  + 
Sbjct: 61  RLKMNKSPCEEQVKLSKSITSEIETISLKEQT---EK------NKLVDILSNLPNISAQN 111

Query: 113 VPIGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLA 172
           VPIG   + N+ IR  GKK       + H+E+GE LGLMDF++A K+SG+RF++L G LA
Sbjct: 112 VPIGEDESSNVEIRKYGKKRKFDFTPKFHYELGERLGLMDFEQAAKISGSRFTILKGQLA 171

Query: 173 HLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTS 232
            L RAL  FM++ H +E  YTEV  P LV++EAMY  GQ+PKF+DD + TTD   LIPTS
Sbjct: 172 KLGRALINFMLETHVNEFAYTEVYHPALVKNEAMYNVGQLPKFSDDSYLTTDKLRLIPTS 231

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL + +IIE K LP+RFT  +  FR EAGSAGRDTRGM+RQHQF K ELVSIT E
Sbjct: 232 EVVLTNLVADKIIEEKELPIRFTAYSECFRKEAGSAGRDTRGMIRQHQFGKVELVSITTE 291

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           + S  E ERM + AEEILK+L+L YR++ LC+GD+GF+A KTYD+EVWL  QN YREISS
Sbjct: 292 DQSKDELERMTNAAEEILKKLELPYRIMLLCSGDMGFAAQKTYDIEVWLPEQNKYREISS 351

Query: 353 CSTCGNFQSRRMNSRY-RDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPT 411
           CS CG FQ+RRMN++Y  + + K+ K+ HTLNGS +A+GR ++AI+ENY N+DGSVTIP 
Sbjct: 352 CSNCGTFQARRMNTKYFLETDRKTKKYVHTLNGSALAIGRTIVAIMENYQNSDGSVTIPN 411

Query: 412 VLRPYMNNLAVIKKE 426
           VL+ YM+N  VI K+
Sbjct: 412 VLQRYMSNDTVISKQ 426


>gi|83954200|ref|ZP_00962920.1| seryl-tRNA synthetase [Sulfitobacter sp. NAS-14.1]
 gi|83841237|gb|EAP80407.1| seryl-tRNA synthetase [Sulfitobacter sp. NAS-14.1]
          Length = 430

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 207/419 (49%), Positives = 278/419 (66%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP+  D AL +R   P S  +L+LDE  R  I   E  +A +N  S  +G 
Sbjct: 1   MHDIKAIRENPDAFDAALARRGDTPVSAQVLALDEARRAKISAAETAQAEQNKASKLVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+ +  + L+   S  K ++  ++ E  ++ + L  +++ IPN+P ++ P G    
Sbjct: 61  AKAKGDEAEFERLRTLVSDKKAEVTAMQAEAKDLDAQLTDMLARIPNLPADDAPDGADEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G  P+    ++EHFEI      MDF+ A K SGARF +L G +A + RAL Q
Sbjct: 121 DNVEVNRWGDVPAFDFKAKEHFEIASVAASMDFETAAKTSGARFVMLKGAVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMID H  E+G TE   P+LVRDEAMYGT ++PKF DD + TT+G WLIPTSEV+LT   
Sbjct: 181 FMIDTHVDENGLTEHMTPVLVRDEAMYGTDKLPKFGDDSYQTTNGWWLIPTSEVTLTYSV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + +++E  +LP R T     FRSEAGSAGRDT GMLRQHQF K E+VS+T  + S  E +
Sbjct: 241 AGDVLEEAALPRRMTAHTLCFRSEAGSAGRDTSGMLRQHQFEKVEMVSVTHPDQSDDEQK 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML CAE++L+RL + YR V LCTGD+GF A +T+D+E WL GQN YREISS ST G+FQ
Sbjct: 301 RMLRCAEDMLERLGVPYRTVILCTGDMGFGARRTFDIEAWLPGQNAYREISSVSTTGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           +RRMN+R++  N    +F HTLNGSG+AVGRCLIA+LEN   ADGSV +P VL PY+  
Sbjct: 361 ARRMNARFKPANGGKPQFVHTLNGSGLAVGRCLIAVLENGQQADGSVRLPDVLAPYLGG 419


>gi|329114108|ref|ZP_08242872.1| Seryl-tRNA synthetase [Acetobacter pomorum DM001]
 gi|326696647|gb|EGE48324.1| Seryl-tRNA synthetase [Acetobacter pomorum DM001]
          Length = 422

 Score =  428 bits (1101), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 211/423 (49%), Positives = 281/423 (66%), Gaps = 2/423 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ +R +P   D  L +R +EP S  +L+ DE+ R     +++ + RR + + +IG 
Sbjct: 1   MHDIRALRADPAAFDADLARRGIEPVSARLLAWDEERRQAQTVLQEKQGRRKALAREIGT 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G  S    L+ E   L+ ++  LE++ + +      L++ +PN     VP G   +
Sbjct: 61  LKRSGGDS--SDLEAEGLALRAEMEALEEQVNTLGRESTALLANLPNRLDATVPEGPDES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N++    G KP+     ++HFE+GE L  MDF  A KLSG+RF VL G +A L RALGQ
Sbjct: 119 ANVVQHEWGTKPAFTFTPKQHFELGETLKQMDFATAAKLSGSRFVVLRGGIARLARALGQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLH +EHGYTE   P++V D+AMYGT ++PKFAD  F T DGRWLIPT+EV LT   
Sbjct: 179 FMLDLHVTEHGYTETQVPVMVNDDAMYGTDKLPKFADQSFRTEDGRWLIPTAEVPLTASV 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           S +I+E  +LPLR T L+  FRSEAG+AGRD RGMLRQHQF K E+VS+T  E+S  EHE
Sbjct: 239 SGDILEGAALPLRMTALSQCFRSEAGAAGRDVRGMLRQHQFEKVEMVSVTTPEESDAEHE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE++L++L++ YR + LC GD GF A KT+DLE WL GQ+ +REISSCS   +FQ
Sbjct: 299 RMTRCAEKVLEKLNIPYRRMLLCAGDTGFGAAKTFDLEAWLPGQDAWREISSCSNTRDFQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR     +  F HTLNGSG+AVGR LIA++ENY N DGSVT+P VLRPYM  +
Sbjct: 359 ARRMNARYRPQAGAAPAFVHTLNGSGLAVGRTLIAVMENYQNEDGSVTVPDVLRPYMGGI 418

Query: 421 AVI 423
             I
Sbjct: 419 EKI 421


>gi|221638196|ref|YP_002524458.1| seryl-tRNA synthetase [Rhodobacter sphaeroides KD131]
 gi|221158977|gb|ACL99956.1| Seryl-tRNA synthetase [Rhodobacter sphaeroides KD131]
          Length = 430

 Score =  428 bits (1100), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 214/430 (49%), Positives = 279/430 (64%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+ P+  D AL +R L   S  IL++DE  R  I   +  +A +N  S ++G 
Sbjct: 1   MHDIRIIREFPDRFDTALSRRGLSALSGEILAIDEARRSKILAADTAQAEQNRASKEVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  + L+   +  K ++  L +E     + L+ ++  IPN+PL+EVP G   +
Sbjct: 61  AKARGDEAEFERLRALLAEKKAEVARLNEEAAAEDARLRDMLVAIPNLPLDEVPEGPDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ IR  G         +EHFEI      MDF  A K+SG+RF +L G +  + RAL Q
Sbjct: 121 ANVEIRRWGTPRGFNFAPKEHFEIAGVKPGMDFATAAKISGSRFVMLKGAVIRVHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H +EHG TE   P+LV+DEAM+GTGQ+PKF++D + TT+G WLIPTSEV+LTN  
Sbjct: 181 FMLDTHVTEHGLTETWTPVLVKDEAMFGTGQLPKFSEDSYQTTNGWWLIPTSEVTLTNSV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++   LP+R T     FRSEAGSAG+DT GMLRQHQF K E+VSIT  E S  EHE
Sbjct: 241 AGEILDEAQLPIRMTAHTQCFRSEAGSAGKDTSGMLRQHQFEKVEMVSITTPETSLAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE IL++L L YR + LCTGD+GF A KT+DLEVWL GQN YREISS S CG+FQ
Sbjct: 301 RMTGCAEAILQKLGLPYRTIVLCTGDMGFGATKTHDLEVWLPGQNTYREISSVSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R+R       +F HTLNGSG+AVGRCLIA+LEN    DGSV +P  L PY+   
Sbjct: 361 ARRMNARFRPAGGGKPEFVHTLNGSGLAVGRCLIAVLENGQQEDGSVELPEALHPYLGGK 420

Query: 421 AVIKKEHILE 430
             I  +  LE
Sbjct: 421 TRISADGTLE 430


>gi|296114988|ref|ZP_06833632.1| seryl-tRNA synthetase [Gluconacetobacter hansenii ATCC 23769]
 gi|295978450|gb|EFG85184.1| seryl-tRNA synthetase [Gluconacetobacter hansenii ATCC 23769]
          Length = 425

 Score =  427 bits (1099), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 211/424 (49%), Positives = 286/424 (67%), Gaps = 3/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M D++ +R +P+  D  L +R   P +  +L LD   R     +++ +A+R + S ++G 
Sbjct: 1   MHDLRALRADPDAFDADLTRRGEAPVAHVLLELDRDRRAAETALQECQAQRKTLSKEVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G  S   A++ +++ L++++  L  +  ++ + L+  + C+PN     VP G   +
Sbjct: 61  LRRTGADS--SAVEAKSAALRDRMEELSTQVADLDTKLRGTLECLPNRLDAGVPDGRDES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N++    G        ++EHFE+GEALGLMDF+ A++LSGARF VL G LA +ERALGQ
Sbjct: 119 ANVVCHIWGTVREMGFPAKEHFELGEALGLMDFETASRLSGARFVVLRGALARMERALGQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT E+GY E + P+LV DEAMYGT ++PKFAD  F TTDGRWL+PT+EV LT   
Sbjct: 179 FMLDLHTRENGYDETAVPVLVNDEAMYGTDKLPKFADQSFRTTDGRWLVPTAEVPLTASV 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI+ + +LP R   L+  FRSEAG+AGRDTRGMLRQHQF K E+VSIT  EDS  EHE
Sbjct: 239 AGEILSADTLPRRMVALSSCFRSEAGAAGRDTRGMLRQHQFQKVEMVSITAPEDSEAEHE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE +L+RL + YR + LC GD GF A +T+DLE WL GQ  +REISSCST  +FQ
Sbjct: 299 RMTRCAEMVLERLGVPYRRMLLCAGDTGFGAARTFDLEAWLPGQKAWREISSCSTTRDFQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR  + K   F HTLNGSG+AVGR LIA++EN  N DGS+T+P VLRPYM   
Sbjct: 359 ARRMNARYRAADGKP-AFVHTLNGSGLAVGRTLIAVMENGQNEDGSITVPEVLRPYMGGT 417

Query: 421 AVIK 424
            +I+
Sbjct: 418 DIIR 421


>gi|73667073|ref|YP_303089.1| seryl-tRNA synthetase [Ehrlichia canis str. Jake]
 gi|123745850|sp|Q3YS14|SYS_EHRCJ RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|72394214|gb|AAZ68491.1| seryl-tRNA synthetase [Ehrlichia canis str. Jake]
          Length = 423

 Score =  427 bits (1098), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 215/428 (50%), Positives = 292/428 (68%), Gaps = 9/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M D+ +I++NPE  D A++ R+ E  ++ I+ LD K + L+ ++  ++  RN  + +I +
Sbjct: 1   MHDVDFIKRNPELFDYAMQNRNYEKVAQKIIELDIKKKQLLTQLYSLQKERNQITREIEK 60

Query: 61  AIAEGNL--SLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTS 118
              +G    + +++ KN T  + +   +++++     S L  L++ +PNVP + VP+G  
Sbjct: 61  LKKDGVKCDTQIESSKNITEKINDINNMIKED-----SQLIDLLNVLPNVPDDIVPVGKD 115

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
            + N+ IR  G K +     + H+E+GE L LMDF +A KLSG+RF +L   LA L+RAL
Sbjct: 116 ESSNVEIRKHGYKRNFDFQVKTHYELGEKLNLMDFKQAAKLSGSRFVILKNQLAQLDRAL 175

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTN 238
             FM+D+HT E GY+E+S P+LV + AMYG GQ+PKFADD F TT+   L+PTSEV+LTN
Sbjct: 176 ANFMLDIHTKEFGYSEISHPILVHESAMYGVGQLPKFADDSFKTTENFRLVPTSEVALTN 235

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L S   I S  LP+R T  +P FR EAGSAG+DTRGM+RQHQF K ELVSI  EE S +E
Sbjct: 236 LVSGMNINSCDLPIRLTACSPCFRLEAGSAGKDTRGMMRQHQFNKVELVSIVTEEQSASE 295

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            ERM+  AEE+LKRL+L YRV+ LCTGD+GFSA  TYD+EVW+  QN YREISSCS C +
Sbjct: 296 LERMVQVAEEVLKRLELPYRVMMLCTGDMGFSASITYDIEVWVPSQNRYREISSCSNCKD 355

Query: 359 FQSRRMNSRYR--DPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           FQ+RRMN++Y     N K  KF HTLNGS +A+GR +IAILENY N DGS+TIP  LR Y
Sbjct: 356 FQARRMNTKYTTITNNVKVSKFAHTLNGSALAIGRTIIAILENYQNMDGSITIPLALRKY 415

Query: 417 MNNLAVIK 424
           MN+   IK
Sbjct: 416 MNDQEFIK 423


>gi|294083982|ref|YP_003550739.1| Serine--tRNA ligase [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292663554|gb|ADE38655.1| Serine--tRNA ligase [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 428

 Score =  427 bits (1098), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 216/429 (50%), Positives = 285/429 (66%), Gaps = 7/429 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI++IR++P+  D A+K+R ++  +  IL +D   R L  +++D+++RRN  S +IG+
Sbjct: 1   MHDIRFIREHPDQFDAAMKRRKVDMSASSILEIDSARRALQSELQDMQSRRNIASKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
             A G  +  DAL  E + +K  LP +E  E ++   L  ++  IPN+    VP G   +
Sbjct: 61  LKANGGDA--DALIAEVNDIKTALPDIETREADLAHKLDSVLMEIPNILDVSVPDGDDEH 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N LI S G  PS      +H  +GE LG MDF    KL+GARF VL G LA LERAL  
Sbjct: 119 DNELIHSYGDIPSFSFTPIDHVALGEGLGQMDFALGAKLAGARFVVLQGQLARLERALAA 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
            M+D HTSE GY E   P LV  + M GTGQ+PKFA+D++  TD +WLIPT+EV LTN+ 
Sbjct: 179 LMLDTHTSEFGYIETVPPSLVNSQTMTGTGQLPKFAEDLY-KTDDKWLIPTAEVPLTNIV 237

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + +I+    LP+R T     FRSEAGSAGRDTRGM+RQHQF K E+VSI+  +DS  E E
Sbjct: 238 AGDILTPDILPIRMTAYTNCFRSEAGSAGRDTRGMIRQHQFSKVEMVSISHPDDSAAELE 297

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQN----LYREISSCSTC 356
           RM  CAE IL++L+L YRV+ LC+GD GFSA +TYDLEVWL GQ+    +YREISSCS C
Sbjct: 298 RMTGCAEAILQKLELPYRVLKLCSGDTGFSAEQTYDLEVWLPGQDEGRGMYREISSCSNC 357

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G FQ+RRM +RYRD ++   +F HTLNGSG+AVGR +IAILEN    DG+V +P  L PY
Sbjct: 358 GPFQARRMKARYRDKDTGETQFLHTLNGSGLAVGRTMIAILENGQQEDGTVCLPAALHPY 417

Query: 417 MNNLAVIKK 425
           M    +IK+
Sbjct: 418 MGTDRLIKQ 426


>gi|83943025|ref|ZP_00955485.1| seryl-tRNA synthetase [Sulfitobacter sp. EE-36]
 gi|83846033|gb|EAP83910.1| seryl-tRNA synthetase [Sulfitobacter sp. EE-36]
          Length = 430

 Score =  427 bits (1097), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 206/419 (49%), Positives = 278/419 (66%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP+  D AL +R   P S  +L+LDE  R  I   E  +A +N  S  +G 
Sbjct: 1   MHDIKAIRENPDAFDAALARRGDTPVSAQVLALDEARRAKISAAETAQAEQNKASKLVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+ +  + L+   S  K ++  ++ E  ++ + L  +++ IPN+P ++ P G    
Sbjct: 61  AKAKGDEAEFERLRTLVSDKKAEVTAMQAEAKDLDAQLTDMLARIPNLPADDAPDGADEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G  P+    ++EHFEI      MDF+ A K SGARF +L G +A + RAL Q
Sbjct: 121 DNVEVNRWGDVPTFDFKAKEHFEIASVAASMDFETAAKTSGARFVMLKGAVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMID H  E+G TE   P+LVRDEAMYGT ++PKF DD + TT+G WLIPTSEV+LT   
Sbjct: 181 FMIDTHVDENGLTEHMTPVLVRDEAMYGTDKLPKFGDDSYQTTNGWWLIPTSEVTLTYSV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + +++E  +LP R T     FRSEAGSAGRDT GMLRQHQF K E+VS+T  + S  E +
Sbjct: 241 AGDVLEEAALPRRMTAHTLCFRSEAGSAGRDTSGMLRQHQFEKVEMVSVTHPDQSDDEQK 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML CAE++L+RL + YR V LCTGD+GF A +T+D+E WL GQN YREISS ST G+FQ
Sbjct: 301 RMLRCAEDMLERLGVPYRTVILCTGDMGFGARRTFDIEAWLPGQNAYREISSVSTTGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           +RRMN+R++  +    +F HTLNGSG+AVGRCLIA+LEN   ADGSV +P VL PY+  
Sbjct: 361 ARRMNARFKPADGGKPQFVHTLNGSGLAVGRCLIAVLENGQQADGSVKLPDVLAPYLGG 419


>gi|114800440|ref|YP_760631.1| seryl-tRNA synthetase [Hyphomonas neptunium ATCC 15444]
 gi|123027986|sp|Q0C0W2|SYS_HYPNA RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|114740614|gb|ABI78739.1| seryl-tRNA synthetase [Hyphomonas neptunium ATCC 15444]
          Length = 432

 Score =  427 bits (1097), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 224/435 (51%), Positives = 288/435 (66%), Gaps = 16/435 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRH--LEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQI 58
           M DI+ IR NP+    A  +R   L    + IL LD + R      +D  + RN+NS  I
Sbjct: 1   MFDIRAIRDNPDAFRNAWNRRKSGLGSVVDDILKLDAQWREATTAKQDAESARNANSKLI 60

Query: 59  GQAIA---EGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           GQA A   E   + + AL  E  T  EQ     + E     +L  L+  +PN+PL+EVP 
Sbjct: 61  GQAKAKKDEAEAARLMALVAEAKTTMEQAG---EAEDNARKALDDLLMGLPNLPLDEVPE 117

Query: 116 GTSANENILIRSVGKKPSAIHLSREHFEIGEALG------LMDFDRATKLSGARFSVLTG 169
           G+  + N+   + G+ P  I+  ++H ++GEAL       +MDF+ A ++SGARF  L G
Sbjct: 118 GSDEHGNVEQHTWGE-PKLINDPKDHADLGEALKGQGGFPMMDFEAAARMSGARFVALRG 176

Query: 170 HLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLI 229
            L  LERAL  FM+DL T+EHGY E+S P+LVRD+A+YGTGQ+PKFA+D+F TT   WL 
Sbjct: 177 KLTRLERALANFMLDLQTTEHGYEEMSVPVLVRDQALYGTGQLPKFAEDLFRTTVDHWLT 236

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EVSLTNL   +I+++  LPLRFT   P FRSEAGSAGRDT+GM+RQHQF K ELVSI
Sbjct: 237 PTAEVSLTNLVREQILDAAQLPLRFTAHTPCFRSEAGSAGRDTKGMIRQHQFNKVELVSI 296

Query: 290 -TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYR 348
              E +   E ERM  CAEE+LKRL+L +R + LCTGD+G  A KTYDLEVWL  QN YR
Sbjct: 297 VANEAEGLAELERMTGCAEEVLKRLELPFRRMLLCTGDMGAGARKTYDLEVWLPSQNTYR 356

Query: 349 EISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVT 408
           EISSCS CG+FQ+RRM++RYR       ++ HTLNGSG+AVGR L+A+LENY NADGS+T
Sbjct: 357 EISSCSYCGDFQARRMDARYRPEPKAKPEYVHTLNGSGLAVGRTLVAVLENYQNADGSIT 416

Query: 409 IPTVLRPYMNNLAVI 423
           +P  L PYM  + VI
Sbjct: 417 VPKALVPYMGGVEVI 431


>gi|167647077|ref|YP_001684740.1| seryl-tRNA synthetase [Caulobacter sp. K31]
 gi|189083561|sp|B0T1Q3|SYS_CAUSK RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|167349507|gb|ABZ72242.1| seryl-tRNA synthetase [Caulobacter sp. K31]
          Length = 474

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 217/473 (45%), Positives = 290/473 (61%), Gaps = 47/473 (9%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR N +  + A   +     +   + LD   R     +++ +A+RN +S  IG 
Sbjct: 1   MHDIKAIRDNQQAFEAAWSAKGRSGAAAEAVKLDALLRAAQTALQEAQAKRNESSKLIGM 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+ + +    L  E   LK  +    + E EV   L+ L++ +PN+P  EVP G    
Sbjct: 61  AKAKKDEAEATRLMAEVEHLKAVMASAAQTETEVGGQLRDLLASLPNIPAPEVPAGEDEA 120

Query: 121 ENILIRSVG---KKPSA-IHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLER 176
            N+ IR  G   K P+  ++  ++H ++G ALG MDF+ A ++SGARF VL G +A LER
Sbjct: 121 GNVEIRRWGDASKLPAGRLNNPKDHVDLGAALGGMDFEAAARMSGARFVVLKGQIARLER 180

Query: 177 ALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD------------ 224
           ALGQFM+DL T +HGYTEVS PLLV+DEA++GTGQ+PKF  D+F T++            
Sbjct: 181 ALGQFMLDLQTVQHGYTEVSPPLLVKDEALFGTGQLPKFKADLFKTSEQNWVERLDEQIA 240

Query: 225 -------------------------------GRWLIPTSEVSLTNLYSHEIIESKSLPLR 253
                                           RWLIPT+EVSLTN+   +I +   LPLR
Sbjct: 241 LRVPPLLNITQTDVVENLKGLRAAASMDEQAARWLIPTAEVSLTNIVREQITDEAELPLR 300

Query: 254 FTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRL 313
            T L PSFRSEAG++GRDTRGM+RQHQF+K ELVSIT  + S  EHERM+ CAE +LK L
Sbjct: 301 MTALTPSFRSEAGASGRDTRGMIRQHQFYKVELVSITTPDQSDEEHERMVGCAEAVLKAL 360

Query: 314 DLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNS 373
           +L +R + LCTGD+GF A KTYDLEVWL  QN YREISSCS CG+FQ+RRM++R++    
Sbjct: 361 ELPFRTMLLCTGDMGFGAKKTYDLEVWLPSQNTYREISSCSNCGDFQARRMDARFKKVGE 420

Query: 374 KSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVIKKE 426
           K  ++ HTLNGSG+AVGR L+A+LENY +  G +T+P VL PYM  +  I  E
Sbjct: 421 KGARYVHTLNGSGLAVGRTLVAVLENYQDETGRITVPAVLVPYMGGVTHIGGE 473


>gi|56697184|ref|YP_167548.1| seryl-tRNA synthetase [Ruegeria pomeroyi DSS-3]
 gi|67461635|sp|Q5LR07|SYS_SILPO RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|56678921|gb|AAV95587.1| seryl-tRNA synthetase [Ruegeria pomeroyi DSS-3]
          Length = 430

 Score =  425 bits (1092), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 208/429 (48%), Positives = 282/429 (65%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D AL +R   P S  IL+LDE  R  I   E  +A +N  S ++G 
Sbjct: 1   MHDIRAIRENPAAFDAALSRRGSAPVSSDILALDEARRGKILAAETAQADQNKASKEVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  + L+   +  K ++  ++ E  E+ + L +L++ +PN+P E+VP G    
Sbjct: 61  AKARGDEAEFERLRALVAEKKAEIAAMQAEAKELDTQLSELLAGLPNLPAEDVPQGADEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         +EHF++      MDF+ A KLSGARF +L+G +A + RAL Q
Sbjct: 121 DNVELHRWGTPREMDFAPKEHFDLASVQDGMDFETAAKLSGARFVLLSGAVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H+ ++G TEV+ P+LV  E MYGTGQ+PKF +D + T +G WLIPTSEVSLTN+ 
Sbjct: 181 FMLDTHSEQNGLTEVNGPVLVLSEMMYGTGQLPKFGEDSYQTREGWWLIPTSEVSLTNIV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           +   I    LP R+T  +  FRSEAGSAG+DTRGMLRQHQF K E+VS+T  + S  E +
Sbjct: 241 NGSTIAEDYLPRRYTAHSLCFRSEAGSAGKDTRGMLRQHQFEKVEMVSVTHPDHSDAEQK 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML CAE IL+ L + YR + LCTGD+GF A +TYD+E WL GQN YREISS STCG+FQ
Sbjct: 301 RMLRCAEGILEALGIPYRTIVLCTGDMGFGARRTYDIEAWLPGQNTYREISSVSTCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++  +    +F HTLNGSG+AVGRCLIA+LEN  NADGSVT+P  L PY+   
Sbjct: 361 ARRMNARFKPADGGKPQFVHTLNGSGLAVGRCLIAVLENGQNADGSVTLPQALAPYLGGK 420

Query: 421 AVIKKEHIL 429
             +  +  L
Sbjct: 421 LTLNTDGTL 429


>gi|163746865|ref|ZP_02154222.1| seryl-tRNA synthetase [Oceanibulbus indolifex HEL-45]
 gi|161379979|gb|EDQ04391.1| seryl-tRNA synthetase [Oceanibulbus indolifex HEL-45]
          Length = 430

 Score =  425 bits (1092), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 210/429 (48%), Positives = 280/429 (65%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NPE  D AL +R     SE +LSLD   R  I   E  +A +N  S ++G 
Sbjct: 1   MHDIRAIRDNPEAFDAALARRGEAAMSEAVLSLDAARRAKIAAAETAKAEQNKASKEVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+ +  + L+   S  K ++  +  E  E+ + L  +++ +PN P ++VP G    
Sbjct: 61  AKAKGDEAEFERLRALVSDKKAEVAAMNTEAQELDAQLTDMLARVPNSPADDVPQGADEG 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ ++  G KPS      EH+EI      MDF+ A+K SGARF +L G +A + RAL Q
Sbjct: 121 DNVEVKVWGDKPSFDFTPVEHYEIESVKPGMDFETASKTSGARFVMLKGGVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMID H  E+G TEV+ P+LVRDEAMYGT ++PKF +D + TT+G WL+PTSEV LT   
Sbjct: 181 FMIDTHVDENGLTEVNTPVLVRDEAMYGTDKLPKFGEDSYQTTNGWWLVPTSEVPLTYSV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             + +E  +LP+R T     FRSEAGSAGRDT GMLRQHQF K E+VSIT  ++S  E +
Sbjct: 241 GGDTLEQSALPIRLTAHTLCFRSEAGSAGRDTAGMLRQHQFEKVEMVSITHPDESDAEQQ 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM+ CAE IL++L + YR V LCTGD+GF A +TYD+E W+ GQN YREISS ST G+FQ
Sbjct: 301 RMVGCAEGILEKLGVPYRTVILCTGDMGFGARRTYDIEAWVPGQNCYREISSVSTTGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++       +F HTLNGSG+AVGRCLIA+LEN   ADGSV +P VL PY+   
Sbjct: 361 ARRMNARFKPEGGGKPQFVHTLNGSGLAVGRCLIAVLENGQQADGSVRLPEVLAPYLGGK 420

Query: 421 AVIKKEHIL 429
             +  E +L
Sbjct: 421 TTLTAEGVL 429


>gi|210631790|ref|ZP_03297032.1| hypothetical protein COLSTE_00919 [Collinsella stercoris DSM 13279]
 gi|210159910|gb|EEA90881.1| hypothetical protein COLSTE_00919 [Collinsella stercoris DSM 13279]
          Length = 430

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 209/428 (48%), Positives = 289/428 (67%), Gaps = 5/428 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+++R+NPE LD A+  R      E   +LDE+ R +I ++E+++A RN+ S +IG 
Sbjct: 1   MLDIKFVRENPEALDAAMASRQGSWDRERFFALDEERRSVITQVEELQATRNTESKKIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            + EG     +A K     + EQ+  L +   E+ + +   ++ IPN+P E  P+G   N
Sbjct: 61  LMKEGKREEAEAAKEAVRQVNEQIEGLAERRSELDAEVAGFMARIPNIPCEATPVGKDEN 120

Query: 121 ENILIRSVGKK---PSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
           EN   R VG+     +     + H+++G   G++DFDR  KLSGARF+VL+G  A L+RA
Sbjct: 121 ENPERRRVGEPRDFAAEGFEPKAHWDLGTETGILDFDRGAKLSGARFTVLSGAGATLDRA 180

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLT 237
           L  F ++ H S  G+ E   P++V  E MYGTGQ+PKF DD + T + ++LIPT+EV+LT
Sbjct: 181 LQNFFLNTHIS-RGFKEFIPPVIVNREIMYGTGQLPKFEDDAYHTGEDQFLIPTAEVALT 239

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           NL++ E++++  LPLR+T   P FR EAGSAGRDTRG++RQHQF K E+V   R E+S  
Sbjct: 240 NLHAGEVLDAAQLPLRYTAGTPCFREEAGSAGRDTRGIIRQHQFTKVEMVKFARPEESDA 299

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E E M++ AE IL++L L YRV+SLCTGDLGFSA +TYD+EVWL   N Y+EISSCS CG
Sbjct: 300 ELESMVAEAEFILQQLGLPYRVISLCTGDLGFSARQTYDIEVWLPSYNAYKEISSCSNCG 359

Query: 358 NFQSRRMNSRYRDP-NSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           +FQ+RR N +YRDP N K  +F HTLNGSG+  GR + AI+ENY NADGS+T+P VLRPY
Sbjct: 360 DFQARRANIKYRDPENFKGTRFVHTLNGSGLPTGRTMAAIMENYQNADGSITVPEVLRPY 419

Query: 417 MNNLAVIK 424
           M  +  I+
Sbjct: 420 MGGIEKIE 427


>gi|58617193|ref|YP_196392.1| seryl-tRNA synthetase [Ehrlichia ruminantium str. Gardel]
 gi|81311339|sp|Q5FGY8|SYS_EHRRG RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|58416805|emb|CAI27918.1| Seryl-tRNA synthetase [Ehrlichia ruminantium str. Gardel]
          Length = 425

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 217/431 (50%), Positives = 288/431 (66%), Gaps = 11/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI +I+ NPE  D A++ R+    +  I+ L    +  + ++  ++  RN+ + +I +
Sbjct: 1   MHDIDFIKNNPELFDEAMQNRNFGKIAHKIIELSANKKHTLTQLYSLQKERNNITQEI-E 59

Query: 61  AIAEGNL---SLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGT 117
            + + N+   + ++  K  T  +     +++ +     S L  L++ +PN+P ++VPIG 
Sbjct: 60  KLKKDNIQCDTQIELSKEITKKINHINNMIKTD-----SELIDLLNILPNIPDKKVPIGK 114

Query: 118 SANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
             N+NI IR  GKK       + H+E+GE L LMDF +A KLSG+RF +L   LA L+RA
Sbjct: 115 DENDNIEIRRYGKKVDFKFPPKTHYELGENLNLMDFKQAAKLSGSRFVILKSQLAQLDRA 174

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLT 237
           L  FM+D+HT E GY+E+S P+LV + AMYG GQ+PKFADD F TTD   LIPTSEV+LT
Sbjct: 175 LANFMLDVHTQEFGYSEISHPVLVHESAMYGVGQLPKFADDSFKTTDNFRLIPTSEVALT 234

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           NL S+  I +  LP+R T  +  FRSEAGSAG+D RGM+RQHQF K ELVSI  EE S  
Sbjct: 235 NLVSNANINANELPIRLTACSQCFRSEAGSAGKDVRGMMRQHQFNKVELVSIVTEEQSEL 294

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E ERM   AEEILK+L+L YRV+ LCTGDLGFSA  TYD+EVW+  QN YREISSCS C 
Sbjct: 295 ELERMTQVAEEILKKLELPYRVMMLCTGDLGFSASITYDIEVWIPSQNQYREISSCSNCK 354

Query: 358 NFQSRRMNSRYR--DPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
            FQ+RRMN++Y      +K  KF HTLNGS +A+GR +IAILENY N DGS+TIP VLR 
Sbjct: 355 AFQARRMNAKYHTISNGNKVNKFVHTLNGSALAIGRTIIAILENYQNQDGSITIPHVLRK 414

Query: 416 YMNNLAVIKKE 426
           YMNN  +IKK+
Sbjct: 415 YMNNQDIIKKQ 425


>gi|149913919|ref|ZP_01902451.1| seryl-tRNA synthetase [Roseobacter sp. AzwK-3b]
 gi|149812203|gb|EDM72034.1| seryl-tRNA synthetase [Roseobacter sp. AzwK-3b]
          Length = 430

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 209/429 (48%), Positives = 278/429 (64%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D A+ +R LE  S+ IL+LDE  R  I   E  +A +NS S  +G 
Sbjct: 1   MHDIRAIRENPAAFDAAMARRGLEQASDEILALDEARRACIHAAETAQAEQNSASKDVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  D L+   S  K ++  ++ E  ++   L  L+  +PN+PL+E+P G    
Sbjct: 61  AKARGDEAEFDRLRALVSDKKSEVARMQAEAKDLDQRLTDLLMGLPNLPLDEIPDGQDEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I   G   S     +EHFEI   +  MDF+   KLSGARF V+ G +A + RAL Q
Sbjct: 121 DNVEIHRWGTPASFDFPPKEHFEIPGVIPGMDFEAGAKLSGARFVVMQGAVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H  E+G  E   P+LVR++ MYGTG +PKF +D + TT+G WL+PT+EV+LTNL 
Sbjct: 181 FMLDTHIEENGLLETWTPVLVREDMMYGTGNLPKFGEDSYQTTNGWWLVPTAEVTLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             + +E  +LP R+      FRSEAGSAG+DT GMLRQHQF K E+VSIT  + S  E +
Sbjct: 241 HGDTVEEATLPRRYAAHTQCFRSEAGSAGKDTAGMLRQHQFEKVEMVSITHPDHSRAELD 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CA+ IL+RL L YR V LCTGD+GF A +T+D+EVWL GQN YREISS S CG FQ
Sbjct: 301 RMTGCAQGILERLGLPYRTVVLCTGDMGFGARRTHDIEVWLPGQNTYREISSVSLCGEFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM +R+R       +F HTLNGSG+AVGRCLIA+LEN   ADGSV +P VL PY+   
Sbjct: 361 ARRMTARFRPAGGGKPQFVHTLNGSGLAVGRCLIAVLENGQQADGSVALPAVLHPYLGGR 420

Query: 421 AVIKKEHIL 429
           +V++ +  L
Sbjct: 421 SVLQADGTL 429


>gi|254465472|ref|ZP_05078883.1| seryl-tRNA synthetase [Rhodobacterales bacterium Y4I]
 gi|206686380|gb|EDZ46862.1| seryl-tRNA synthetase [Rhodobacterales bacterium Y4I]
          Length = 430

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 208/427 (48%), Positives = 281/427 (65%), Gaps = 2/427 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D A+ +R     S  IL+LDE  R  I   E  +A +N  S ++G 
Sbjct: 1   MHDIRAIRENPAAFDAAVARRGDAGVSSGILALDEARRAKILAAETAQAEQNKASKEVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G+ +  + L+   +  K ++  +  E  E+   L  +++ IPN+P ++VP G    
Sbjct: 61  AKGRGDEAEFERLRALVAEKKAEVAAMNTEAKELDQQLNDMLATIPNLPFDDVPDGADEV 120

Query: 121 ENILIRSVGKKPSAIHL-SREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +N+ IR  G+ P A+   ++EHFEI      MDF+ A KLSG+RF VL+G +A + RAL 
Sbjct: 121 DNVEIRRWGE-PKALEFEAKEHFEIEGVKPGMDFEVAAKLSGSRFVVLSGAVARIHRALA 179

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNL 239
           QFMI+ H  E+G TE   P+LVR+E MYGTGQ+PKF +D + TTDG WL+PT+EV+LTN+
Sbjct: 180 QFMINTHVDENGLTETWTPVLVREEMMYGTGQLPKFGEDSYKTTDGWWLVPTAEVTLTNI 239

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
            +  ++E   LP R+      FRSEAGSAG+DT GMLRQHQF K E+VS+T  + S  EH
Sbjct: 240 VNGLVVEEGYLPRRYVAHTQCFRSEAGSAGKDTAGMLRQHQFEKVEMVSVTHPDKSIEEH 299

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           ERM  CAE+IL+RL L YR + LCTGD+GF A KT+D+EVW+ GQN YREISS S CG+F
Sbjct: 300 ERMTRCAEDILERLGLPYRTIVLCTGDMGFGARKTHDIEVWVPGQNTYREISSVSVCGDF 359

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RRM +R++  +    +F HTLNGSG+AVGRCLIA+LEN   ADGSV +P VL PY+  
Sbjct: 360 QARRMTARFKPADGGKPQFVHTLNGSGLAVGRCLIAVLENGQQADGSVKLPEVLAPYLGG 419

Query: 420 LAVIKKE 426
              +  E
Sbjct: 420 KLTLSAE 426


>gi|16126242|ref|NP_420806.1| seryl-tRNA synthetase [Caulobacter crescentus CB15]
 gi|221235015|ref|YP_002517451.1| seryl-tRNA synthetase [Caulobacter crescentus NA1000]
 gi|30173208|sp|Q9A6T4|SYS_CAUCR RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|254783015|sp|B8GX53|SYS_CAUCN RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|13423468|gb|AAK23974.1| seryl-tRNA synthetase [Caulobacter crescentus CB15]
 gi|220964187|gb|ACL95543.1| seryl-tRNA synthetase [Caulobacter crescentus NA1000]
          Length = 482

 Score =  422 bits (1086), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 217/478 (45%), Positives = 293/478 (61%), Gaps = 55/478 (11%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP+  D     +     ++  + LD + R     +++ +A+RN +S  IG 
Sbjct: 1   MHDIKAIRENPKAYDRHWSGKGRSGAADEAVRLDAELRAAQTTLQEAQAKRNESSKLIGM 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+ + +    L  E  +LK  +    + E+     LK L++ +PN+P  EVP G   +
Sbjct: 61  AKAKKDEAEAARLMAEVESLKGVMATAAEAENLADGQLKDLLASLPNIPAPEVPAGEDEH 120

Query: 121 ENILIRSVG---KKPSA-IHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLER 176
            N+  R  G   K P+  ++  ++H ++G ALG MDF+ A ++SGARF VL   +A LER
Sbjct: 121 GNLEQRRWGDATKLPAGKLNKPKDHVDLGAALGGMDFEAAARMSGARFVVLKKEIARLER 180

Query: 177 ALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD---GR------- 226
           A+GQFM+DL T EHGYTEVS PLLV+D A+YGTGQ+PKFADD+F TT    GR       
Sbjct: 181 AIGQFMLDLQTVEHGYTEVSPPLLVKDHALYGTGQLPKFADDLFATTSFDLGRYDDEFAR 240

Query: 227 -----------------------------------------WLIPTSEVSLTNLYSHEII 245
                                                    WLIPT+EVSLTN+   +++
Sbjct: 241 QAAAIGSALDKLSDEHRNQLKYLLSKEYIHASVQNALERSHWLIPTAEVSLTNIVREQLV 300

Query: 246 ESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSC 305
             + LP+R T L PSFR+EAGSAGRDTRGM+RQHQF+K ELVSIT  + S  EH+RM+ C
Sbjct: 301 AEEELPMRLTALTPSFRAEAGSAGRDTRGMIRQHQFYKVELVSITTPDQSEAEHQRMVEC 360

Query: 306 AEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMN 365
           AE +LK+L+L +R + LCTGD+GF A KTYDLEVWL  Q++YREISSCS CG+FQ+RRM+
Sbjct: 361 AETVLKKLELPFRTMLLCTGDMGFGAKKTYDLEVWLPSQDMYREISSCSNCGDFQARRMD 420

Query: 366 SRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVI 423
           +RYR    K   F HTLNGSG+AVGR L+A+LENY +  G + IP  L+PYM  +  I
Sbjct: 421 ARYRKTGEKGGHFVHTLNGSGLAVGRTLVAVLENYQDEGGRIHIPAALQPYMGGVTHI 478


>gi|294676987|ref|YP_003577602.1| seryl-tRNA synthetase [Rhodobacter capsulatus SB 1003]
 gi|294475807|gb|ADE85195.1| seryl-tRNA synthetase [Rhodobacter capsulatus SB 1003]
          Length = 429

 Score =  422 bits (1086), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 211/419 (50%), Positives = 273/419 (65%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP   D  L +R L P S  +L+LDE+ R  I   E  +A +N+ + ++G 
Sbjct: 1   MHDIRAIRDNPAQFDADLARRSLPPLSAEVLALDERRRAAILAAETAQAAQNAAAKEVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+ +  + L+   +  K ++  ++ E   + + L+  +  IPN PL EVP G    
Sbjct: 61  AKAKGDEAEFERLRALVAEKKSEVAAMQAEAGRLDAELRDRLMLIPNAPLPEVPEGADEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ ++  G  PS    + EH+++      MDF+ A KLSGARF VL   +A + RAL Q
Sbjct: 121 GNVEVKRWGTIPSFAFKALEHYQLSAVAKAMDFETAAKLSGARFVVLRAGVARVHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLH   HG TE   P+LVR EAM GTGQ+PKFA+D + TTDG W+IPT+EV+LTN  
Sbjct: 181 FMLDLHVDSHGLTEAITPVLVRAEAMLGTGQLPKFAEDSYATTDGWWMIPTAEVTLTNFI 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           ++EI +  +LP R T     FRSEAGSAG+DT GMLRQHQF K E+V+I R ED+  EHE
Sbjct: 241 ANEIWDEAALPCRMTAHTNCFRSEAGSAGKDTAGMLRQHQFEKVEMVTICRPEDALAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE +L+ L L YR + LCTGD+GF + KTYDLEVWL GQN +REISS STCG FQ
Sbjct: 301 RMTGCAEAVLEALGLPYRRIVLCTGDMGFGSQKTYDLEVWLPGQNCFREISSVSTCGQFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           SRRMN RY+        F  TLNGSG+AVGRCLIA+LEN    DGSVT+P VL PY+  
Sbjct: 361 SRRMNGRYKPAAGGKPDFVATLNGSGLAVGRCLIAVLENGQQEDGSVTLPAVLHPYLGG 419


>gi|329889968|ref|ZP_08268311.1| seryl-tRNA synthetase [Brevundimonas diminuta ATCC 11568]
 gi|328845269|gb|EGF94833.1| seryl-tRNA synthetase [Brevundimonas diminuta ATCC 11568]
          Length = 427

 Score =  422 bits (1086), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 207/425 (48%), Positives = 282/425 (66%), Gaps = 7/425 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEY---ILSLDEKNRILIKKIEDIRARRNSNSAQ 57
           M DI+ IR NPE        R ++   +    I +LD   R    + +D  A+RN+ S  
Sbjct: 1   MHDIRAIRDNPEAFVAGWSSRGVDDADDVVARIRALDVDLRAAQTRGQDALAKRNAASKA 60

Query: 58  IGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGT 117
           IG A+ + +++  D LK E   LK ++    + E    + L+ L++ + N+   +VP G 
Sbjct: 61  IGAAMGKKDMAEADRLKAEVEALKGEIAEAGEAETAKGAELRDLLAGLKNLAAADVPDGE 120

Query: 118 SANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
             N N+ +   G+ P      ++H ++GEALGL+DF+ A K+SG+RF+VL G LA LERA
Sbjct: 121 DENGNVEVLKWGE-PRTTGPVKDHADLGEALGLLDFEAAAKMSGSRFAVLKGQLARLERA 179

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLT 237
           +GQFM+DL T +HGY EV+ P +V+D+AM+GTGQ+PKF +D+F   +   LIPT+EVSLT
Sbjct: 180 IGQFMLDLQTGKHGYQEVAPPYMVKDDAMFGTGQLPKFEEDLFRAGE-HLLIPTAEVSLT 238

Query: 238 NLYSHEIIESKSL--PLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDS 295
           NL   +I+    +  PLR   L P FR+EAGSAGRDTRG++RQHQF K E+VSI R EDS
Sbjct: 239 NLVREQILSEDEVAQPLRMAALTPCFRAEAGSAGRDTRGLIRQHQFSKVEMVSICRPEDS 298

Query: 296 FTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCST 355
             EHERM  CAE +L+ L+L YR V LC GD+GFSA KTYDLEVWL  QN YREISSCS 
Sbjct: 299 EAEHERMTGCAEAVLQALELPYRKVLLCKGDMGFSAQKTYDLEVWLPSQNTYREISSCSN 358

Query: 356 CGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
           CG+FQ+RRM++R++    K  +F HTLNGSG+AVGR L+A++ENY   DG++ +P  L+P
Sbjct: 359 CGDFQARRMDARFKRAGEKKTEFLHTLNGSGLAVGRTLVAVMENYQQEDGTIAVPAALQP 418

Query: 416 YMNNL 420
           YM  L
Sbjct: 419 YMGGL 423


>gi|58040190|ref|YP_192154.1| seryl-tRNA synthetase [Gluconobacter oxydans 621H]
 gi|67461607|sp|Q5FQ48|SYS_GLUOX RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|58002604|gb|AAW61498.1| Seryl-tRNA synthetase [Gluconobacter oxydans 621H]
          Length = 420

 Score =  422 bits (1085), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 209/420 (49%), Positives = 282/420 (67%), Gaps = 4/420 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M D++ +R +P   D AL +R L P  + ++S DE  R  +  +++ +  R + + +IG 
Sbjct: 1   MHDLKALRADPAAFDAALARRGLSPVGQQLVSDDEGRRAALAALQEAQGARKALAKEIG- 59

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +    L   + ++ +   L++Q+  LE+  + + + +  ++  +PN     VP G   +
Sbjct: 60  LLKRQKLDTAE-IEAKAVALRDQIAGLEERANTIQTRIDDVLKSLPNCLDASVPDGKGED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+++   G+K      +++HFE+GEALGLMDF  A KLSG RF VL G LA LERALGQ
Sbjct: 119 ENVVVHVRGEKREFAFEAKQHFELGEALGLMDFPTAAKLSGTRFVVLRGALARLERALGQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D HT+E GY+E S PLLV D+AMYGT ++PKFA+D F T DGRWLIPT+EV LT   
Sbjct: 179 FMLDTHTTEFGYSETSVPLLVNDDAMYGTDKLPKFAEDSFRTEDGRWLIPTAEVPLTASV 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI+ + +LP+R T L+  FRSEAGSAGRD RGMLRQHQF KCELVS+ + EDS  EHE
Sbjct: 239 MGEILPADALPIRMTALSQCFRSEAGSAGRDVRGMLRQHQFTKCELVSVVKPEDSDAEHE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM   AE +L+RL + +R + LC GD GF A KT+DLE WL GQ  +REISSCS   +FQ
Sbjct: 299 RMTQAAETVLERLGITFRRMLLCAGDTGFGAAKTFDLEAWLPGQKAWREISSCSNTRDFQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR  N  +  F +TLNGSG+AVGR +IA++E Y N DGS+ IP VLRPYM  L
Sbjct: 359 ARRMNARYRAENGPA--FVNTLNGSGLAVGRTMIAVMETYQNEDGSIDIPEVLRPYMGGL 416


>gi|149204172|ref|ZP_01881140.1| seryl-tRNA synthetase [Roseovarius sp. TM1035]
 gi|149142614|gb|EDM30659.1| seryl-tRNA synthetase [Roseovarius sp. TM1035]
          Length = 430

 Score =  421 bits (1083), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 207/429 (48%), Positives = 279/429 (65%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+ P+  D AL +R L P S  IL+LDE  R  I   E  +A +N  S + G 
Sbjct: 1   MHDIRAIRETPDAFDAALARRGLAPVSPQILALDEARRTRIHAAESAQADQNRASKEAGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G+ +  + L+   S  KE++  ++ E   + + L  L+  +PN+P ++VP GT  +
Sbjct: 61  AKGRGDEAEFERLRTLVSAKKEEMAAMQAEAKALDTQLTDLLMALPNLPFDDVPDGTDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G   S     +EH++I      MDF+ A KLSGARF VL+G +A L RAL Q
Sbjct: 121 GNVELRRWGTPASFDFTPKEHYDITGVQPGMDFETAAKLSGARFVVLSGSIARLHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H  E+G  E   P+LVR E M GTGQ+PKF +D + TT+G WL+PT+EV+LTN+ 
Sbjct: 181 FMLDTHIEENGLQETWTPVLVRPEMMLGTGQLPKFGEDSYETTNGWWLVPTAEVTLTNIV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             E +++ +LP R+      FRSEAGSAGRDT GMLRQHQF K E+VSIT  ++S  E +
Sbjct: 241 HGETVDAATLPRRYVAHTQCFRSEAGSAGRDTAGMLRQHQFEKVEMVSITHPDESRAELD 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CA+ IL+RL L YR + LCTGD+GF A +T+D+EVWL GQN YREISS S CG+FQ
Sbjct: 301 RMTACAQSILERLGLPYRTIVLCTGDMGFGARRTHDIEVWLPGQNTYREISSVSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++       +F HTLNGSG+AVGRCLIA+LEN   ADGSV IP  L PY+   
Sbjct: 361 ARRMNARFKPQGGGKPEFLHTLNGSGLAVGRCLIAVLENGQQADGSVRIPDALHPYLRGK 420

Query: 421 AVIKKEHIL 429
            ++  +  L
Sbjct: 421 TILNADGSL 429


>gi|254293766|ref|YP_003059789.1| seryl-tRNA synthetase [Hirschia baltica ATCC 49814]
 gi|254042297|gb|ACT59092.1| seryl-tRNA synthetase [Hirschia baltica ATCC 49814]
          Length = 437

 Score =  421 bits (1083), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 212/437 (48%), Positives = 285/437 (65%), Gaps = 13/437 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRH--LEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQI 58
           M DI+ IR NP+       +R   L      IL+LDE+ R  +++I+D    RN +S  I
Sbjct: 1   MHDIRAIRDNPDAYINGWNRRKSGLGDVVSDILALDEQLRAAVQQIQDAEQIRNKSSKLI 60

Query: 59  GQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTS 118
           G+A A GN      L  E +  K  +  + + E +V + L  ++  +PN+  ++VP G  
Sbjct: 61  GKAKATGNEDEAQRLMAEVADAKATMEKIGETESDVRAKLDAILLGLPNIVYDDVPDGED 120

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEAL------GLMDFDRATKLSGARFSVLTGHLA 172
            ++N  +R  G+       ++EH ++GE L       LMDF+ A K+SGARF  L G +A
Sbjct: 121 EDDNTEVRVWGEPNKLAFTAQEHADLGEKLKDEKGFALMDFEAAAKISGARFVALRGKMA 180

Query: 173 HLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTS 232
            LERAL QFM+D+ T EHGY EVS P LVRD+A+ GTGQ+PKF +D+F TT+  + IPT+
Sbjct: 181 KLERALTQFMLDVQTDEHGYQEVSPPFLVRDDALVGTGQLPKFEEDLFKTTNDFYTIPTA 240

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV +TNL   +I+    LP+R T   P FRSEAGSAGRDT+GM+R HQF K E+VSIT+ 
Sbjct: 241 EVPVTNLVREQILAEDQLPIRMTAATPCFRSEAGSAGRDTKGMIRLHQFTKVEMVSITKP 300

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E+S  E ERM  CAE IL++L+L YRVV+LCTGD+GF A +TYD+EVWL  Q+ YREISS
Sbjct: 301 EESDAELERMTGCAEAILQKLELPYRVVNLCTGDIGFGAKRTYDIEVWLPSQDTYREISS 360

Query: 353 CSTCGNFQSRRMNSRYR-----DPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSV 407
           CSTCG+FQ+RRMN+R++     D      +F HTLNGSG+AVGR L+A+LENY   DGS+
Sbjct: 361 CSTCGDFQARRMNTRFKPAPTEDNKKPKTQFVHTLNGSGLAVGRTLVAVLENYQQEDGSI 420

Query: 408 TIPTVLRPYMNNLAVIK 424
            +P  L PYM  + VIK
Sbjct: 421 KVPAALVPYMGGVEVIK 437


>gi|254453692|ref|ZP_05067129.1| seryl-tRNA synthetase [Octadecabacter antarcticus 238]
 gi|198268098|gb|EDY92368.1| seryl-tRNA synthetase [Octadecabacter antarcticus 238]
          Length = 430

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 207/429 (48%), Positives = 282/429 (65%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D AL +R   P S  +L++DE  R  I   E  +A  N  +  +G 
Sbjct: 1   MHDIRAIRENPAAFDAALSRRGDAPLSAELLAMDEARRAKILAAETAQADANKAAKDVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+    + L+   S  K Q+  L  +     + L   ++ IPN+P ++VP+G   N
Sbjct: 61  AKARGDNEEFERLRALVSEKKAQIAQLNDQAKAQATGLTARLAMIPNLPADDVPMGADEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I   G   +      EHF+I      MDF+ A K+SG+RF +++G +A L RAL Q
Sbjct: 121 DNVEISRWGTPRTFDFTPAEHFDISAVKPNMDFETAAKISGSRFVLMSGAVARLHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D+HT E+G TE++ P+LVRD+AMYGT ++PKFA D + TT+G WLI TSE+ LT + 
Sbjct: 181 FMLDIHTVENGLTEMNTPVLVRDDAMYGTDKLPKFAGDSYQTTEGMWLISTSEIPLTYIA 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + + I++ SLP R+T     FRSEAGSAGRDT GMLRQHQF K E+VS+T  ++S TE +
Sbjct: 241 AGDTIDAASLPRRYTAHTLCFRSEAGSAGRDTSGMLRQHQFEKVEMVSVTHPDESDTEQK 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML CAE++L+RL++ YR V LCTGD+GF A +T+D+E WL GQN YREISS ST G FQ
Sbjct: 301 RMLRCAEDLLERLEIPYRTVLLCTGDMGFGARRTFDIEAWLPGQNAYREISSVSTTGEFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++  +    +F HTLNGSG+AVGRCLIA+LEN   ADGSVTIPT L  +M   
Sbjct: 361 ARRMNARFKPADGGKPQFVHTLNGSGLAVGRCLIAVLENGQQADGSVTIPTALHRHMGGK 420

Query: 421 AVIKKEHIL 429
            +I  +  L
Sbjct: 421 TMINADGTL 429


>gi|289549035|ref|YP_003474023.1| seryl-tRNA synthetase [Thermocrinis albus DSM 14484]
 gi|289182652|gb|ADC89896.1| seryl-tRNA synthetase [Thermocrinis albus DSM 14484]
          Length = 424

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 216/425 (50%), Positives = 289/425 (68%), Gaps = 13/425 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS----EYILSLDEKNRILIKKIEDIRARRNSNSA 56
           MLD++ IR+ P ++   L++R  +PQ     +  L+LD + R LIK+IE +R  RN+ S 
Sbjct: 1   MLDVELIRKQPLYVRQKLERR--DPQYAQLLDQFLALDTRRRELIKEIEQLRFLRNTKSK 58

Query: 57  QIGQAIAEG-NLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           QIG+   +G N SL   L+ E   L+E++ +++ E  EV    + L+  IPN+P + VP+
Sbjct: 59  QIGELKKKGENTSL---LEEEVKELREKIDLMDSELREVERQAQDLLLRIPNLPHDSVPV 115

Query: 116 GTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLE 175
           G    +N+ I+  G+ PS     + H+EIGE L ++DF+R  KLSG+RF+VL G  A LE
Sbjct: 116 GEDEKDNVEIKRWGEPPSFTFTPKPHWEIGEYLNILDFERGAKLSGSRFTVLKGWGAKLE 175

Query: 176 RALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGRWLIPTSEV 234
           RAL  FM+DLHTS  GYTEV  P LV+ E + GTGQ+PKF +D++ C  D  +LIPT+EV
Sbjct: 176 RALINFMLDLHTS-RGYTEVMTPHLVKPEILVGTGQLPKFEEDLYKCERDQLYLIPTAEV 234

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
           +LTNL+  EI+  + LP+  T   P +R EAG+ G+D RG++RQHQF K ELV I + ED
Sbjct: 235 TLTNLFREEILREEDLPIYLTAYTPCYRREAGAYGKDVRGIIRQHQFDKVELVKIVKPED 294

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCS 354
           S+ E ER+L  AEE+L+ L L YRVV LCTGDLGFS+ KTYD+EVW   Q  YRE+SSCS
Sbjct: 295 SYKELERLLEDAEEVLRLLQLPYRVVELCTGDLGFSSAKTYDIEVWFPSQGRYREVSSCS 354

Query: 355 TCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR 414
            C +FQ+RRMN RYRD N + L+F HTLNGSG+AVGR L AILENY   DGSV +P VLR
Sbjct: 355 NCEDFQARRMNLRYRDANGR-LRFVHTLNGSGLAVGRVLAAILENYQREDGSVEVPPVLR 413

Query: 415 PYMNN 419
            Y+  
Sbjct: 414 DYLGT 418


>gi|260433300|ref|ZP_05787271.1| seryl-tRNA synthetase [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417128|gb|EEX10387.1| seryl-tRNA synthetase [Silicibacter lacuscaerulensis ITI-1157]
          Length = 430

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 210/429 (48%), Positives = 283/429 (65%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D AL +R   P S  +L LDE  R  I   E  +A +N  S ++G 
Sbjct: 1   MHDIRAIRENPAAFDAALARRGEAPISAELLRLDEARRAKILAAETAQAEQNKASKEVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +    L+   +  K ++  ++ E  ++ + L   +  IPN+P E+VP G   N
Sbjct: 61  AKARGDEAEFQRLRALVAEKKAEIARMQTEAKDLDALLTDQLIRIPNLPAEDVPDGKDEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G   +    ++EHFEI      MDF+ A KL+G+RF +L+G +A + RAL Q
Sbjct: 121 DNVEVNRWGTPRAFDFDAKEHFEIEAVQNGMDFETAAKLAGSRFVLLSGGVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H +E+G TEV+AP+LV  E M GTGQ+PKF +D + T +G WLIPTSEVSLTN+ 
Sbjct: 181 FMLDTHINENGLTEVNAPVLVLSEMMMGTGQLPKFGEDSYQTREGWWLIPTSEVSLTNIV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           +  +IE   LP R+T  +  FRSEAGSAG+DTRGMLRQHQF K E+VSIT  + S  E +
Sbjct: 241 NDTMIEESYLPRRYTAHSLCFRSEAGSAGKDTRGMLRQHQFEKVEMVSITHPDKSDEEQK 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML CAE IL++L + YR V LCTGD+GF A +TYD+E WL GQN YREISS STCG+FQ
Sbjct: 301 RMLRCAEGILEKLGVPYRTVILCTGDMGFGARRTYDIEAWLPGQNTYREISSVSTCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R+R       ++ HTLNGSG+AVGRCLIA+LEN   ADG+V +P VL PY+   
Sbjct: 361 ARRMNARFRPEGGGKPEYVHTLNGSGLAVGRCLIAVLENGQQADGTVILPEVLAPYLGGK 420

Query: 421 AVIKKEHIL 429
             ++K+  L
Sbjct: 421 LTLQKDGTL 429


>gi|57239182|ref|YP_180318.1| seryl-tRNA synthetase [Ehrlichia ruminantium str. Welgevonden]
 gi|58579140|ref|YP_197352.1| seryl-tRNA synthetase [Ehrlichia ruminantium str. Welgevonden]
 gi|81819249|sp|Q5HB76|SYS_EHRRW RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|57161261|emb|CAH58182.1| seryl-tRNA synthetase [Ehrlichia ruminantium str. Welgevonden]
 gi|58417766|emb|CAI26970.1| Seryl-tRNA synthetase [Ehrlichia ruminantium str. Welgevonden]
          Length = 427

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 215/429 (50%), Positives = 285/429 (66%), Gaps = 11/429 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI +I+ NPE  D A++ R+    +  I+ L    +  + ++  ++  RN+ + +I +
Sbjct: 1   MHDIDFIKNNPELFDEAMQNRNFGKIAHKIIELSANKKHTLTQLYSLQKERNNITQEI-E 59

Query: 61  AIAEGNL---SLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGT 117
            + + N+   + ++  K  T  +     +++ +     S L  L++ +PN+P ++VPIG 
Sbjct: 60  KLKKDNIQCDTQIELSKEITKKINHINNMIKTD-----SELIDLLNILPNIPDKKVPIGK 114

Query: 118 SANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
             N+NI IR  GKK       + H+E+GE L LMDF +A KLSG+RF +L   LA L+RA
Sbjct: 115 DENDNIEIRRYGKKVDFKFPPKTHYELGENLNLMDFKQAAKLSGSRFVILKSQLAQLDRA 174

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLT 237
           L  FM+D+HT E GY+E+S P+LV + AMYG GQ+PKFADD F TTD   LIPTSEV+LT
Sbjct: 175 LANFMLDVHTQEFGYSEISHPVLVHESAMYGVGQLPKFADDSFKTTDNFRLIPTSEVALT 234

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           NL S+    +  LP+R T  +  FRSEAGSAG+D RGM+RQHQF K ELVSI  EE S  
Sbjct: 235 NLVSNTNTNANELPIRLTACSQCFRSEAGSAGKDVRGMMRQHQFNKVELVSIVTEEQSEL 294

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E ERM   AEEILK+L+L YRV+ LCTGDLGFSA  TYD+EVW+  QN YREISSCS C 
Sbjct: 295 ELERMTQVAEEILKKLELPYRVMMLCTGDLGFSASITYDIEVWIPSQNQYREISSCSNCK 354

Query: 358 NFQSRRMNSRYR--DPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
            FQ+RRMN++Y      +K  KF HTLNGS +A+GR +IAILENY N DGS+TIP VLR 
Sbjct: 355 AFQARRMNAKYHTISNGNKVNKFVHTLNGSALAIGRTIIAILENYQNQDGSITIPHVLRK 414

Query: 416 YMNNLAVIK 424
           YMNN  +IK
Sbjct: 415 YMNNQDIIK 423


>gi|91204894|ref|YP_537249.1| seryl-tRNA synthetase [Rickettsia bellii RML369-C]
 gi|122426103|sp|Q1RKF4|SYS_RICBR RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|91068438|gb|ABE04160.1| Seryl-tRNA synthetase [Rickettsia bellii RML369-C]
          Length = 426

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 209/423 (49%), Positives = 281/423 (66%), Gaps = 2/423 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           ML+I+WIR+N E  D  L++R +EP ++ I  LD K R +   I++ +  R   S  +G 
Sbjct: 1   MLNIKWIRENQELFDDKLRQRFIEPMAKRIEELDGKKRKITNLIQEFQHARKVKSKILGN 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            I   +    + L+ +   + E+L  LE++ +      + L + +PN+P EEVP G   +
Sbjct: 61  -INPKSGEEFEGLQRDVKDINEKLEELEQDLNNNNELNELLNT-LPNIPDEEVPYGIDES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N LIR+ G+        ++HFE+G  L LMDF++  K+SGARF  L G LA LERAL  
Sbjct: 119 MNKLIRTHGEVDLNAQNKKQHFELGVKLDLMDFEQTAKISGARFVTLKGDLAKLERALAN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D+HT E G+ EVS P+LVRD AMY +GQ+PKFAD+ F TT+G  LIPT+EVSL N+ 
Sbjct: 179 FMLDVHTGEFGFLEVSPPVLVRDNAMYNSGQLPKFADESFATTNGYRLIPTAEVSLVNMV 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           +  II  + LP+R     P FRSEAGS+GRDTRGM+R HQF K ELVSIT  E+S  EHE
Sbjct: 239 ADTIIPREKLPMRLVAYTPCFRSEAGSSGRDTRGMIRLHQFSKVELVSITTPEESKNEHE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
            M + +E IL++L LHYR + LCTGD+GF++ KTYD+EVWL GQ  YREI+SCS CG+FQ
Sbjct: 299 YMTNASETILQKLGLHYRTMLLCTGDMGFASQKTYDIEVWLPGQKQYREIASCSNCGDFQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM +RY++  S      HTLN SG+ +GR ++AILENY N DGS+T+P VL  YM  L
Sbjct: 359 ARRMKARYKEFGSHDTTLVHTLNASGLPIGRTMVAILENYQNEDGSITVPDVLVNYMGGL 418

Query: 421 AVI 423
             I
Sbjct: 419 QKI 421


>gi|84503428|ref|ZP_01001488.1| seryl-tRNA synthetase [Oceanicola batsensis HTCC2597]
 gi|84388215|gb|EAQ01167.1| seryl-tRNA synthetase [Oceanicola batsensis HTCC2597]
          Length = 429

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 209/429 (48%), Positives = 281/429 (65%), Gaps = 1/429 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP+  D AL +R + P S  IL+LDEK R  I   E  +A +N++S +IG+
Sbjct: 1   MHDIRAIRDNPDAFDAALARRGVSPLSSEILALDEKRRACIHAAESAQADQNASSKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  + L+   +  K+++  ++ E  +    L  ++  IPN+P ++VP G   +
Sbjct: 61  AKASGDEAEFERLRALVAAKKDEVARMQAEAKDWDRKLTDMLMGIPNLPHDDVPDGADED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N  +R  G  P       EH+E+      MDF+ A KLSG+RF VL+G +A + RAL Q
Sbjct: 121 DNAELRRHGTPPEFAFKPLEHYELPGVQEGMDFETAAKLSGSRFVVLSGAVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H SE+G TE   P+LV++E MYGTGQ+PKF +D + T +G WL+PT+EV+LTN+ 
Sbjct: 181 FMLDTHVSENGLTETWTPVLVKEEMMYGTGQLPKFGEDSYRTREGWWLVPTAEVTLTNIV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           +  +I    LP R+      FRSEAGSAGRDT GMLRQHQF K E+VSITR E+S  E +
Sbjct: 241 NDVMIADSYLPRRYVAHTQCFRSEAGSAGRDTAGMLRQHQFEKVEMVSITRPEESRAELD 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE IL+RL L +R V LCTGD+GF A +T+D+EVWL GQN YREISS S CG+FQ
Sbjct: 301 RMTDCAEGILRRLGLAFRTVVLCTGDMGFGARRTHDIEVWLPGQNAYREISSVSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR P      + HTLNGSG+AVGRCLIA+LEN    DGSV +P  L P++   
Sbjct: 361 ARRMNARYR-PEGGKPDYVHTLNGSGLAVGRCLIAVLENGQCEDGSVALPEALHPWLGGK 419

Query: 421 AVIKKEHIL 429
             +  E  L
Sbjct: 420 TTLTAEGQL 428


>gi|262277223|ref|ZP_06055016.1| seryl-tRNA synthetase [alpha proteobacterium HIMB114]
 gi|262224326|gb|EEY74785.1| seryl-tRNA synthetase [alpha proteobacterium HIMB114]
          Length = 422

 Score =  418 bits (1075), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 212/426 (49%), Positives = 295/426 (69%), Gaps = 7/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYI---LSLDEKNRILIKKIEDIRARRNSNSAQ 57
           ML+I+ IR NPE+    LKKR+++   + I   L LD+  R  +++ E +   RN  S +
Sbjct: 1   MLNIKDIRLNPENFIQNLKKRNIDDPKKIISNILELDKTYRNFLEQKEKLLNERNIISKE 60

Query: 58  IGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGT 117
           +G+   + +    + L N+ S +KE++  L+K   E   S+ +++  +PNVP E+VP+GT
Sbjct: 61  LGKN--KDDQKKFNELSNKVSMIKEEIFKLDKITEEKILSINEILMSLPNVPHEDVPVGT 118

Query: 118 SANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
              +NI IR VG+   +  +   H EIGE +  +DF+ A K+SG+RF +L  +LA LERA
Sbjct: 119 DDRQNIEIRKVGQCKVSDKIM-PHDEIGERIKKIDFETAVKISGSRFVILKENLAKLERA 177

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLT 237
           L  FM+D+HT E+GYTE S P++V +++MYGTGQ+PKF +D F   + +WLIPTSEVSLT
Sbjct: 178 LINFMLDVHTEENGYTEYSVPVIVNEKSMYGTGQLPKFKEDQFQLNNNQWLIPTSEVSLT 237

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           N+ S  IIE + LPLRF +    FR+EAG+AG+DT+GM+RQHQF K E+VSI + E  F 
Sbjct: 238 NMVSESIIEYEKLPLRFVSATQCFRAEAGAAGKDTKGMIRQHQFAKVEMVSIIQPEFRFK 297

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E ERM+ CAE+ILK+L L YRV+ L +GD+GFSA KTYDLEVWL  QN YREISSCS+CG
Sbjct: 298 ELERMVECAEKILKKLKLPYRVMLLSSGDMGFSAEKTYDLEVWLPSQNKYREISSCSSCG 357

Query: 358 NFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
            FQ+ RM +RY+  + K+     TLNGSG+AVGR ++AILENY NADGS++IP  L+ YM
Sbjct: 358 TFQANRMRARYKTLDKKN-NLVATLNGSGLAVGRTIVAILENYQNADGSISIPECLKKYM 416

Query: 418 NNLAVI 423
            N+  +
Sbjct: 417 GNVETL 422


>gi|68171715|ref|ZP_00545070.1| Seryl-tRNA synthetase, class IIa [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|67998859|gb|EAM85556.1| Seryl-tRNA synthetase, class IIa [Ehrlichia chaffeensis str.
           Sapulpa]
          Length = 406

 Score =  418 bits (1075), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 216/412 (52%), Positives = 282/412 (68%), Gaps = 11/412 (2%)

Query: 18  LKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQAIAEGNLSL---VDALK 74
           ++ R+ E  ++ I+ LD K R L+ ++  ++  RN  + +I + + + NL     ++  K
Sbjct: 1   MQVRNSEKVAKKIIELDVKKRHLLTQLYSLQKERNQITQEI-EKLKKNNLQCNIQIELSK 59

Query: 75  NETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSANENILIRSVGKKPSA 134
           + TS + +   +++++     S L  L++ +PN+P E VPIG   N N+ +R  G K S 
Sbjct: 60  DVTSKINDINNMIKED-----SQLVNLLNMLPNIPDERVPIGKDENSNVELRRHGNKTSF 114

Query: 135 IHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTE 194
               + H+E+GE L LMDF +A KLSG+RF +L   LA L+RAL  FM+D+H  E GY+E
Sbjct: 115 DFPIKTHYELGENLNLMDFKQAAKLSGSRFVILKNQLAQLDRALSNFMLDIHIKEFGYSE 174

Query: 195 VSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLYSHEIIESKSLPLRF 254
           +S P+LV + AMYG GQ+PKFADD F TT+   LIPTSEV+LTNL S+  I +  LPLRF
Sbjct: 175 ISHPILVHESAMYGVGQLPKFADDSFKTTENFRLIPTSEVALTNLVSNMNINACDLPLRF 234

Query: 255 TTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLD 314
           T  +P FRSEAGSAGRDTRGM+RQHQF K ELVSI  EE S  E ERM   AEEILKRL+
Sbjct: 235 TACSPCFRSEAGSAGRDTRGMMRQHQFNKVELVSIVTEEQSAPELERMTQIAEEILKRLE 294

Query: 315 LHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRD--PN 372
           L YRV+ LCTGD+GFSA  TYD+EVW+  QN YREISSCS C  FQ+RRMN++Y     N
Sbjct: 295 LPYRVMMLCTGDMGFSASITYDIEVWIPSQNQYREISSCSNCKAFQARRMNTKYTTIINN 354

Query: 373 SKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVIK 424
            K  KF HTLNGS +A+GR +IAILENY N DGS+TIP +LR YM+N  VIK
Sbjct: 355 VKVSKFVHTLNGSALAIGRTIIAILENYQNRDGSITIPHILRKYMDNQEVIK 406


>gi|259418549|ref|ZP_05742466.1| seryl-tRNA synthetase [Silicibacter sp. TrichCH4B]
 gi|259344771|gb|EEW56625.1| seryl-tRNA synthetase [Silicibacter sp. TrichCH4B]
          Length = 430

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 208/429 (48%), Positives = 283/429 (65%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D AL +R     S  +L LDE  R  I   E  +A +N  +  IG 
Sbjct: 1   MHDIRAIRENPAAFDAALARRGESALSSQVLELDEARRAKILAAETAQADQNKAAKAIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+ +  + L+ E +  K ++  ++ E  E+ + L  +++ IPN P E+VP G   +
Sbjct: 61  AKAKGDEAEFERLRAEVADKKAEVATMQAEAKELDAKLTDMLARIPNSPAEDVPEGADED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ ++  G  P+     +EHFEI      MDF+ A K+SGARF VL G +A + RAL Q
Sbjct: 121 DNVEVKRWGDVPAFDFEPKEHFEIAGVAKAMDFETAAKISGARFVVLKGAVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H  E+G TEV++P+LVRDEAMYGT ++PKF DD + TT+G WL+PTSEV LT   
Sbjct: 181 FMVDTHVDENGLTEVNSPVLVRDEAMYGTDKLPKFGDDSYQTTNGWWLVPTSEVPLTYSV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + ++I+  +LP+R+T     FRSEAGSAG+DT GMLRQHQF K E+VSI   E S  E +
Sbjct: 241 AGDVIDESTLPIRYTAHTLCFRSEAGSAGKDTSGMLRQHQFEKVEMVSIVHPETSDDEQK 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML CAE IL++L + YR V LCTGD+GF A +T+D+E W+ GQN YREISS ST G+FQ
Sbjct: 301 RMLGCAEGILEKLGIPYRTVVLCTGDMGFGARRTFDIEAWVPGQNTYREISSVSTTGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++  +    +F HTLNGSG+AVGRCLIA+LEN   ADGSV +P  L PY+   
Sbjct: 361 ARRMNARFKPADGGKPEFLHTLNGSGLAVGRCLIAVLENGQQADGSVKLPAALTPYLGGK 420

Query: 421 AVIKKEHIL 429
           + +  E  L
Sbjct: 421 STLTAEGTL 429


>gi|83952360|ref|ZP_00961091.1| seryl-tRNA synthetase [Roseovarius nubinhibens ISM]
 gi|83836033|gb|EAP75331.1| seryl-tRNA synthetase [Roseovarius nubinhibens ISM]
          Length = 430

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 206/429 (48%), Positives = 280/429 (65%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP   D AL  R L+  S  IL+LDEK R LI   E  +A +N  S ++G 
Sbjct: 1   MHDIRAIRDNPAAFDAALALRGLDGASSQILALDEKRRALIHAAETAQAEQNRASKEVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+ +  + L+      K ++  ++ E  E+   L  L+  +PN+P ++VP G    
Sbjct: 61  AKAKGDEAEFERLRALVGEKKSEVAAMQAEAKELDQQLTDLLMGLPNLPFDDVPQGADEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I   G         +EH+E+   L  MDF+ A KLSG+RF VL+G +A + RAL Q
Sbjct: 121 DNVEIHRWGTPRVFDFTPKEHYELDGVLPGMDFETAAKLSGSRFVVLSGAVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMI+ H  E+G TE   P+LVR E MYGTGQ+PKF +D + TT+G WL+PT+EV+LTN+ 
Sbjct: 181 FMINTHIDENGLTETWTPVLVRPEMMYGTGQLPKFGEDSYETTNGWWLVPTAEVTLTNIV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           +   +E+  LP R+      FRSEAGSAGRDT GMLRQHQF K E+VS+T  ++S  E +
Sbjct: 241 NGLTVEADYLPRRYVAHTQCFRSEAGSAGRDTAGMLRQHQFEKVEMVSVTHPDESRAELD 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CA+ IL+RL L YR V LCTGD+GF A +T+D+EVWL GQ+ YREISS S CG+FQ
Sbjct: 301 RMTACAQGILERLGLPYRTVVLCTGDMGFGARRTHDIEVWLPGQDSYREISSVSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++  +    +F HTLNGSG+AVGRCLIA+LEN   ADGSV +P  L PY+   
Sbjct: 361 ARRMNARFKPADGGKPQFLHTLNGSGLAVGRCLIAVLENGQQADGSVALPEALHPYLGGK 420

Query: 421 AVIKKEHIL 429
            ++  +  L
Sbjct: 421 TILAADGTL 429


>gi|294789503|ref|ZP_06754739.1| serine--tRNA ligase [Simonsiella muelleri ATCC 29453]
 gi|294482583|gb|EFG30274.1| serine--tRNA ligase [Simonsiella muelleri ATCC 29453]
          Length = 430

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 203/427 (47%), Positives = 284/427 (66%), Gaps = 9/427 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R + E +   L  R  E  +     LD + ++L  + E ++A+RN  S QIG 
Sbjct: 1   MLDIQLLRNDIEAVAQRLAARGFELDTTKFEQLDAQRKLLQTENEQLQAKRNQLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            + +G     DA KNE + +K Q+  +E++   + ++L  L+  +PN+P E VPIG    
Sbjct: 61  FMGQGKKDEADAAKNEVAQIKSQMDKIEQDLPNIQAALDDLLLRVPNLPHESVPIGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++G ALGL DF++A +LSGARFS++ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPRQFDFDIKDHVDLGAALGL-DFEKAAQLSGARFSLMKGKVARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT++HGYTE   P +V D  + GTGQ+PKF +D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTTQHGYTECYTPYIVSDSTLLGTGQLPKFGEDLFHVTRGGDETKLTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN    E++    LP++ T  +P FRSEAGS G+DTRG++RQHQF K E+V I + E
Sbjct: 240 VTLTNTVRDEVLSPHDLPMKLTAHSPCFRSEAGSHGKDTRGLIRQHQFDKVEMVQIVQPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYEALEEMVGHAENILKLLELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRALVAVLENHQNADGSINIPKAL 418

Query: 414 RPYMNNL 420
           +PY+  +
Sbjct: 419 QPYLGGV 425


>gi|86138471|ref|ZP_01057045.1| seryl-tRNA synthetase [Roseobacter sp. MED193]
 gi|85824996|gb|EAQ45197.1| seryl-tRNA synthetase [Roseobacter sp. MED193]
          Length = 430

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 208/419 (49%), Positives = 279/419 (66%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D AL +R     S  IL+LDE  R  I++ E  +A +N  + +IG 
Sbjct: 1   MHDIRAIRENPAAFDAALARRGDAGVSSDILALDEARRAKIQEAEAAQAAQNKAAKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+    + L+ E +  K Q+  L+ E  E+ +    +++ I N+P E+VP G   +
Sbjct: 61  AKAKGDTETFERLRAEVAEKKAQVAALQTEAKELDAKQTDMLARIANLPAEDVPEGADED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G        ++EHFEI      MDF+ A K SGARF  L G +A + RAL Q
Sbjct: 121 DNVEVNRWGTPRELDFDAKEHFEIAGVAQAMDFETAAKTSGARFVFLKGGVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H  E+G TEV  P+LVRDEAMYGT ++PKF DD + TT+G WL+PTSEV+LT   
Sbjct: 181 FMVDTHVDENGLTEVQTPVLVRDEAMYGTDKLPKFGDDSYQTTNGWWLVPTSEVTLTYSV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + +++E+  LP+R T     FRSEAGSAGRDT GMLRQHQF K E+VSIT  ++S +E +
Sbjct: 241 AGDVLEASDLPIRMTAHTQCFRSEAGSAGRDTSGMLRQHQFEKVEMVSITHPDESDSEQK 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML CAE +L++L + YR V LCTGD+GF A +T+D+E WL GQN YREISS ST G FQ
Sbjct: 301 RMLRCAEGLLEKLGVPYRTVVLCTGDMGFGARRTFDIEAWLPGQNTYREISSVSTTGAFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           +RRMN+R+R  +    +F H+LNGSG+AVGRCLIA+LEN   ADGSVT+P VL PY+  
Sbjct: 361 ARRMNARFRPADGGKPEFVHSLNGSGLAVGRCLIAVLENGQQADGSVTLPEVLGPYLKG 419


>gi|126732587|ref|ZP_01748384.1| seryl-tRNA synthetase [Sagittula stellata E-37]
 gi|126706871|gb|EBA05940.1| seryl-tRNA synthetase [Sagittula stellata E-37]
          Length = 430

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 206/417 (49%), Positives = 277/417 (66%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NPE LD AL +R  EP S  +L+LD + R  I   E  +A +N  S ++G+
Sbjct: 1   MHDIRAIRENPETLDAALGRRGAEPMSSAVLALDAERRAAILAAETAQADQNRASKEVGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  + L+   +  K ++  ++++   + + L  L+  +PN+PL +VP G   N
Sbjct: 61  AKASGDEAEFERLRALVAEKKAEVAEMQEKAKVLDTQLTDLLMGLPNLPLADVPDGADEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ IR  G+  S     +EH+E+      MDF+ A KLSG+RF +L+G +A + RAL Q
Sbjct: 121 DNVEIRRWGEPRSFDFTPKEHYELEGVKPGMDFETAAKLSGSRFVLLSGGVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H  EH   E   P+LVR E MYGTGQ+PKF +D + TT+G WLIPTSEV+LTN+ 
Sbjct: 181 FMLDTHVEEHDLAETWTPVLVRPEMMYGTGQLPKFGEDSYETTNGWWLIPTSEVTLTNIV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           +   ++   LP R+   +  FRSEAGSAGRDT GMLRQHQF K E+V++   + S  EHE
Sbjct: 241 NGLTVDEGYLPRRYAAHSQCFRSEAGSAGRDTSGMLRQHQFEKVEMVTVCHPDKSLEEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE IL++L L YR V LCTGD+GF A KT+D+EVWL GQN YREISS STCG+FQ
Sbjct: 301 RMTRCAEAILEKLGLPYRTVVLCTGDIGFGAQKTHDIEVWLPGQNTYREISSVSTCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +RRMN+RY+        F HTLNGSG+AVGR LIA+LEN   ADGSV +P  L P++
Sbjct: 361 ARRMNARYKPTEGGKPGFLHTLNGSGLAVGRALIAVLENGQQADGSVDLPEALHPWL 417


>gi|15604615|ref|NP_221133.1| seryl-tRNA synthetase [Rickettsia prowazekii str. Madrid E]
 gi|6226194|sp|Q9ZCG5|SYS_RICPR RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|3861310|emb|CAA15209.1| SERYL-TRNA SYNTHETASE (serS) [Rickettsia prowazekii]
 gi|292572433|gb|ADE30348.1| Seryl-tRNA synthetase [Rickettsia prowazekii Rp22]
          Length = 425

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 209/423 (49%), Positives = 287/423 (67%), Gaps = 3/423 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           ML+I+WIR+N E  D  L +R +EP S  I  LD++ R +   I++ +  R   S  +G 
Sbjct: 1   MLNIKWIRENQELFDEKLSQRFIEPMSSKIAMLDQEKRKITSLIQEFQHARKVKSKILGN 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +++      + L+ + + + E+L  LE +  +  + L +L++ +PN+P EEVP G   +
Sbjct: 61  MVSKSGEEF-EELQRDVNHINEKLAELE-QNLDNNNELNELLNMLPNIPDEEVPYGIDGS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N L+R+ GK  +   L+++HFE+G  L LMDF++  K+SG+RF  L G LA LERAL  
Sbjct: 119 MNKLVRAYGKT-NKNALNKQHFELGTKLNLMDFEQTAKISGSRFVTLKGDLAKLERALIN 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMID+HT E  + E+S P LVRD AMY  GQ+PKF+++ F TT+G  LIPT+EVSL N+ 
Sbjct: 178 FMIDIHTKEFDFFEISPPFLVRDRAMYNAGQLPKFSEESFITTNGYRLIPTAEVSLVNIV 237

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           +  II+ + LP+R+      FRSEAGS+GRDTRGM+R HQF K ELVSIT  E+S  EHE
Sbjct: 238 ADTIIQREKLPMRYVAYTTCFRSEAGSSGRDTRGMIRLHQFGKVELVSITTPEESKNEHE 297

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
            + + +E ILK+LDL YRV+ LCTGD+GF+A KTYD+EVWL GQN YREI+SCS CG+FQ
Sbjct: 298 YITNASETILKKLDLPYRVMLLCTGDMGFAAKKTYDIEVWLPGQNQYREIASCSNCGDFQ 357

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM +RY++  S      HTLN SG+ +GR ++AILENY N DGS+TIP VL  YM  L
Sbjct: 358 ARRMKARYKEFGSNETTLVHTLNASGLPIGRTIVAILENYQNNDGSITIPDVLINYMGGL 417

Query: 421 AVI 423
             I
Sbjct: 418 QKI 420


>gi|224826934|ref|ZP_03700033.1| seryl-tRNA synthetase [Lutiella nitroferrum 2002]
 gi|224600921|gb|EEG07105.1| seryl-tRNA synthetase [Lutiella nitroferrum 2002]
          Length = 428

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 208/426 (48%), Positives = 282/426 (66%), Gaps = 11/426 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R  PE +   L  R  +  ++    L+ + + L  ++++++ARRN+ S QIG+
Sbjct: 1   MLDIQLLRSQPETVAERLAARGYQLDTDAFGQLENERKALQTRMQELQARRNATSKQIGE 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A  +G    V A+  E +TL ++L   E     V   L+  +  IPN+P   VP G   +
Sbjct: 61  AKRKGED--VSAIMAEVATLGDELKAAEAAFEAVQQKLEHWLMTIPNLPHASVPQGKDES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R VG   S    +++H ++G  LGL DF+   KLSGARF+VL G +A L RAL Q
Sbjct: 119 ANVEVRRVGVPRSFEFEAKDHVDVGSPLGL-DFETGAKLSGARFTVLRGEIAQLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM++ HT++HGYTE+  P +V D  ++GTGQ+PKFA+DMF  T G       ++LI TSE
Sbjct: 178 FMLNTHTNQHGYTEMYTPYIVNDSVLFGTGQLPKFAEDMFKVTRGGEEGAVDQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           ++LTN     I++   LP++ T  +P FRSEAGS GRDTRGM+RQHQF K E+V +   E
Sbjct: 238 ITLTNTVRESILKLDELPVKMTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQVVHPE 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVWL  QN YREISSC
Sbjct: 298 KSYDALEEMVGHAEAILKALELPYRVITLCTGDMGFGAAKTYDLEVWLPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C  FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LENY NADGSVT+PTVL
Sbjct: 358 SNCEAFQARRMQARFKDENGKN-QLVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPTVL 416

Query: 414 RPYMNN 419
           RPY+  
Sbjct: 417 RPYLGG 422


>gi|239946845|ref|ZP_04698598.1| seryl-tRNA synthetase [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921121|gb|EER21145.1| seryl-tRNA synthetase [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 425

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 211/424 (49%), Positives = 288/424 (67%), Gaps = 5/424 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           ML+I+WIR+N E  D  L +R +EP S  I  LD + R +   I++ +  R   S  +G 
Sbjct: 1   MLNIKWIRENQELFDEKLSQRFIEPMSSKIAMLDGEKRKITSLIQEFQHARKVKSKILGN 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +A  +    + L+ +   + E+L  LE ++    + L +L++ +PN+P EEVP G   +
Sbjct: 61  -MASKSGEEFEGLQRDVKHINEKLEELE-QDLNNNNELNELLNMLPNIPDEEVPYGIDES 118

Query: 121 ENILIRSVGK-KPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            N L+R+ G+  P+A  L+++HFE+G  L LMDF++  K+SGARF  L G LA LERAL 
Sbjct: 119 MNKLVRTYGETNPNA--LNKQHFELGTKLNLMDFEQTAKISGARFVTLKGDLAKLERALI 176

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNL 239
            FMID+HT E  + E+S P+LVRD AMY  GQ+PKFA++ F TT+G  LIPT+EVSL N+
Sbjct: 177 NFMIDVHTKEFDFFEISPPILVRDNAMYNAGQLPKFAEESFATTNGYRLIPTAEVSLVNI 236

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
            +  II  + LP+R+    P FRSEAGS+ RDTRGM+R HQF K ELVSIT +E+S TEH
Sbjct: 237 VADTIIPREKLPMRYVAYTPCFRSEAGSSSRDTRGMIRLHQFGKVELVSITTQEESKTEH 296

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E + + +E IL++L+L YRV+ LCTGD+GF+A KTYD+EVWL GQ  YREI+SCS CG+F
Sbjct: 297 EYITNASETILQKLNLPYRVMLLCTGDMGFAAKKTYDIEVWLPGQKQYREIASCSNCGDF 356

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RRM +RY++  S      HTLN SG+ +GR ++AILENY N DGS+TIP VL  YM  
Sbjct: 357 QARRMKARYKEFGSNETTLVHTLNASGLPIGRTMVAILENYQNEDGSITIPDVLINYMGG 416

Query: 420 LAVI 423
           L  I
Sbjct: 417 LQKI 420


>gi|255262643|ref|ZP_05341985.1| seryl-tRNA synthetase [Thalassiobium sp. R2A62]
 gi|255104978|gb|EET47652.1| seryl-tRNA synthetase [Thalassiobium sp. R2A62]
          Length = 430

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 207/429 (48%), Positives = 272/429 (63%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP   D AL +R   P S  +L LDE  R +I   E  +A +N  S ++G 
Sbjct: 1   MHDIRTIRDNPAAFDAALSRRGDAPMSSQVLELDEARRAMILAAETAQAEQNKASKEVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G+ +  + L+   +  K Q+  L ++     + L  L++ IPN+P E+VP G    
Sbjct: 61  AKGRGDDAEFERLRALVAEKKAQVAQLNEDAKTKDAELTDLLAVIPNLPYEDVPDGADEG 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ I   G   +      EHFEI      MDF+ A K+SG+RF +L+G +A + RA+ Q
Sbjct: 121 YNVEINRWGTPRAFDFKPVEHFEIAGVASSMDFETAAKMSGSRFVLLSGAVARVNRAIAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMID H  ++G  E   P+LVRDEAMYGT ++PKF +D + TT+G WL+PTSEV LT + 
Sbjct: 181 FMIDTHVDKNGLIETVPPVLVRDEAMYGTDKLPKFGEDSYRTTEGMWLVPTSEVPLTYIA 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + E+IE   LP R+T     FRSEAGSAGRDT GMLRQHQF K E+VS+T  + S  E +
Sbjct: 241 AGEMIEQSYLPRRYTAHTLCFRSEAGSAGRDTSGMLRQHQFEKVEMVSVTHPDASDDEQK 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML CAE IL+ L + YR V LCTGD+GF A +TYD+E WL GQ+ YREISS ST G+FQ
Sbjct: 301 RMLGCAEGILEALKIPYRTVILCTGDMGFGARRTYDIEAWLPGQDAYREISSVSTTGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++       +F HTLNGSG+AVGRCLIA+LEN   ADGSVT+P  L PY+   
Sbjct: 361 ARRMNARFKPEGGGKPQFVHTLNGSGLAVGRCLIAVLENGQQADGSVTLPDALAPYLGGK 420

Query: 421 AVIKKEHIL 429
             I  E +L
Sbjct: 421 TSITVEGVL 429


>gi|89071126|ref|ZP_01158326.1| seryl-tRNA synthetase [Oceanicola granulosus HTCC2516]
 gi|89043337|gb|EAR49559.1| seryl-tRNA synthetase [Oceanicola granulosus HTCC2516]
          Length = 429

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 212/429 (49%), Positives = 282/429 (65%), Gaps = 1/429 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+ P   D AL +R L P S  IL++DE  R  I+  E  +A  N  + +IG 
Sbjct: 1   MHDIRAIRETPGAFDAALSRRGLAPVSSEILAIDEARRAKIQAAETAQAEANRAAKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  + L+ E +  K  +  L  E     + L +L+  +PN+P + +P G   +
Sbjct: 61  AKARGDDAAFERLRAEVADKKAAIARLNDEAKAEDARLTELLLGLPNLPDDSIPDGDDED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G   +     +EH+EI  A G +DF+ A  LSG+RF VL G +A L RAL Q
Sbjct: 121 DNVELRRTGSPRNFSFTPKEHYEIPAARGGLDFETAATLSGSRFVVLKGAMARLHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D+HT EHG TE+  P+LVR+E MYGTGQ+PKF +D + TT+G WLIPTSEV+LTN+ 
Sbjct: 181 FMLDVHTEEHGLTEMITPVLVREEMMYGTGQLPKFGEDSYQTTNGWWLIPTSEVTLTNVV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             +++E+++LP+R  +    FRSEAGSAGRDT GMLRQHQF K E+VSITR EDS  EHE
Sbjct: 241 HGKLLEAEALPIRMASHTQCFRSEAGSAGRDTSGMLRQHQFEKVEMVSITRPEDSAAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM   AE IL +L L YR V LCTGDLG    KT+D+EVWL GQ+ YREISS S  G++Q
Sbjct: 301 RMTRQAEAILDKLGLPYRTVVLCTGDLGAGMRKTHDIEVWLPGQDRYREISSVSVAGDYQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYRD + K  +F HTLNGSG+AVGR LIA+LEN    DGSV +P  L  Y+   
Sbjct: 361 ARRMNARYRDEDGKP-RFVHTLNGSGLAVGRTLIAVLENGQQDDGSVELPEALYRYLGGR 419

Query: 421 AVIKKEHIL 429
             +  + +L
Sbjct: 420 TRVTADGVL 428


>gi|126739018|ref|ZP_01754712.1| seryl-tRNA synthetase [Roseobacter sp. SK209-2-6]
 gi|126719635|gb|EBA16343.1| seryl-tRNA synthetase [Roseobacter sp. SK209-2-6]
          Length = 430

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 207/429 (48%), Positives = 283/429 (65%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D AL +R     S  IL+LDE+ R  I++ E  +A +N  + +IG 
Sbjct: 1   MHDIRAIRENPAAFDAALARRGDAGVSSEILALDEERRAKIQEAEAAQAAQNKAAKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+    + L+ E +  K ++  L+    E+ +    +++ I N+P  +VP G   +
Sbjct: 61  AKAKGDNETFERLRAEVAEKKSEVAALQNAAKELDAKQTDILARIANLPAADVPEGADED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G        ++EHFEI      MDF+ A K SGARF  L G +A + RAL Q
Sbjct: 121 DNVEVNRWGTPAELDFDAKEHFEITGVAANMDFETAAKTSGARFVFLKGGVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H  E+G TEV  P+LVRDEAMYGT ++PKF DD + TT+G WL+PTSEV+LT   
Sbjct: 181 FMVDTHVDENGLTEVQTPVLVRDEAMYGTDKLPKFGDDSYQTTNGWWLVPTSEVTLTYSV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + ++++++ LP+R T     FRSEAGSAG+DT GMLRQHQF K E+VSITR ++S  E +
Sbjct: 241 AGDVLDARDLPIRMTAHTQCFRSEAGSAGKDTSGMLRQHQFEKVEMVSITRPDESDNEQK 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML CAE +L++LD+ YR V LCTGD+GF A +TYD+E WL GQ+ YREISS ST G+FQ
Sbjct: 301 RMLRCAEGLLEKLDVPYRTVVLCTGDMGFGARRTYDIEAWLPGQDTYREISSVSTTGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R+R       +F HTLNGSG+AVGRCLIA+LEN   ADGSV +P VL PY+   
Sbjct: 361 ARRMNARFRPEEGAKPEFVHTLNGSGLAVGRCLIAVLENGQQADGSVKLPEVLSPYLGGK 420

Query: 421 AVIKKEHIL 429
             +  E +L
Sbjct: 421 LTLTAEGVL 429


>gi|294101987|ref|YP_003553845.1| seryl-tRNA synthetase [Aminobacterium colombiense DSM 12261]
 gi|293616967|gb|ADE57121.1| seryl-tRNA synthetase [Aminobacterium colombiense DSM 12261]
          Length = 423

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/425 (47%), Positives = 283/425 (66%), Gaps = 3/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           ML+I+WIR N E +   L  R+ +   + I+ LDE+ R L+ + E+++A+RN  S ++ +
Sbjct: 1   MLEIKWIRNNIEEVKAFLVNRNNDFDVDRIVILDEEKRSLLTETENLKAQRNEGSRKVAE 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G  +  D L  E   L + +   + +  E+   L+ L+  +PN P + VP+G   N
Sbjct: 61  AKASGQDA--DVLMEEMKNLGQMVKEKDSKIAEIDQELQSLLLQMPNRPHDSVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G     +   + H++IGE LG++DF++   L+ +RF+VL G  A LERAL  
Sbjct: 119 DNMEVRKWGTPKEFVFEPQAHWDIGEKLGILDFEKGVSLAESRFTVLKGAGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGRWLIPTSEVSLTNL 239
           FM+DLHT  HGY E+  P +V  + M GTGQ+PKFA+D++ C  +  WLIPT+EV LTNL
Sbjct: 179 FMLDLHTEHHGYKEIQPPFMVSSQTMQGTGQLPKFAEDLYKCEGEDLWLIPTAEVPLTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +S EI+  + LPL +T   P FR EAGS GRD RGM+RQHQF K ELV I++ E+S+ E 
Sbjct: 239 HSGEILPEEVLPLYYTAYTPCFRKEAGSYGRDVRGMMRQHQFDKVELVKISKPENSYDEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++ + AEE+L++L L YRV++LCTGD+GF A KTYDLEVWL  Q+ YREISSCS C +F
Sbjct: 299 EKLTANAEEVLQKLGLPYRVITLCTGDMGFGASKTYDLEVWLPFQDKYREISSCSNCEDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RRM +RY+  +    ++ HTLNGSG+AVGR LIA+LENY   DGSV IP  L PYM  
Sbjct: 359 QARRMGTRYKPADGGRPRYVHTLNGSGIAVGRTLIAVLENYQREDGSVEIPEALVPYMGG 418

Query: 420 LAVIK 424
           +  I+
Sbjct: 419 MKEIR 423


>gi|126725452|ref|ZP_01741294.1| seryl-tRNA synthetase [Rhodobacterales bacterium HTCC2150]
 gi|126704656|gb|EBA03747.1| seryl-tRNA synthetase [Rhodobacterales bacterium HTCC2150]
          Length = 430

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 207/429 (48%), Positives = 278/429 (64%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP   D  L +R   P S  IL++DE  R  I+  E   A RN+ S Q+G 
Sbjct: 1   MHDIRAIRANPAEFDQQLARRGKSPMSADILAIDEARRAKIQAAETALADRNAASKQVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+ +  + L+   S  K+++  L+       + L  L+  I N+P ++VP+G+  +
Sbjct: 61  AKAKGDEAEFERLRALVSAKKDEIAELDAASKAEDARLNDLLMSIDNIPFDDVPVGSDED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ I   G+ P       EHFEIG     MDF+ A K+SG+RF +++G +A + RAL Q
Sbjct: 121 ANVEINRNGEPPRMNFTPVEHFEIGGVKSGMDFETAGKISGSRFVIMSGAVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D HT+E+  TEV+ P+LVR EAM GTGQ+PKFA+D + TT+G WLIPTSEV+LTN+ 
Sbjct: 181 FMLDTHTTENDLTEVNTPVLVRTEAMTGTGQLPKFAEDSYQTTNGWWLIPTSEVTLTNIV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           S   +E   LP R+   +  FRSEAGSAGRDT GMLRQHQF K E+VS+T  ++S  E +
Sbjct: 241 SGLTVEESYLPRRYVAHSLCFRSEAGSAGRDTSGMLRQHQFEKVEMVSVTHPDNSRAELD 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE IL+ L L YR V LCTGD+GF A +T+D+EVWL GQ+ YREISS S CG+FQ
Sbjct: 301 RMTRCAEGILEALGLAYRTVVLCTGDMGFGARRTHDIEVWLPGQDTYREISSVSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++       +F HTLNGSG+AVGRCLIA+LEN    DGSV +P  L  ++   
Sbjct: 361 ARRMNARFKPSEGGKPEFVHTLNGSGLAVGRCLIAVLENGQQEDGSVKLPAALHGHLGGK 420

Query: 421 AVIKKEHIL 429
             +  E  L
Sbjct: 421 TTLTPEGTL 429


>gi|157827781|ref|YP_001496845.1| seryl-tRNA synthetase [Rickettsia bellii OSU 85-389]
 gi|166223280|sp|A8GY58|SYS_RICB8 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|157803085|gb|ABV79808.1| seryl-tRNA synthetase [Rickettsia bellii OSU 85-389]
          Length = 426

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 208/423 (49%), Positives = 280/423 (66%), Gaps = 2/423 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           ML+I+WIR+N E  D  L++R +EP ++ I  LD K R +   I++ +  R   S  +G 
Sbjct: 1   MLNIKWIRENQELFDDKLRQRFIEPMAKRIEELDGKKRKITNLIQEFQHARKVKSKILGN 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            I   +    + L+ +   + E+L  LE++ +      + L + +PN+P EEVP G   +
Sbjct: 61  -INPKSGEEFEGLQRDVKDINEKLEELEQDLNNNNELNELLNT-LPNIPDEEVPYGIDES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N LIR+ G+        ++HFE+G  L LMDF++  K+SGARF  L G LA LERAL  
Sbjct: 119 MNKLIRTHGEVDLNAQNKKQHFELGVKLDLMDFEQTAKISGARFVTLKGDLAKLERALAN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D+HT E G+ EVS P+LVRD AMY +GQ+PKFAD+ F TT+G  LIPT+EVSL N+ 
Sbjct: 179 FMLDVHTGEFGFLEVSPPVLVRDNAMYNSGQLPKFADESFATTNGYRLIPTAEVSLVNMV 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           +  II  + LP+R     P FRSEAGS+GRDTRGM+R HQF K ELVSIT  E+S  EHE
Sbjct: 239 ADTIIPREKLPMRLVAYTPCFRSEAGSSGRDTRGMIRLHQFSKVELVSITTPEESKNEHE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
            M + +E IL++L L YR + LCTGD+GF++ KTYD+EVWL GQ  YREI+SCS CG+FQ
Sbjct: 299 YMTNASETILQKLGLPYRTMLLCTGDMGFASQKTYDIEVWLPGQKQYREIASCSNCGDFQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM +RY++  S      HTLN SG+ +GR ++AILENY N DGS+T+P VL  YM  L
Sbjct: 359 ARRMKARYKEFGSHDTTLVHTLNASGLPIGRTMVAILENYQNEDGSITVPDVLVNYMGGL 418

Query: 421 AVI 423
             I
Sbjct: 419 QKI 421


>gi|260428621|ref|ZP_05782600.1| seryl-tRNA synthetase [Citreicella sp. SE45]
 gi|260423113|gb|EEX16364.1| seryl-tRNA synthetase [Citreicella sp. SE45]
          Length = 430

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 200/419 (47%), Positives = 276/419 (65%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D AL +R +  QS  IL++DE+ R  I   E  +A +N  S ++G+
Sbjct: 1   MHDIRAIRENPAAFDAALSRRGMPSQSPAILAMDEERRAAIHAAETAQAEQNKASKEVGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  + L+      K ++  ++    E+ + L +L+  +PN+P ++ P G    
Sbjct: 61  AKASGDEAEFERLRALVGEKKAEVAEMQTRAKELDAQLAELLMGLPNLPFDDTPDGADEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I   G   +     +EH+E+   +  MDF+ A KLSGARF VL+G +A + RAL Q
Sbjct: 121 DNVEIHRWGTPATLDFTPKEHYELPGVVKGMDFETAAKLSGARFVVLSGAVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H  E+G TE   P+LVR+E MYGTGQ+PKF DD + T +G WL+PT+EV+LTN+ 
Sbjct: 181 FMLDTHVEENGLTETWTPVLVREEMMYGTGQLPKFGDDSYQTREGWWLVPTAEVTLTNIV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           +   ++  +LP R+      FRSEAGSAGRDT GMLRQHQF K E+VSIT  + S  E +
Sbjct: 241 NGLTVDEDTLPRRYVAHTQCFRSEAGSAGRDTAGMLRQHQFEKVEMVSITHPDKSRDELD 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CA+ IL++L L YR V+LCTGD+GF A +T+DLEVWL GQN YREISS S CG+FQ
Sbjct: 301 RMTGCAQGILEKLGLPYRTVALCTGDIGFGARRTHDLEVWLPGQNTYREISSVSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           +RRMN+R++        F HTLNGSG+AVGRCLIA+LEN   ADGSV +P  L+P++  
Sbjct: 361 ARRMNARFKPTAGGKPDFVHTLNGSGLAVGRCLIAVLENGQQADGSVRLPEALQPWLGG 419


>gi|51473951|ref|YP_067708.1| seryl-tRNA synthetase [Rickettsia typhi str. Wilmington]
 gi|67461735|sp|Q68VW6|SYS_RICTY RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|51460263|gb|AAU04226.1| SerRS [Rickettsia typhi str. Wilmington]
          Length = 425

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 209/423 (49%), Positives = 286/423 (67%), Gaps = 3/423 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           ML+I+WIR+N E  D  L +R +EP S  I  LD + R +   I++ +  R   S  +G 
Sbjct: 1   MLNIKWIRENQELFDEKLSQRFIEPMSSKIAMLDREKRKITSLIQEFQHARKVKSKILGN 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +++      + L+ + + + E+L  LE +  +  + L +L++ +PN+P EEVP G   +
Sbjct: 61  MVSKSGEEF-EELQRDVNHINEKLEELE-QTLDNNNELNELLNMLPNIPDEEVPYGIDES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N L+RS G   +   L+++HFE+G  L LMDF++  K+SG+RF  L G LA LERAL  
Sbjct: 119 MNKLVRSYGNT-NKNALNKQHFELGTKLNLMDFEQTAKISGSRFVTLKGDLAKLERALIN 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D+HT E  + E+S PLLVRD AMY  GQ+PKF+++ F TT+G  LIPT+EVSL N+ 
Sbjct: 178 FMVDIHTKEFDFFEISPPLLVRDSAMYNAGQLPKFSEESFITTNGYRLIPTAEVSLVNIV 237

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           +  II+ + LP+R+      FRSEAGS+GRDTRGM+R HQF K ELVSIT  E+S  EHE
Sbjct: 238 ADTIIQREKLPMRYVAYTTCFRSEAGSSGRDTRGMIRLHQFGKVELVSITTPEESKNEHE 297

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
            + + +E ILK+LDL YRV+ LCTGD+GF+A KTYD+EVWL GQN YREI+SCS CG+FQ
Sbjct: 298 YITNASETILKKLDLPYRVMLLCTGDMGFAAKKTYDIEVWLPGQNQYREIASCSNCGDFQ 357

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM +RY++  S      HTLN SG+ +GR ++AILENY N DGS+TIP VL  YM  L
Sbjct: 358 ARRMKARYKEFGSNETTLVHTLNASGLPIGRTIVAILENYQNNDGSITIPDVLINYMGGL 417

Query: 421 AVI 423
             I
Sbjct: 418 KKI 420


>gi|254438860|ref|ZP_05052354.1| seryl-tRNA synthetase [Octadecabacter antarcticus 307]
 gi|198254306|gb|EDY78620.1| seryl-tRNA synthetase [Octadecabacter antarcticus 307]
          Length = 430

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 204/426 (47%), Positives = 279/426 (65%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D AL +R   P S  ++++DE  R +I   E  +A  N  + ++G 
Sbjct: 1   MHDIRTIRENPAAFDAALSRRGDAPLSAELVAMDEARRAMILTAETAQADANKAAKEVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G+    + L+   S  K Q+  L  E     ++L   ++ IPN+P ++VP+GT  N
Sbjct: 61  AKGRGDDVEFERLRALVSKKKSQIAELNDEAKAQGAALTARLAMIPNLPADDVPMGTDEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I   G   +      EHF+I      MDF+ A K+SG+RF +++G +A L RAL Q
Sbjct: 121 DNVEISRWGTPRAFDFTPTEHFDIAAVKPGMDFEAAAKISGSRFVLMSGAIARLHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D+HT E+  TE++ P+LVRD+AMYGT ++PKFA D + TT+G WLI TSE+ LT + 
Sbjct: 181 FMLDIHTVENNLTEMNTPVLVRDDAMYGTDKLPKFAGDSYQTTEGMWLISTSEIPLTYIA 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EII++ +LP R+T     FRSEAGSAGRDT GMLRQHQF K E+VS+T  + S  E +
Sbjct: 241 AGEIIDAATLPRRYTAHTLCFRSEAGSAGRDTSGMLRQHQFEKVEMVSVTHPDASDAEQK 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML CAE +L+RL++ YR V LCTGD+GF A +T+D+E WL GQN YREISS ST G FQ
Sbjct: 301 RMLRCAENLLERLEIPYRTVLLCTGDMGFGARRTFDIEAWLPGQNAYREISSVSTTGEFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++  +    +F HTLNGSG+AVGRCLIA+LEN   ADGSV IPT L  +M   
Sbjct: 361 ARRMNARFKPADGGKPQFVHTLNGSGLAVGRCLIAVLENGQQADGSVIIPTALHGHMGGK 420

Query: 421 AVIKKE 426
             I  +
Sbjct: 421 TKINAD 426


>gi|67459641|ref|YP_247265.1| seryl-tRNA synthetase [Rickettsia felis URRWXCal2]
 gi|75535963|sp|Q4UK35|SYS_RICFE RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|67005174|gb|AAY62100.1| Seryl-tRNA synthetase [Rickettsia felis URRWXCal2]
          Length = 425

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 211/424 (49%), Positives = 287/424 (67%), Gaps = 5/424 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           ML+I+WIR+N E  D  L +R +EP S  I  LD + R +   I++ +  R   S  +G 
Sbjct: 1   MLNIKWIRENQELFDEKLSQRFIEPMSSKIAMLDGEKRKITCLIQEFQHARKVKSKILGN 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +A  +    + L+ +   + E+L  LE ++    + L +L++ +PN+P EEVP G   +
Sbjct: 61  -MASKSGEEFEGLQRDVKHINEKLEELE-QDLNNNNELNELLNMLPNIPDEEVPYGMDES 118

Query: 121 ENILIRSVGK-KPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            N L+R+ G+  P+A  L+++HFE+G  L LMDF++  K+SGARF  L G LA LERAL 
Sbjct: 119 MNKLVRTYGETNPNA--LNKQHFELGTKLNLMDFEQTAKISGARFVTLKGDLAKLERALI 176

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNL 239
            FMID+HT E  + E+S P+LVRD AMY  GQ+PKFA++ F TT+G  LIPT+EVSL N+
Sbjct: 177 NFMIDVHTKEFDFFEISPPVLVRDNAMYNAGQLPKFAEESFATTNGYRLIPTAEVSLVNI 236

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
            +  II  + LP+R+    P FRSEAGS+GRDTRGM+R HQF K ELVSIT  E+S  EH
Sbjct: 237 VADTIIPREKLPMRYVAYTPCFRSEAGSSGRDTRGMIRLHQFGKVELVSITTTEESKNEH 296

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E + + +E IL++L+L YRV+ LCTGD+GF+A KTYD+EVWL GQ  YREI+SCS CG+F
Sbjct: 297 EYITNASETILQKLNLPYRVMLLCTGDMGFAAKKTYDIEVWLPGQKQYREIASCSNCGDF 356

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RRM +RY++  S      HTLN SG+ +GR ++AILENY N DGS+TIP VL  YM  
Sbjct: 357 QARRMKARYKEFGSNETTLVHTLNASGLPIGRTMVAILENYQNEDGSITIPDVLINYMGG 416

Query: 420 LAVI 423
           L  I
Sbjct: 417 LQKI 420


>gi|99080835|ref|YP_612989.1| seryl-tRNA synthetase [Ruegeria sp. TM1040]
 gi|123077692|sp|Q1GHY9|SYS_SILST RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|99037115|gb|ABF63727.1| seryl-tRNA synthetase [Ruegeria sp. TM1040]
          Length = 430

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 207/429 (48%), Positives = 282/429 (65%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D AL +R     S  +L LDE  R  I   E  +A +N  +  IG 
Sbjct: 1   MHDIRAIRENPAAFDAALARRGDSALSSQVLELDEARRAKILAAETAQADQNKAAKAIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+ +  + L+ E +  K ++  ++ E  E+ + L  +++ IPN P E+VP G   +
Sbjct: 61  AKAKGDEAEFERLRAEVADKKAEVAAMQAEAKELDAKLTDMLARIPNSPAEDVPDGADED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ ++  G  P+     +EHFEI      MDF+ A K+SG+RF VL G +A + RAL Q
Sbjct: 121 DNVEVKRWGDVPAFDFDPKEHFEIAGVAKAMDFETAAKISGSRFVVLKGAVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H  E+G TEV++P+LVRDEAMYGT ++PKF +D + TT+G WL+PTSEV LT   
Sbjct: 181 FMVDTHVDENGLTEVNSPVLVRDEAMYGTDKLPKFGEDSYQTTNGWWLVPTSEVPLTYSV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + ++I+  +LP+R+T     FRSEAGSAG+DT GMLRQHQF K E+VSI   E S  E +
Sbjct: 241 AGDVIDEAALPIRYTAHTLCFRSEAGSAGKDTSGMLRQHQFEKVEMVSIVHPETSDEEQK 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML CAE IL++L + YR V LCTGD+GF A +TYD+E W+ GQN YREISS ST G+FQ
Sbjct: 301 RMLGCAEGILEKLGIPYRTVVLCTGDMGFGARRTYDIEAWVPGQNTYREISSVSTTGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++  +    +F HTLNGSG+AVGRCLIA+LEN   ADGSV +P  L PY+   
Sbjct: 361 ARRMNARFKPADGGKPEFLHTLNGSGLAVGRCLIAVLENGQQADGSVKLPDALAPYLGGK 420

Query: 421 AVIKKEHIL 429
             +  E  L
Sbjct: 421 LTLTAEGQL 429


>gi|34581191|ref|ZP_00142671.1| seryl-tRNA synthetase [Rickettsia sibirica 246]
 gi|28262576|gb|EAA26080.1| seryl-tRNA synthetase [Rickettsia sibirica 246]
          Length = 425

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 210/424 (49%), Positives = 287/424 (67%), Gaps = 5/424 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           ML+I+WIR+N E  D  L +R +EP S  I  LD + R +   I++++  R   S  +G 
Sbjct: 1   MLNIKWIRENKELFDEKLSQRFIEPMSSKIAMLDGEKRKITSLIQELQHARKVKSKILGN 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +A  +    + L+ +   + E+L  LE ++    + L +L++ +PN+P EEVP G   +
Sbjct: 61  -MASKSGEEFEGLQRDVKHINEKLEALE-QDLNNNNELNELLNMLPNIPDEEVPYGMDES 118

Query: 121 ENILIRSVGK-KPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            N L+R+ G+  P+A  L+++HFE+G  L LMDF++  K+SG RF  L G LA LERAL 
Sbjct: 119 MNKLVRTYGETNPNA--LNKQHFELGIKLNLMDFEQTAKISGTRFVTLKGDLAKLERALI 176

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNL 239
            FMID+HT E  + E+S P+LVRD AMY  GQ+PKFA++ F TT+G  LIPT+EVSL N+
Sbjct: 177 NFMIDVHTKEWDFFEISPPVLVRDNAMYNAGQLPKFAEESFATTNGYRLIPTAEVSLINM 236

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
            +  II  + LP+R+    P FRSEAGS+GRDTRGM+R HQF K ELVSIT  E+S  EH
Sbjct: 237 VADTIIPREKLPIRYVAYTPCFRSEAGSSGRDTRGMIRLHQFGKVELVSITTPEESTNEH 296

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E + + +E IL++L+L YRV+ LCTGD+GF+A KTYD+EVWL GQ  YREI+SCS CG+F
Sbjct: 297 EYITNASETILQKLNLPYRVMLLCTGDMGFAAKKTYDIEVWLPGQKQYREIASCSNCGDF 356

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RRM +RY++  S      HTLN SG+ +GR ++AILENY N DGS+TIP VL  YM  
Sbjct: 357 QARRMKARYKEFGSNETTLVHTLNASGLPIGRTMVAILENYQNEDGSITIPDVLINYMGG 416

Query: 420 LAVI 423
           L  I
Sbjct: 417 LQKI 420


>gi|157826236|ref|YP_001493956.1| seryl-tRNA synthetase [Rickettsia akari str. Hartford]
 gi|166223279|sp|A8GPX3|SYS_RICAH RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|157800194|gb|ABV75448.1| seryl-tRNA synthetase [Rickettsia akari str. Hartford]
          Length = 425

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 211/424 (49%), Positives = 287/424 (67%), Gaps = 5/424 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           ML I+WIR+N E  D  L KR +EP S  I  LD + R +   I++ +  R   S  +G 
Sbjct: 1   MLSIKWIRENQELFDEKLSKRFIEPMSSKIAMLDGEKRKITSLIQEFQHARKVKSKILGN 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +A  +    +A++ +   + E+L  LE ++    + L +L++ +PN+P EEVP G   +
Sbjct: 61  -MASKSGEEFEAIQRDVKHINEKLEELE-QDLNNNNELNELLNMLPNIPDEEVPYGMDES 118

Query: 121 ENILIRSVGK-KPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            N L+R+ G+  P+A  L+++HFE+G  L LMDF++  K+SGARF  L G LA LERAL 
Sbjct: 119 MNKLVRTYGETNPNA--LNKQHFELGTKLNLMDFEQTAKISGARFVTLKGDLAKLERALI 176

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNL 239
            FMID+HT E  + E+S P+LVRD AMY +GQ+PKFA++ F TT+G  LIPT+EV L N+
Sbjct: 177 NFMIDVHTKEFNFFEMSPPVLVRDNAMYNSGQLPKFAEESFATTNGYRLIPTAEVFLVNI 236

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
            +  II  + LP+R+    P FRSEAGS+GRDTRGM+R HQF K ELVSIT  E+S  EH
Sbjct: 237 VADTIIPREKLPMRYVAYTPCFRSEAGSSGRDTRGMIRLHQFGKVELVSITTPEESKHEH 296

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E + + +E IL++L+L YRV+ LCTGD+GF+A KTYD+EVWL GQ  YREI+SCS CG+F
Sbjct: 297 EYITNSSETILQKLNLPYRVMLLCTGDMGFAAKKTYDIEVWLPGQKQYREIASCSNCGDF 356

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RRM +RY++  S      HTLN SG+ +GR ++AILENY N DGS+TIP VL  YM  
Sbjct: 357 QARRMKARYKEFGSNETTLVHTLNASGLPIGRTMVAILENYQNEDGSITIPDVLINYMGG 416

Query: 420 LAVI 423
           L  I
Sbjct: 417 LQKI 420


>gi|288574952|ref|ZP_06393309.1| seryl-tRNA synthetase [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288570693|gb|EFC92250.1| seryl-tRNA synthetase [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 425

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 200/424 (47%), Positives = 278/424 (65%), Gaps = 3/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+++R + + +   LK R+ +   + IL LD K R LI ++E+++A RN+ S ++G 
Sbjct: 1   MLDIKYVRDHMDEVRDFLKARNHDFNLDSILELDAKRRELISEVEELKAERNAGSKKVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G      A+      + E++  L+++  EV + L  L+  +PN P + VP+G   +
Sbjct: 61  AKAKGEDPT--AIMERMKAIGEEIKALDQKVAEVDAGLDDLMLQVPNRPHDSVPVGVDED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G           H+++GE LG++DF R  KL+ +RF+V+ G  A LERAL  
Sbjct: 119 DNVEVRKWGDPREFDFEPLPHWDLGENLGILDFKRGVKLAQSRFTVMAGPGARLERALLN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGRWLIPTSEVSLTNL 239
           FM+DLH   HGY E++ P +V    M GTGQ+PKFADD++    D  WLIPT+EV LTNL
Sbjct: 179 FMLDLHVDRHGYKEINPPFMVNSATMTGTGQLPKFADDLYRIADDDLWLIPTAEVPLTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +  EI+E   LPL +T   P FR EAGS GRD RG++RQHQF K E+V ++  E+S+ E 
Sbjct: 239 HGGEIMEESDLPLYYTAYTPCFRKEAGSHGRDVRGIMRQHQFEKVEMVKLSTPENSYEEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++ S AEE+L+ L L YRV++LCTGD+GF A KTYD+EVWL  Q  YREISSCS C +F
Sbjct: 299 EKLTSNAEEVLQLLKLPYRVITLCTGDMGFGASKTYDIEVWLPSQGRYREISSCSNCEDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RRMN+RYR       +F HTLNGSG+A+GR LIA++ENY   DGS+ IP VL PYM  
Sbjct: 359 QARRMNTRYRPSQGGKPRFVHTLNGSGIAIGRALIAVMENYQRTDGSIEIPEVLVPYMGG 418

Query: 420 LAVI 423
           L  I
Sbjct: 419 LKEI 422


>gi|34496830|ref|NP_901045.1| seryl-tRNA synthetase [Chromobacterium violaceum ATCC 12472]
 gi|46577183|sp|Q7NY99|SYS_CHRVO RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|34102685|gb|AAQ59050.1| seryl-tRNA synthetase [Chromobacterium violaceum ATCC 12472]
          Length = 427

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 210/425 (49%), Positives = 277/425 (65%), Gaps = 11/425 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI  +R + E +   L  R     +     L+ + + L  ++++++A+RN+ S QIG 
Sbjct: 1   MLDINLLRNDIEAVAARLAGRGYTLDTAAFNQLESERKSLQSRMQELQAKRNATSKQIG- 59

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            IA+G    V A+  E +TL ++L   E+    V   L   +  IPN+P E VP+G   N
Sbjct: 60  -IAKGKGEDVSAILAEVATLGDELKAAEQAFDGVQGQLDAWLMSIPNLPHESVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R VG         ++H ++G  LGL DFD   KLSGARF+VL G +A L RA+ Q
Sbjct: 119 DNVEVRRVGVPRQFDFEVKDHVDVGAPLGL-DFDTGAKLSGARFTVLKGDIARLHRAIAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM++ HT  HGY E   P +V D A+ GTGQ+PKFADDMF  T G       ++LI TSE
Sbjct: 178 FMLNTHTGSHGYQEHYTPYIVNDTALLGTGQLPKFADDMFKVTRGGDESAVPQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  I++   LP + T  +P FRSEAGS GRDTRGM+RQHQF K E+V + + E
Sbjct: 238 VTLTNTVADTILQESELPKKMTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVRVEKPE 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF + KTYDLEVWL  QN YREISSC
Sbjct: 298 HSYAALEEMVGHAENILKALELPYRVITLCTGDMGFGSAKTYDLEVWLPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C  FQ+RRM +RY+D N K+ +  HTLNGSG+AVGR L+AILENY NADGSVT+PTVL
Sbjct: 358 SNCEAFQARRMKARYKDENGKN-QLVHTLNGSGLAVGRTLVAILENYQNADGSVTVPTVL 416

Query: 414 RPYMN 418
           RP+M 
Sbjct: 417 RPFMG 421


>gi|257417382|ref|ZP_05594376.1| seryl-tRNA synthetase [Enterococcus faecalis AR01/DG]
 gi|257159210|gb|EEU89170.1| seryl-tRNA synthetase [Enterococcus faecalis ARO1/DG]
          Length = 423

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 210/427 (49%), Positives = 286/427 (66%), Gaps = 7/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQ--SEYILSLDEKNRILIKKIEDIRARRNSNSAQI 58
           MLD++ +RQN + +   L+ R ++ +   E+ L LDE  R L+ K+E+++  RN  SA+I
Sbjct: 1   MLDVKMMRQNFDEVKAKLQTRGVKEEILVEF-LRLDESRRDLLVKVEEMKKYRNDVSAEI 59

Query: 59  GQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTS 118
            Q   + N     A   E   +   +  L+ E + +   L+ + + +PN+P + VP+G  
Sbjct: 60  AQL--KRNKEDATAKIAEMKEVGGNIKALDAEINAIDEELRGITTTLPNLPDDSVPVGAG 117

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
             EN+ +R   +  +     + H+E+ E LG++DF+R  K++G+RF    G  A LERAL
Sbjct: 118 EEENVEVRRWSEPRTFAFEPKPHWEVAENLGILDFERGAKVAGSRFVYYKGLGARLERAL 177

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLT 237
             FM+DLH  EHGYTE+  P +V D AM+GTGQ PKF +D+F   D    LIPT+EV LT
Sbjct: 178 YNFMLDLHVYEHGYTEMITPYIVNDTAMFGTGQFPKFKEDVFQLQDTDLTLIPTAEVPLT 237

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           N Y++EI++ K LP+ FT L+PSFRSEAGSAGRDTRG++R HQF K E+V  +  E S+ 
Sbjct: 238 NYYNNEILDGKDLPIYFTALSPSFRSEAGSAGRDTRGLIRLHQFNKVEMVKFSDAEHSYE 297

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E E+M + AEEIL++L L YRV++L TGD+GFSA KTYDLEVW+  Q  YREISSCS C 
Sbjct: 298 ELEKMTNNAEEILQKLGLPYRVMALSTGDMGFSAAKTYDLEVWIPAQETYREISSCSNCE 357

Query: 358 NFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +FQ+RR   RYRD N K +++THTLNGSG+AVGR + AILENY N DGSVT+P VL PYM
Sbjct: 358 DFQARRAMIRYRDENDK-VQYTHTLNGSGLAVGRTVAAILENYQNEDGSVTVPEVLVPYM 416

Query: 418 NNLAVIK 424
            NL VIK
Sbjct: 417 GNLTVIK 423


>gi|317154684|ref|YP_004122732.1| seryl-tRNA synthetase [Desulfovibrio aespoeensis Aspo-2]
 gi|316944935|gb|ADU63986.1| seryl-tRNA synthetase [Desulfovibrio aespoeensis Aspo-2]
          Length = 425

 Score =  411 bits (1057), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 200/426 (46%), Positives = 290/426 (68%), Gaps = 5/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++ +++ P+ +  +LKKR  +   +  L+LDE+ + LI + E ++A RN+   +I +
Sbjct: 1   MLDLKLMQKTPDLVRESLKKRGSKIDVQEFLTLDERRKSLIAEGETLKAERNAAGPEIAK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G  +   AL    + + E++  L+ E  EV ++ +  +  +PN+P E VP+G S  
Sbjct: 61  CKKSGQDA--SALLARMAEVSERVKTLDAELTEVETAERDWLMSVPNMPHESVPVGASEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N ++RS G+KP      +EH+E+G ALG +DF+RA KL+G+RF++  G  A LERAL Q
Sbjct: 119 DNPVVRSWGEKPVMDFEPKEHWELGTALGGLDFERAAKLAGSRFALSFGWCARLERALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG--RWLIPTSEVSLTN 238
           FM+D  T+ HGYTEV  P +V    M GTGQ+PKF +D+F   +G   +LIPT+EV LTN
Sbjct: 179 FMLDTQTTLHGYTEVIPPYIVNRRTMTGTGQLPKFEEDLF-KLEGVDSFLIPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           +Y+ E+I+  +LP++F    P FRSEAGS G+DT+G++R HQF K E+V+    + S+  
Sbjct: 238 IYAGEVIDEAALPVKFCAHTPCFRSEAGSYGKDTKGLIRLHQFHKVEMVNFAHPDTSYEA 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E M + AE+IL+ L +HYRV+ LCTGD+GF A KTYD+EVWL GQN YREISSCS CG+
Sbjct: 298 LEAMTAAAEKILQLLGIHYRVIELCTGDMGFGATKTYDIEVWLPGQNQYREISSCSNCGD 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR + R+R P SK  ++ HTLNGSG+AVGRCL+A++EN   ADGS+ IP  L+PYM 
Sbjct: 358 FQARRADIRFRSPGSKKNQYVHTLNGSGLAVGRCLVAVMENGQRADGSIVIPDALKPYMG 417

Query: 419 NLAVIK 424
            L V++
Sbjct: 418 GLEVVE 423


>gi|238650802|ref|YP_002916657.1| seryl-tRNA synthetase [Rickettsia peacockii str. Rustic]
 gi|259511680|sp|C4K208|SYS_RICPU RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|238624900|gb|ACR47606.1| seryl-tRNA synthetase [Rickettsia peacockii str. Rustic]
          Length = 425

 Score =  411 bits (1057), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 210/424 (49%), Positives = 284/424 (66%), Gaps = 5/424 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           ML+I+WIR+N E  D  L +R +EP S  I  LD + R +   I++ +  R   S  +G 
Sbjct: 1   MLNIKWIRENKELFDEKLSQRFIEPMSSKIAMLDREKRKITSLIQEFQHARKVKSKILGN 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +A  +    + L+ +   + E+L  LE  +    + L +L++  PN+P EEVP G   +
Sbjct: 61  -MASKSGEEFEGLQRDVKHINEKLEALE-HDLNNNNELNELLNMFPNIPDEEVPYGMDES 118

Query: 121 ENILIRSVGK-KPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            N L+R+ G+  P+A  L+++HFE+G  L LMDF++  K+SG RF  L G LA LERAL 
Sbjct: 119 MNKLVRTYGETNPNA--LNKQHFELGIKLNLMDFEQTAKISGTRFVTLKGDLAKLERALI 176

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNL 239
            FMID+HT E  + E+S P+LVRD AMY  GQ+PKFA++ F TT+G  LIPT+EVSL N+
Sbjct: 177 NFMIDVHTKEWDFFEISPPVLVRDNAMYNAGQLPKFAEESFATTNGYRLIPTAEVSLVNM 236

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
            +  II  + LP+R+    P FRSEAGS+GRDTRGM+R HQF K ELVSIT  E+S  EH
Sbjct: 237 VADTIIPREKLPIRYVAYTPCFRSEAGSSGRDTRGMIRLHQFGKVELVSITTPEESTNEH 296

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E + + +E IL++L+L YRV+ LCTGD+GF+A KTYD+EVWL GQ  YREI+SCS CG+F
Sbjct: 297 EYITNASETILQKLNLPYRVMLLCTGDMGFAAKKTYDIEVWLPGQKQYREIASCSNCGDF 356

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RRM +RY++  S      HTLN SG+ +GR ++AILENY N DGS+TIP VL  YM  
Sbjct: 357 QARRMKARYKEFGSNETTLVHTLNASGLPIGRTMVAILENYQNEDGSITIPDVLINYMGG 416

Query: 420 LAVI 423
           L  I
Sbjct: 417 LQKI 420


>gi|157804152|ref|YP_001492701.1| seryl-tRNA synthetase [Rickettsia canadensis str. McKiel]
 gi|166223281|sp|A8EZY3|SYS_RICCK RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|157785415|gb|ABV73916.1| seryl-tRNA synthetase [Rickettsia canadensis str. McKiel]
          Length = 425

 Score =  411 bits (1057), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 207/424 (48%), Positives = 284/424 (66%), Gaps = 5/424 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           ML+I+WIR+N E  D  L +R +EP S  I  LDE+ R +   I++ +  R   S  +G 
Sbjct: 1   MLNIKWIRENQELFDEKLSQRFIEPMSSKIAMLDEEKRKITSLIQEFQHARRVKSKILGN 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
             ++ +    + L+ +   + E+L  LEK+ +      + L + +PN+P +EVP G   +
Sbjct: 61  MTSKSSEEF-EGLQRDVKHINEKLEELEKDLNNNNELNELL-NMLPNIPDDEVPYGIDES 118

Query: 121 ENILIRSVGK-KPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            N L+R+ G+  P+A  L+++HFE+G  L LMDF++ TK+SGARF  L G LA LERAL 
Sbjct: 119 MNKLVRTYGEINPNA--LNKQHFELGTKLNLMDFEQTTKISGARFVTLKGDLAKLERALI 176

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNL 239
            FMID+HT E  + E+S P+LVRD AMY  GQ+PKF ++ F TT G  LIPT+EVSL N+
Sbjct: 177 NFMIDVHTKEFDFFEISPPVLVRDNAMYNAGQLPKFTEESFATTKGYRLIPTAEVSLVNI 236

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
            +  II  + LP+R+      FRSEAGS+GRDTRGM+R HQF K ELVSIT  E+S  EH
Sbjct: 237 VADTIISREKLPMRYVAYTQCFRSEAGSSGRDTRGMIRLHQFGKVELVSITTPEESQNEH 296

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E + + +E IL++L+L YR++ LCTGD+GF+A KTYD+EVWL GQ  YREI+SCS CG+F
Sbjct: 297 EYITNASETILQKLNLPYRIMLLCTGDMGFAAKKTYDIEVWLPGQKQYREIASCSNCGDF 356

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RRM +RY++  S      HTLN SG+ +GR ++AILE+Y N DGS+TIP VL  YM  
Sbjct: 357 QARRMKARYKEFGSNDTTLVHTLNASGLPIGRTMVAILESYQNEDGSITIPDVLINYMGG 416

Query: 420 LAVI 423
           L  I
Sbjct: 417 LQKI 420


>gi|163784436|ref|ZP_02179316.1| hypothetical protein HG1285_05375 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880295|gb|EDP73919.1| hypothetical protein HG1285_05375 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 419

 Score =  411 bits (1057), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 208/420 (49%), Positives = 282/420 (67%), Gaps = 4/420 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRH--LEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQI 58
           MLDI+ IR+NP+ +   LK R   L    + IL++D++ R LI ++E ++A +N  S +I
Sbjct: 1   MLDIKLIRENPDFVKERLKTRDEVLVFVIDEILTVDKERRKLIAEVEQLKAEKNKLSKEI 60

Query: 59  GQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTS 118
           G+   EG        K E     E++  LEKE  EV      L+  +PN+P E VP+G  
Sbjct: 61  GKLFKEGKKEEAQKAKEEVVAKNERIECLEKELKEVEKRFNNLLLTVPNLPYESVPVGKD 120

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
             EN+ IR  G+          H+EIGE LG++DF+R  KLSG+RF+V+    A LERAL
Sbjct: 121 ETENVEIRKWGEPRKFDFEPLPHWEIGEKLGILDFERGAKLSGSRFTVMFKEAARLERAL 180

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-GRWLIPTSEVSLT 237
             FM+D+HT EHGYTEV +P+LV+ E + GTGQ+PKF +D++   D   +L+PT+EVSLT
Sbjct: 181 INFMLDIHTKEHGYTEVWSPVLVKPEILTGTGQLPKFEEDLYKICDEDLYLLPTAEVSLT 240

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           NL++ EI++ + LP  +T   P FR EAGS GRD RG+LRQHQF K ELV I + E+S+ 
Sbjct: 241 NLHAGEILKEEELPKYYTAYTPCFRREAGSHGRDVRGILRQHQFDKVELVKIVKPEESYN 300

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E E++++ AE+IL+ L+L YRVV LCTGDLGFSA KTYD+EVW+  QN+YREISSCS   
Sbjct: 301 ELEKLVNEAEKILQLLELPYRVVELCTGDLGFSAAKTYDIEVWIPSQNMYREISSCSNTE 360

Query: 358 NFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +FQ+RR   RY+    K+ +F HTLNGSG+AVGR L+A++ENY   DGS  IP VL+ YM
Sbjct: 361 DFQARRAKIRYKTKEGKN-EFVHTLNGSGLAVGRTLLAVMENYQKPDGSFDIPEVLQKYM 419


>gi|166712549|ref|ZP_02243756.1| seryl-tRNA synthetase [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 426

 Score =  411 bits (1057), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 213/427 (49%), Positives = 281/427 (65%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKK-RHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD   +RQ+P  L   L+  R     +  + SL+ + + +  + ++++++RNS S  IG
Sbjct: 1   MLDPALLRQHPADLAERLRSTRSFSLDTAELESLESERKRIQVRTQELQSQRNSKSKAIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA A+G    V AL  E +   ++L   E     + + L+ +   +PN+P E+VP+G   
Sbjct: 61  QAKAKGED--VAALMAEVAGFGDELKASEDALDAIRAKLEIIALGLPNLPAEDVPLGKDE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +EN+     G         ++H E+G   G +D + A KLSGARF+VL G +A L RAL 
Sbjct: 119 SENVEQSRWGTPRQFDFAVKDHVELGAPHGWLDGETAAKLSGARFTVLRGPVARLHRALA 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG---RWLIPTSEVSL 236
           QFM+DLH  EHGY E + PLLV  ++M GTGQ+PKF DD+F T  G   R+LIPTSEV L
Sbjct: 179 QFMLDLHVGEHGYEETNVPLLVNADSMLGTGQLPKFEDDLFQTEVGESRRYLIPTSEVPL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+   EII+++ LPLR T  +  FR+EAGS GRDTRGM+RQHQF K ELV+    EDS 
Sbjct: 239 TNIVRDEIIDAERLPLRMTAHSMCFRAEAGSGGRDTRGMIRQHQFEKVELVTACAPEDSD 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            EH+RM  CAE +L++L L YR V LCTGD+GFSA KTYDLEVWL  QN YREISSCS C
Sbjct: 299 AEHQRMTRCAEVVLEQLGLPYRKVLLCTGDMGFSAIKTYDLEVWLPSQNTYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +R+R+P S   +  HTLNGSG AVGR +IA++ENY NADGS+ +P VLRPY
Sbjct: 359 GDFQARRMQARWRNPVSGKPELLHTLNGSGTAVGRAMIAVMENYQNADGSIDVPQVLRPY 418

Query: 417 MNNLAVI 423
           M  L  I
Sbjct: 419 MGGLERI 425


>gi|310778421|ref|YP_003966754.1| seryl-tRNA synthetase [Ilyobacter polytropus DSM 2926]
 gi|309747744|gb|ADO82406.1| seryl-tRNA synthetase [Ilyobacter polytropus DSM 2926]
          Length = 423

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 208/427 (48%), Positives = 284/427 (66%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++++R N E L   LK R+     +    LD + R L+ ++E ++ +RN+ S ++G+
Sbjct: 1   MLDLRYMRDNIEFLKGMLKNRNASVDLDDFEQLDAERRDLLTEVEALKHKRNNVSQEVGK 60

Query: 61  AIAEGNLSLVDA--LKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTS 118
              E      DA  +  E  T+  ++  L+ +  E+ S L+     IPNV  E  P+G  
Sbjct: 61  LKREKK----DASHIIAEMGTVSSKIKELDSKLSEIDSKLQYYQMTIPNVYHESTPVGKD 116

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
             +N+L+R+ G+     +  + H+E+GE LG++DF+R  KL GARF+V  G  A LERAL
Sbjct: 117 EEDNLLVRTWGEPTEFEYEPKNHWELGEELGILDFERGAKLGGARFTVYRGLGARLERAL 176

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTN 238
             FM+DLHT+EHGYTE   P LVR +   GTGQ+PKF DDM+ TTD  +LI TSE++LTN
Sbjct: 177 INFMLDLHTTEHGYTEHITPFLVRRDICEGTGQLPKFEDDMYKTTDEMFLISTSEITLTN 236

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L+  EI+E   LP  +T  +P FR EAGS GRD +G++RQHQF K E+V IT  E+S+ E
Sbjct: 237 LHRKEILEESDLPKYYTAHSPCFRREAGSYGRDVKGLIRQHQFNKVEMVKITTPENSYDE 296

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            ++M+  AE +L++L L YR+V LC+GD+GFSA KTYDLEVWL GQ  YREISSCS CG+
Sbjct: 297 LDKMVVNAETVLQKLGLPYRLVQLCSGDIGFSAAKTYDLEVWLPGQGKYREISSCSNCGD 356

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRM  +YR   +K  +F +TLNGSGVAVGR L+AI+ENY   DGS+ IP  LRPYM 
Sbjct: 357 FQARRMGLKYRPEGTKKSEFVNTLNGSGVAVGRALLAIMENYQQEDGSIIIPEALRPYMG 416

Query: 419 NLAVIKK 425
            + VIKK
Sbjct: 417 GIDVIKK 423


>gi|84517344|ref|ZP_01004698.1| seryl-tRNA synthetase [Loktanella vestfoldensis SKA53]
 gi|84508824|gb|EAQ05287.1| seryl-tRNA synthetase [Loktanella vestfoldensis SKA53]
          Length = 430

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 205/430 (47%), Positives = 269/430 (62%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR  P+  D AL +R L P +  IL LDE  R LI   E  +A  N  S  +G 
Sbjct: 1   MHDIRSIRDTPDAFDTALSRRGLAPVAATILDLDEARRKLILAAETAQAEANKASKDVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  D L+   +  K ++  +  E      +L  L++ +PN+P   +P G    
Sbjct: 61  AKARGDDAEFDRLRGLIADSKSRIAAMNDEAKAKDQALSDLLATLPNLPDPSIPDGKDEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ IR  G          EH++I      MDF+ A KLSG+RF +L+G +A L RAL Q
Sbjct: 121 DNVEIRRHGTPRIFSFAPVEHYDIAGIKQGMDFETAAKLSGSRFVLLSGAVARLHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLH  EHG TE   P++VR++ MYGTGQ+PKF +D + TT+G WLIPT+EV+LTN+ 
Sbjct: 181 FMLDLHVEEHGLTETITPVMVREDMMYGTGQLPKFGEDSYQTTNGWWLIPTAEVTLTNIV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + E ++  +LP R       FRSEAGSAGRDT GMLRQHQF K E+VSIT    S  EH+
Sbjct: 241 NGETVDESTLPRRHVAHTLCFRSEAGSAGRDTSGMLRQHQFEKVEMVSITTPNQSAAEHD 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CA+ +L+RL L YR V LC GD+G  A KT+D+EVWL GQN YREISS S CG++Q
Sbjct: 301 RMTQCAQTVLERLGLPYRTVVLCAGDMGAGATKTHDIEVWLPGQNTYREISSVSVCGDYQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R+R       +F HTLNGSG+AVGR LIA++EN    DGSV +P  L PY+   
Sbjct: 361 ARRMNARFRPAGGGKPEFVHTLNGSGLAVGRTLIAVVENGQQEDGSVDLPAALHPYLGGK 420

Query: 421 AVIKKEHILE 430
             I  E +LE
Sbjct: 421 TRITAEGMLE 430


>gi|323700066|ref|ZP_08111978.1| seryl-tRNA synthetase [Desulfovibrio sp. ND132]
 gi|323459998|gb|EGB15863.1| seryl-tRNA synthetase [Desulfovibrio desulfuricans ND132]
          Length = 425

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 204/427 (47%), Positives = 284/427 (66%), Gaps = 8/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++ +++NP+ +  +L+KRH +        LDE+ + LI ++E ++A +N+    +G 
Sbjct: 1   MLDLKLMQKNPDLVRASLEKRHSKIDVREFTDLDERRKQLIGEVESLKAEKNA----VGP 56

Query: 61  AIAEGNLSLVDA--LKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTS 118
            IA+   +  DA  L  +   + E+   L++E  EV  + +  +  +PN+P E VP+G  
Sbjct: 57  EIAKRKKAGEDASDLLEKMGRVAERTKELDRELAEVEKAEQDWMMSVPNIPHESVPLGAG 116

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
             +N ++R  G+KP      +EH+EIG ALG +DF+ A KL+GARFS+  G  A LERAL
Sbjct: 117 EEDNPVLRYWGEKPVMDFEPKEHWEIGTALGGLDFECAAKLAGARFSISFGWCARLERAL 176

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGR--WLIPTSEVSL 236
            Q M+D  T  HGYTEV  P +V  + M GTGQ+PKF +D+F  TD R  +LIPT+EV L
Sbjct: 177 AQLMLDTQTERHGYTEVLPPFMVNRKTMTGTGQLPKFEEDLFKLTDEREFYLIPTAEVPL 236

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+Y+ E+I  + LP++F    P FRSEAGS G+DT+G++RQHQF+K E+V+    + S+
Sbjct: 237 TNIYADEVIPEEKLPVKFCAQTPCFRSEAGSYGKDTKGLIRQHQFYKVEMVNFAHPDHSY 296

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
              E M   AE IL+ L LHYR + LCTGD+GFSA KTYD+EVWL GQ  YREISSCS C
Sbjct: 297 EALEEMTHSAERILEILGLHYRTIVLCTGDMGFSAAKTYDIEVWLPGQGKYREISSCSNC 356

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
            +FQ+RR N R++  +SK   + HTLNGSG+AVGRCL+A+LENY  ADGS+ IP  LRPY
Sbjct: 357 EDFQARRANIRFQPKDSKKKLYPHTLNGSGLAVGRCLVAVLENYQQADGSLVIPEALRPY 416

Query: 417 MNNLAVI 423
           M  L V+
Sbjct: 417 MGGLEVV 423


>gi|225851091|ref|YP_002731325.1| seryl-tRNA synthetase [Persephonella marina EX-H1]
 gi|225645430|gb|ACO03616.1| seryl-tRNA synthetase [Persephonella marina EX-H1]
          Length = 419

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 203/420 (48%), Positives = 283/420 (67%), Gaps = 4/420 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRH--LEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQI 58
           MLDI+ IR NPE +   L KR    E   + IL +DE+ R +IK++ED++A +N  S +I
Sbjct: 1   MLDIKLIRSNPEFVKERLSKRDPAYEKMIDEILDVDEERRRIIKEVEDLKAEKNRLSKEI 60

Query: 59  GQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTS 118
           G    EG     + +K+E     +++  LE++  ++      L+  +PN+P E VP+G  
Sbjct: 61  GLLFREGKKEEAEKVKDEVQAKNKKIERLERDLKDIEKRFNYLLLTVPNIPHETVPVGED 120

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
             +N+ IR  G+          H++IGE LG++DF+R  KLSG+RF+V+    A LERAL
Sbjct: 121 EEDNVEIRRWGEPRKFDFEPLPHWDIGEKLGILDFERGAKLSGSRFTVMYSEAARLERAL 180

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGRWLIPTSEVSLT 237
             FM+DLHT EHGYTEV  P+LVR E + GTGQ+PKF +D++  + +  +L+PT+EVSLT
Sbjct: 181 INFMLDLHTKEHGYTEVWTPVLVRSEILVGTGQLPKFEEDLYRISEEDLYLLPTAEVSLT 240

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           NL++ EI++ + LP  +T   P FR EAGS G+D RG+LRQHQF K ELV I + EDS+ 
Sbjct: 241 NLHAGEILKEEELPKYYTAYTPCFRREAGSHGKDVRGILRQHQFDKVELVKIVKPEDSYE 300

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E E+++  AE++L+ L+L YRVV LCTGDLGFSA KTYD+EVW+  Q  YREISSCS   
Sbjct: 301 ELEKLVREAEKVLQLLELPYRVVELCTGDLGFSAAKTYDIEVWIPSQKRYREISSCSNTE 360

Query: 358 NFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +FQ+RR   R++D + K+ +F HTLNGSG+AVGR L+AI+ENY   DGS  IP +L+ YM
Sbjct: 361 DFQARRAKIRFKDKDGKN-RFVHTLNGSGLAVGRTLLAIMENYQREDGSFDIPEILKKYM 419


>gi|15893139|ref|NP_360853.1| seryl-tRNA synthetase [Rickettsia conorii str. Malish 7]
 gi|30173197|sp|Q92GA7|SYS_RICCN RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|15620347|gb|AAL03754.1| seryl-tRNA synthetase [Rickettsia conorii str. Malish 7]
          Length = 425

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 209/424 (49%), Positives = 285/424 (67%), Gaps = 5/424 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           ML+I+WIR+N E  D  L +R +EP S  I  LD + R +   I++ +  R   S  +G 
Sbjct: 1   MLNIKWIRENKELFDEKLSQRFIEPMSSKIAMLDGEKRKITSLIQEFQHARKVKSKILGN 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +A  +    + L+ +   + E+L  LE ++    + L +L++  PN+P +EVP G   +
Sbjct: 61  -MASKSGEEFEGLQRDVKHINEKLEALE-QDLNNNNELNELLNMFPNIPDDEVPYGMDES 118

Query: 121 ENILIRSVGK-KPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            N L+R+ G+  P+A  L+++HFE+G  L LMDF++  K+SG RF  L G LA LERAL 
Sbjct: 119 MNKLVRTYGETNPNA--LNKQHFELGIKLNLMDFEQTAKISGTRFVTLKGDLAKLERALI 176

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNL 239
            FMID+HT E  + E+S P+LVRD AMY  GQ+PKFA++ F TT+G  LIPT+EVSL N+
Sbjct: 177 NFMIDVHTKEWDFFEISPPVLVRDNAMYNAGQLPKFAEESFATTNGYRLIPTAEVSLVNM 236

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
            +  II  + LP+R+    P FRSEAGS+GRDTRGM+R HQF K ELVSIT  E+S  EH
Sbjct: 237 VADTIIPREKLPIRYVAYTPCFRSEAGSSGRDTRGMIRLHQFGKVELVSITTPEESTNEH 296

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E + + +E IL++L+L YRV+ LCTGD+GF+A KTYD+EVWL GQ  YREI+SCS CG+F
Sbjct: 297 EYITNASETILQKLNLPYRVMLLCTGDMGFAAKKTYDIEVWLPGQKQYREIASCSNCGDF 356

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RRM +RY++  S      HTLN SG+ +GR ++AILENY N DGS+TIP VL  YM  
Sbjct: 357 QARRMKARYKEFGSNETTLVHTLNASGLPIGRTMVAILENYQNEDGSITIPDVLINYMGG 416

Query: 420 LAVI 423
           L  I
Sbjct: 417 LQKI 420


>gi|294625158|ref|ZP_06703801.1| seryl-tRNA synthetase [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
 gi|292600530|gb|EFF44624.1| seryl-tRNA synthetase [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
          Length = 426

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 215/428 (50%), Positives = 284/428 (66%), Gaps = 8/428 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKK-RHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD   +RQ+P  L   L+  R     +  + SL+ + + +  + ++++++RNS S  IG
Sbjct: 1   MLDPALLRQHPADLAERLRSTRGFSLDTAELESLESERKRIQVRTQELQSQRNSKSKAIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA A+G    V AL  E +   ++L   E     + + L+ +   +PN+P E+VP+G   
Sbjct: 61  QAKAKGED--VAALMAEVAGFGDELKASEDALDAIRAKLEGIALGLPNLPAEDVPLGKDE 118

Query: 120 NENILIRSVGKKPSAIHLS-REHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
           +EN L +S    P     S ++H E+G   G +D + A KLSGARF+VL G +A L RAL
Sbjct: 119 SEN-LEQSRWGTPRQFDFSVKDHVELGAPHGWLDGETAAKLSGARFTVLRGPVARLHRAL 177

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG---RWLIPTSEVS 235
            QFM+DLH  EHGY E + PLLV  ++M GTGQ+PKF DD+F T  G   R+LIPTSEV 
Sbjct: 178 AQFMLDLHVGEHGYEETNVPLLVNADSMRGTGQLPKFEDDLFQTDVGESRRYLIPTSEVP 237

Query: 236 LTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDS 295
           LTN+   EII+++ LPLR T  +  FR+EAGS GRDTRGM+RQHQF K ELV+    EDS
Sbjct: 238 LTNIVREEIIDAERLPLRMTAHSMCFRAEAGSGGRDTRGMIRQHQFEKVELVTACAPEDS 297

Query: 296 FTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCST 355
             EH+RM  CAE +L++L L YR V LCTGD+GFSA KTYDLEVWL  QN YREISSCS 
Sbjct: 298 DAEHQRMTRCAEVVLEQLGLPYRKVLLCTGDMGFSAIKTYDLEVWLPSQNTYREISSCSN 357

Query: 356 CGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
           CG+FQ+RRM +R+R+P S   +  HTLNGSG AVGR +IA++ENY NADGS+ +P VLRP
Sbjct: 358 CGDFQARRMQARWRNPVSGKPELLHTLNGSGTAVGRAMIAVMENYQNADGSIDVPQVLRP 417

Query: 416 YMNNLAVI 423
           YM  +  I
Sbjct: 418 YMGGIERI 425


>gi|294664247|ref|ZP_06729621.1| seryl-tRNA synthetase [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
 gi|292605989|gb|EFF49266.1| seryl-tRNA synthetase [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
          Length = 426

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 212/427 (49%), Positives = 281/427 (65%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKK-RHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD   +RQ+P  L   L+  R     +  + SL+ + + +  + ++++++RNS S  IG
Sbjct: 1   MLDPALLRQHPADLAERLRSTRGFSLDTAELESLESERKRIQVRTQELQSQRNSKSKAIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA A+G    V AL  E +   ++L   E     + + L+ +   +PN+P E+VP+G   
Sbjct: 61  QAKAKGED--VAALMAEVAGFGDELKASEDALDAIRAKLEGIALGLPNLPAEDVPLGKDE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +EN+     G         ++H E+G   G +D + A KLSGARF+VL G +A L RAL 
Sbjct: 119 SENLEQSRWGTPRQFDFAVKDHVELGAPHGWLDGETAAKLSGARFTVLRGPVARLHRALA 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG---RWLIPTSEVSL 236
           QFM+DLH  EHGY E + PLLV  ++M GTGQ+PKF DD+F T  G   R+LIPTSEV L
Sbjct: 179 QFMLDLHVGEHGYEETNVPLLVNADSMRGTGQLPKFEDDLFQTDVGESRRYLIPTSEVPL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+   EII+++ LPLR T  +  FR+EAGS GRDTRGM+RQHQF K ELV+    EDS 
Sbjct: 239 TNIVREEIIDAERLPLRMTAHSMCFRAEAGSGGRDTRGMIRQHQFEKVELVTACAPEDSD 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            EH+RM  CAE +L++L L YR V LCTGD+GFSA KTYDLEVWL  QN YREISSCS C
Sbjct: 299 AEHQRMTRCAEVVLEQLGLPYRKVLLCTGDMGFSAIKTYDLEVWLPSQNTYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +R+R+P S   +  HTLNGSG AVGR +IA++ENY NADGS+ +P VLRPY
Sbjct: 359 GDFQARRMQARWRNPVSGKPELLHTLNGSGTAVGRAMIAVMENYQNADGSIDVPQVLRPY 418

Query: 417 MNNLAVI 423
           M  +  I
Sbjct: 419 MGGIERI 425


>gi|78047250|ref|YP_363425.1| seryl-tRNA synthetase [Xanthomonas campestris pv. vesicatoria str.
           85-10]
 gi|325927384|ref|ZP_08188632.1| seryl-tRNA synthetase [Xanthomonas perforans 91-118]
 gi|123585378|sp|Q3BUY8|SYS_XANC5 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|78035680|emb|CAJ23371.1| seryl-tRNA synthetase [Xanthomonas campestris pv. vesicatoria str.
           85-10]
 gi|325542205|gb|EGD13699.1| seryl-tRNA synthetase [Xanthomonas perforans 91-118]
          Length = 426

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 216/430 (50%), Positives = 283/430 (65%), Gaps = 12/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLD----EKNRILIKKIEDIRARRNSNSA 56
           MLD   +RQ+P   D+A + R        I  L+    E+ RI ++  ++++++RNS S 
Sbjct: 1   MLDPALLRQHP--ADLAERLRSTRSFDLNIAELELLESERKRIQVR-TQELQSQRNSKSK 57

Query: 57  QIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIG 116
            IGQA A+G    V AL  E +   ++L   E+    + + L+ +   +PN+P E+VP+G
Sbjct: 58  AIGQAKAKGED--VAALMAEVAGFGDELKASEEALDAIRAKLEGIALGLPNLPAEDVPLG 115

Query: 117 TSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLER 176
              +EN+     G         ++H E+G   G +D + A KLSGARF+VL G +A L R
Sbjct: 116 KDESENVEQSRWGTPRQFDFAVKDHVELGAPHGWLDGETAAKLSGARFTVLRGPVARLHR 175

Query: 177 ALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG---RWLIPTSE 233
           AL QFM+DLH  EHGY E + PLLV  ++M GTGQ+PKF DD+F T  G   R+LIPTSE
Sbjct: 176 ALAQFMLDLHVGEHGYEETNVPLLVNADSMRGTGQLPKFEDDLFQTEVGESRRYLIPTSE 235

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V LTN+   EII+++ LPLR T  +  FR+EAGS GRDTRGM+RQHQF K ELV+    E
Sbjct: 236 VPLTNIVRDEIIDAERLPLRMTAHSMCFRAEAGSGGRDTRGMIRQHQFEKVELVTACAPE 295

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
           DS  EH+RM  CAE +L++L L YR V LCTGD+GFSA KTYDLEVWL  QN YREISSC
Sbjct: 296 DSDAEHQRMTRCAEVVLEQLGLPYRKVLLCTGDMGFSAIKTYDLEVWLPSQNTYREISSC 355

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S CG+FQ+RRM +R+R+P S   +  HTLNGSG AVGR +IA++ENY NADGS+ +P VL
Sbjct: 356 SNCGDFQARRMQARWRNPVSGKPELLHTLNGSGTAVGRAMIAVMENYQNADGSIDVPQVL 415

Query: 414 RPYMNNLAVI 423
           RPYM  L  I
Sbjct: 416 RPYMGGLERI 425


>gi|269792616|ref|YP_003317520.1| seryl-tRNA synthetase [Thermanaerovibrio acidaminovorans DSM 6589]
 gi|269100251|gb|ACZ19238.1| seryl-tRNA synthetase [Thermanaerovibrio acidaminovorans DSM 6589]
          Length = 427

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 209/424 (49%), Positives = 279/424 (65%), Gaps = 4/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M+DI+W+R N E     L+ R  +   + +L LDE+ R ++ ++E+I+ARRN  S ++G+
Sbjct: 1   MMDIKWVRDNVEAAREYLRNRRSDFPLDRLLELDERRRQILGEVEEIKARRNEGSKRVGE 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G  +   AL  +  +L +++  LE E   V   L  L+  +PN P   VP+G    
Sbjct: 61  MKRRGEDA--SALMEDMRSLGDRVSQLEAELGSVQGELDDLMLRMPNRPHSTVPVGEDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N ++R+ G+        R H+EIGE LG+MDF+RA +L+ +RF VL G  A LERAL Q
Sbjct: 119 SNPVVRTWGEPRRFDFEPRPHWEIGEILGIMDFERAVRLAESRFVVLKGLGARLERALVQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGRWLIPTSEVSLTNL 239
           +M+DLHTS +G+ EVS P LV    M GTGQ+PKF++D++ C  D  WLIPT+EV LTNL
Sbjct: 179 YMLDLHTS-NGFIEVSPPFLVSSATMTGTGQLPKFSEDLYRCANDDLWLIPTAEVPLTNL 237

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +S EI++  SLPL +T   P FR EAGS GRD +GMLR HQF K ELV I R E+S+ E 
Sbjct: 238 HSGEILDEDSLPLHYTAHTPCFRREAGSYGRDVKGMLRVHQFPKVELVKICRPEESYDEL 297

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E + + AE +LK L L YRVV LCTGD+GF++ KTYD+EVWL  Q  YREISSCS C +F
Sbjct: 298 ESLTASAESVLKGLGLPYRVVCLCTGDMGFASSKTYDIEVWLPSQGCYREISSCSNCEDF 357

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RRMN+RYR       +F HTLNGSG+AVGRCL+AI+EN+   DGS+ IP  L PYM  
Sbjct: 358 QARRMNTRYRPKEGGRPRFVHTLNGSGIAVGRCLLAIVENFQREDGSIEIPEALVPYMGG 417

Query: 420 LAVI 423
           +  I
Sbjct: 418 VREI 421


>gi|332970285|gb|EGK09277.1| serine--tRNA ligase [Kingella kingae ATCC 23330]
          Length = 471

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 202/427 (47%), Positives = 282/427 (66%), Gaps = 9/427 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD+Q  R + + L   L  R  E  +     L+   + L  K E+ +A+RN+ S QIG 
Sbjct: 40  MLDVQHFRNDIQTLAARLVTRGFELDTAKFEQLEAARKSLQMKNEEWQAKRNALSKQIGA 99

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            + +G     +A K E +  K ++  +E+E  ++ + L  L+  +PN+P E VP+G   +
Sbjct: 100 LMGQGKKDEAEAAKTEVAACKAEMDKIEQELPQIQADLDDLLLRVPNLPHESVPVGKDES 159

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG   +     ++H ++G ALGL DF++A +LSGARFS++ G +A L RAL Q
Sbjct: 160 ENVEVRKVGTPRTFDFEIKDHVDLGAALGL-DFEKAAELSGARFSLMKGKIARLHRALAQ 218

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKF +D+F  T G       ++LIPT+E
Sbjct: 219 FMLDTHTQQHGYTECYTPYIVSDSTLLGTGQLPKFGEDLFHVTRGGDESKLTQYLIPTAE 278

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN    EI+    LP++ T  +P FRSEAGS G+DTRG++RQHQF K E+V I + E
Sbjct: 279 VTLTNTVRDEILSLNDLPMKLTAHSPCFRSEAGSHGKDTRGLIRQHQFDKVEMVQIVQPE 338

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M++ AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 339 KSYEALEEMVTHAENILKLLELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 398

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 399 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRALVAVLENHQNADGSINIPMAL 457

Query: 414 RPYMNNL 420
           RPY+  L
Sbjct: 458 RPYLGGL 464


>gi|315498366|ref|YP_004087170.1| seryl-tRNA synthetase [Asticcacaulis excentricus CB 48]
 gi|315416378|gb|ADU13019.1| seryl-tRNA synthetase [Asticcacaulis excentricus CB 48]
          Length = 468

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 213/467 (45%), Positives = 284/467 (60%), Gaps = 44/467 (9%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS---EYILSLDEKNRILIKKIEDIRARRNSNSAQ 57
           M DI+ +R+ PE        R  E      + +L+LD+  R      E  +A+    S +
Sbjct: 1   MHDIKALRETPEAYVRGWSSRGRESAQADVDALLTLDKDLRAAKTTFETNQAQLKKLSGE 60

Query: 58  IGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGT 117
           IG+A A+ + +    L  E   LK  + + ++ E +    L+ L++ +PN+P E+VP+G 
Sbjct: 61  IGKAKAQKDEARAAELMTEVEGLKGAIAVAQETERQTEEDLRTLLASLPNIPFEDVPLGE 120

Query: 118 SANENILIRSVGKKPSAIHLSREHFEIGEALG-----LMDFDRATKLSGARFSVLTGHLA 172
               N+ IR  G       L+++H ++GEAL      LMDF+ A ++SG+RF VL G LA
Sbjct: 121 DEAGNVEIRRHGAPNILSFLAKDHADLGEALKGPTGPLMDFEAAARMSGSRFVVLKGQLA 180

Query: 173 HLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF------------ 220
            LERA+GQ+M+D  T+EHGYTEV+ P+LVR+ A++GTGQ+PKF +D+F            
Sbjct: 181 RLERAIGQWMLDTQTTEHGYTEVNPPVLVRENALFGTGQLPKFEEDLFKAGLTFSRERLA 240

Query: 221 ------------------------CTTDGRWLIPTSEVSLTNLYSHEIIESKSLPLRFTT 256
                                      + R+LIPT+EVSLTNL    I   + LPLR T 
Sbjct: 241 GQAREAGIELKSLDEQTYELIIAQMGENARYLIPTAEVSLTNLVREAITAEEELPLRLTA 300

Query: 257 LAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLH 316
           L   FR+EAGSAGRDT+GM+RQHQF K ELVSIT  E S  EHERM  CAE ILK+LDL 
Sbjct: 301 LTNCFRAEAGSAGRDTKGMIRQHQFQKVELVSITTPEQSAAEHERMTECAEAILKKLDLS 360

Query: 317 YRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSL 376
           +R + LCTGD+GF A KTYDLEVWL  QN YREISSCS CG+FQ+RRM++R R    K  
Sbjct: 361 FRTMLLCTGDMGFGARKTYDLEVWLPSQNTYREISSCSNCGDFQARRMDARTRKAGEKGT 420

Query: 377 KFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVI 423
           +F HTLNGSG+AVGR L+AI+ENY +  G + IP+VL+PYM  L  I
Sbjct: 421 RFLHTLNGSGLAVGRTLVAIMENYQDEGGRIAIPSVLQPYMGGLTHI 467


>gi|119385156|ref|YP_916212.1| seryl-tRNA synthetase [Paracoccus denitrificans PD1222]
 gi|166222757|sp|A1B4S2|SYS_PARDP RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|119374923|gb|ABL70516.1| seryl-tRNA synthetase [Paracoccus denitrificans PD1222]
          Length = 430

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 213/429 (49%), Positives = 273/429 (63%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D AL  R+L P S  ILSLD   R  I   E  +A +N  S + G 
Sbjct: 1   MHDIRAIRENPAAFDAALALRNLPPVSPEILSLDADRRSRIAAAEAAQAEQNKASKEAGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G+ +    L+   +  K++   L+ E   + + L++L+  +PN+PL+ VP G   +
Sbjct: 61  AKGRGDEAEFQRLRALVTAKKDETARLQAEATALDAKLRELLLAVPNLPLDGVPPGKDED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ IR  G+  +     REHFEI      MDF+ A KLSG+RF VL G +A + RAL Q
Sbjct: 121 DNVEIRRWGEPRAFDFAPREHFEIEGVRPGMDFETAAKLSGSRFVVLKGGVARVHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT EHG  E  AP+LV  E M GTGQ+PKF +D + T +G WLIPTSEV+LTN  
Sbjct: 181 FMLDLHTEEHGLAETWAPVLVLSEMMEGTGQLPKFGEDSYQTREGWWLIPTSEVTLTNTV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + ++++  SLP R    +  FRSEAGSAGRDT GMLRQHQF K E+VSIT  E    EH 
Sbjct: 241 NGDLVDHASLPRRMVAHSQCFRSEAGSAGRDTSGMLRQHQFEKVEMVSITDAESGVEEHA 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE +L+RL L YR + LC GD+GF A  T+DLEVWL GQ  YREISS S CG+FQ
Sbjct: 301 RMTRCAEAVLERLGLPYRTIVLCGGDMGFGARITHDLEVWLPGQGKYREISSVSYCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR       +F HTLNGSG+AVGR LIA+LEN   ADGSV +P VL PY+   
Sbjct: 361 ARRMNARYRPAGGGKPEFVHTLNGSGLAVGRTLIAVLENGQQADGSVKLPEVLHPYLGGR 420

Query: 421 AVIKKEHIL 429
             +  + +L
Sbjct: 421 TRLGADGVL 429


>gi|29377733|ref|NP_816887.1| seryl-tRNA synthetase [Enterococcus faecalis V583]
 gi|227555642|ref|ZP_03985689.1| seryl-tRNA synthetase [Enterococcus faecalis HH22]
 gi|229547172|ref|ZP_04435897.1| seryl-tRNA synthetase [Enterococcus faecalis TX1322]
 gi|229550742|ref|ZP_04439467.1| seryl-tRNA synthetase [Enterococcus faecalis ATCC 29200]
 gi|255971509|ref|ZP_05422095.1| seryl-tRNA synthetase [Enterococcus faecalis T1]
 gi|255974459|ref|ZP_05425045.1| seryl-tRNA synthetase [Enterococcus faecalis T2]
 gi|256618568|ref|ZP_05475414.1| seryl-tRNA synthetase [Enterococcus faecalis ATCC 4200]
 gi|256761814|ref|ZP_05502394.1| seryl-tRNA synthetase [Enterococcus faecalis T3]
 gi|256854941|ref|ZP_05560302.1| seryl-tRNA synthetase [Enterococcus faecalis T8]
 gi|256957056|ref|ZP_05561227.1| seryl-tRNA synthetase [Enterococcus faecalis DS5]
 gi|256960920|ref|ZP_05565091.1| seryl-tRNA synthetase [Enterococcus faecalis Merz96]
 gi|256963942|ref|ZP_05568113.1| seryl-tRNA synthetase [Enterococcus faecalis HIP11704]
 gi|257078733|ref|ZP_05573094.1| seryl-tRNA synthetase [Enterococcus faecalis JH1]
 gi|257083965|ref|ZP_05578326.1| seryl-tRNA synthetase [Enterococcus faecalis Fly1]
 gi|257087795|ref|ZP_05582156.1| seryl-tRNA synthetase [Enterococcus faecalis D6]
 gi|257088440|ref|ZP_05582801.1| seryl-tRNA synthetase [Enterococcus faecalis CH188]
 gi|257418881|ref|ZP_05595875.1| seryl-tRNA synthetase [Enterococcus faecalis T11]
 gi|257421304|ref|ZP_05598294.1| seryl-tRNA synthetase [Enterococcus faecalis X98]
 gi|293384815|ref|ZP_06630660.1| serine--tRNA ligase [Enterococcus faecalis R712]
 gi|293388237|ref|ZP_06632756.1| serine--tRNA ligase [Enterococcus faecalis S613]
 gi|294781208|ref|ZP_06746555.1| serine--tRNA ligase [Enterococcus faecalis PC1.1]
 gi|300861572|ref|ZP_07107656.1| serine--tRNA ligase [Enterococcus faecalis TUSoD Ef11]
 gi|307268871|ref|ZP_07550236.1| seryl-tRNA synthetase [Enterococcus faecalis TX4248]
 gi|307273946|ref|ZP_07555156.1| seryl-tRNA synthetase [Enterococcus faecalis TX0855]
 gi|307277353|ref|ZP_07558451.1| seryl-tRNA synthetase [Enterococcus faecalis TX2134]
 gi|307283995|ref|ZP_07564165.1| seryl-tRNA synthetase [Enterococcus faecalis TX0860]
 gi|307286509|ref|ZP_07566608.1| seryl-tRNA synthetase [Enterococcus faecalis TX0109]
 gi|307289982|ref|ZP_07569908.1| seryl-tRNA synthetase [Enterococcus faecalis TX0411]
 gi|312901342|ref|ZP_07760623.1| seryl-tRNA synthetase [Enterococcus faecalis TX0470]
 gi|312902989|ref|ZP_07762178.1| seryl-tRNA synthetase [Enterococcus faecalis TX0635]
 gi|312908857|ref|ZP_07767796.1| seryl-tRNA synthetase [Enterococcus faecalis DAPTO 512]
 gi|312952975|ref|ZP_07771831.1| seryl-tRNA synthetase [Enterococcus faecalis TX0102]
 gi|312979500|ref|ZP_07791182.1| seryl-tRNA synthetase [Enterococcus faecalis DAPTO 516]
 gi|46577436|sp|Q82YY9|SYS2_ENTFA RecName: Full=Seryl-tRNA synthetase 2; AltName: Full=Serine--tRNA
           ligase 2; Short=SerRS 2; AltName:
           Full=Seryl-tRNA(Ser/Sec) synthetase 2
 gi|29345201|gb|AAO82957.1| seryl-tRNA synthetase [Enterococcus faecalis V583]
 gi|227175219|gb|EEI56191.1| seryl-tRNA synthetase [Enterococcus faecalis HH22]
 gi|229304175|gb|EEN70171.1| seryl-tRNA synthetase [Enterococcus faecalis ATCC 29200]
 gi|229307754|gb|EEN73741.1| seryl-tRNA synthetase [Enterococcus faecalis TX1322]
 gi|255962527|gb|EET95003.1| seryl-tRNA synthetase [Enterococcus faecalis T1]
 gi|255967331|gb|EET97953.1| seryl-tRNA synthetase [Enterococcus faecalis T2]
 gi|256598095|gb|EEU17271.1| seryl-tRNA synthetase [Enterococcus faecalis ATCC 4200]
 gi|256683065|gb|EEU22760.1| seryl-tRNA synthetase [Enterococcus faecalis T3]
 gi|256709454|gb|EEU24501.1| seryl-tRNA synthetase [Enterococcus faecalis T8]
 gi|256947552|gb|EEU64184.1| seryl-tRNA synthetase [Enterococcus faecalis DS5]
 gi|256951416|gb|EEU68048.1| seryl-tRNA synthetase [Enterococcus faecalis Merz96]
 gi|256954438|gb|EEU71070.1| seryl-tRNA synthetase [Enterococcus faecalis HIP11704]
 gi|256986763|gb|EEU74065.1| seryl-tRNA synthetase [Enterococcus faecalis JH1]
 gi|256991995|gb|EEU79297.1| seryl-tRNA synthetase [Enterococcus faecalis Fly1]
 gi|256995825|gb|EEU83127.1| seryl-tRNA synthetase [Enterococcus faecalis D6]
 gi|256997252|gb|EEU83772.1| seryl-tRNA synthetase [Enterococcus faecalis CH188]
 gi|257160709|gb|EEU90669.1| seryl-tRNA synthetase [Enterococcus faecalis T11]
 gi|257163128|gb|EEU93088.1| seryl-tRNA synthetase [Enterococcus faecalis X98]
 gi|291077897|gb|EFE15261.1| serine--tRNA ligase [Enterococcus faecalis R712]
 gi|291082384|gb|EFE19347.1| serine--tRNA ligase [Enterococcus faecalis S613]
 gi|294451671|gb|EFG20126.1| serine--tRNA ligase [Enterococcus faecalis PC1.1]
 gi|295112309|emb|CBL30946.1| seryl-tRNA synthetase [Enterococcus sp. 7L76]
 gi|300849033|gb|EFK76786.1| serine--tRNA ligase [Enterococcus faecalis TUSoD Ef11]
 gi|306498976|gb|EFM68468.1| seryl-tRNA synthetase [Enterococcus faecalis TX0411]
 gi|306502382|gb|EFM71659.1| seryl-tRNA synthetase [Enterococcus faecalis TX0109]
 gi|306503366|gb|EFM72615.1| seryl-tRNA synthetase [Enterococcus faecalis TX0860]
 gi|306505987|gb|EFM75159.1| seryl-tRNA synthetase [Enterococcus faecalis TX2134]
 gi|306509254|gb|EFM78314.1| seryl-tRNA synthetase [Enterococcus faecalis TX0855]
 gi|306514787|gb|EFM83337.1| seryl-tRNA synthetase [Enterococcus faecalis TX4248]
 gi|310625295|gb|EFQ08578.1| seryl-tRNA synthetase [Enterococcus faecalis DAPTO 512]
 gi|310629116|gb|EFQ12399.1| seryl-tRNA synthetase [Enterococcus faecalis TX0102]
 gi|310633657|gb|EFQ16940.1| seryl-tRNA synthetase [Enterococcus faecalis TX0635]
 gi|311287682|gb|EFQ66238.1| seryl-tRNA synthetase [Enterococcus faecalis DAPTO 516]
 gi|311291575|gb|EFQ70131.1| seryl-tRNA synthetase [Enterococcus faecalis TX0470]
 gi|315026612|gb|EFT38544.1| seryl-tRNA synthetase [Enterococcus faecalis TX2137]
 gi|315030106|gb|EFT42038.1| seryl-tRNA synthetase [Enterococcus faecalis TX4000]
 gi|315033599|gb|EFT45531.1| seryl-tRNA synthetase [Enterococcus faecalis TX0017]
 gi|315036264|gb|EFT48196.1| seryl-tRNA synthetase [Enterococcus faecalis TX0027]
 gi|315143579|gb|EFT87595.1| seryl-tRNA synthetase [Enterococcus faecalis TX2141]
 gi|315148283|gb|EFT92299.1| seryl-tRNA synthetase [Enterococcus faecalis TX4244]
 gi|315151248|gb|EFT95264.1| seryl-tRNA synthetase [Enterococcus faecalis TX0012]
 gi|315153733|gb|EFT97749.1| seryl-tRNA synthetase [Enterococcus faecalis TX0031]
 gi|315155041|gb|EFT99057.1| seryl-tRNA synthetase [Enterococcus faecalis TX0043]
 gi|315158670|gb|EFU02687.1| seryl-tRNA synthetase [Enterococcus faecalis TX0312]
 gi|315163393|gb|EFU07410.1| seryl-tRNA synthetase [Enterococcus faecalis TX0645]
 gi|315165668|gb|EFU09685.1| seryl-tRNA synthetase [Enterococcus faecalis TX1302]
 gi|315168475|gb|EFU12492.1| seryl-tRNA synthetase [Enterococcus faecalis TX1341]
 gi|315172092|gb|EFU16109.1| seryl-tRNA synthetase [Enterococcus faecalis TX1342]
 gi|315174225|gb|EFU18242.1| seryl-tRNA synthetase [Enterococcus faecalis TX1346]
 gi|315576187|gb|EFU88378.1| seryl-tRNA synthetase [Enterococcus faecalis TX0309B]
 gi|315579766|gb|EFU91957.1| seryl-tRNA synthetase [Enterococcus faecalis TX0630]
 gi|315582998|gb|EFU95189.1| seryl-tRNA synthetase [Enterococcus faecalis TX0309A]
 gi|323479199|gb|ADX78638.1| seryl-tRNA synthetase [Enterococcus faecalis 62]
 gi|327536390|gb|AEA95224.1| serine--tRNA ligase [Enterococcus faecalis OG1RF]
 gi|329577273|gb|EGG58736.1| serine--tRNA ligase [Enterococcus faecalis TX1467]
          Length = 423

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 209/427 (48%), Positives = 285/427 (66%), Gaps = 7/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQ--SEYILSLDEKNRILIKKIEDIRARRNSNSAQI 58
           MLD++ +RQN + +   L+ R ++ +   E+ L LDE  R L+ K+E+++  RN  SA+I
Sbjct: 1   MLDVKMMRQNFDEVKAKLQTRGVKEEILVEF-LRLDESRRDLLVKVEEMKKYRNDVSAEI 59

Query: 59  GQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTS 118
            Q   + N     A   E   +   +  L+ E + +   L+ + + +PN+P + VP+G  
Sbjct: 60  AQL--KRNKEDATAKIAEMKEVGGNIKALDAEINAIDEELRGITTTLPNLPDDSVPVGAG 117

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
             EN+ +R   +  +     + H+E+ E LG++DF+R  K++G+RF    G  A LERAL
Sbjct: 118 EEENVEVRRWSEPRTFAFEPKPHWEVAENLGILDFERGAKVAGSRFVYYKGLGARLERAL 177

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLT 237
             FM+DLH  EHGYTE+  P +V D AM+GTGQ PKF +D+F   D    LIPT+EV LT
Sbjct: 178 YNFMLDLHVYEHGYTEMITPYIVNDTAMFGTGQFPKFKEDVFQLQDTDLTLIPTAEVPLT 237

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           N Y++EI++ K LP+ FT L+PSFRSEAGSAGRDTRG++R HQF K E+V  +  E S+ 
Sbjct: 238 NYYNNEILDGKDLPIYFTALSPSFRSEAGSAGRDTRGLIRLHQFNKVEMVKFSDAEHSYE 297

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E E+M + AEEIL++L L YRV++L TGD+GFSA KTYDLEVW+  Q  YREISSCS C 
Sbjct: 298 ELEKMTNNAEEILQKLGLPYRVMALSTGDMGFSAAKTYDLEVWIPAQETYREISSCSNCE 357

Query: 358 NFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +FQ+RR   RYRD N K +++ HTLNGSG+AVGR + AILENY N DGSVT+P VL PYM
Sbjct: 358 DFQARRAMIRYRDENDK-VQYAHTLNGSGLAVGRTVAAILENYQNEDGSVTVPEVLVPYM 416

Query: 418 NNLAVIK 424
            NL VIK
Sbjct: 417 GNLTVIK 423


>gi|157964932|ref|YP_001499756.1| seryl-tRNA synthetase [Rickettsia massiliae MTU5]
 gi|166987316|sp|A8F2S3|SYS_RICM5 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|157844708|gb|ABV85209.1| Seryl-tRNA synthetase [Rickettsia massiliae MTU5]
          Length = 425

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 208/424 (49%), Positives = 285/424 (67%), Gaps = 5/424 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           ML+I+WIR+N +  D  L +R +EP S  I  LD + R ++  I++ +  R   S  +G 
Sbjct: 1   MLNIKWIRENQKLFDEKLSQRFIEPMSSKIAMLDREKRKIMSLIQEFQHARKVKSKILGN 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +A  +    + L+ +   + E+L  LE ++    + L +L++  PN+P EEVP G   +
Sbjct: 61  -MASKSGEEFEGLQRDVKHINEKLEALE-QDLNNNNELNELLNMFPNIPDEEVPYGMDES 118

Query: 121 ENILIRSVGK-KPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            N L+R+ G+  P+A  L+++HFE+G  L LMDF++  K+SG RF  L G LA LERAL 
Sbjct: 119 MNKLVRTYGETNPNA--LNKQHFELGIKLNLMDFEQTAKISGTRFVTLKGDLAKLERALI 176

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNL 239
            FMID+HT E  + E+S P+LVRD AMY  GQ+PKFA++ F TT+G  LIPT+EV L N+
Sbjct: 177 NFMIDVHTKELDFFEISPPVLVRDNAMYNAGQLPKFAEESFATTNGYRLIPTAEVPLVNI 236

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
            +  II  + LP+R+    P FRSEAGS+GRDTRGM+R HQF K ELVSIT  E+S  EH
Sbjct: 237 VADTIIPREKLPMRYVAYTPCFRSEAGSSGRDTRGMIRLHQFGKVELVSITTPEESKNEH 296

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E + + +E IL++L+L YRV+ LCTGD+GF+A KTYD+EVWL GQ  YREI+SCS CG+F
Sbjct: 297 EYITNASETILQKLNLPYRVMLLCTGDMGFAAKKTYDIEVWLPGQKQYREIASCSNCGDF 356

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RRM +RY++  S      HTLN SG+ +GR ++AILENY N DGS+TIP VL  YM  
Sbjct: 357 QARRMKARYKEFGSNETTLVHTLNASGLPIGRTMVAILENYQNEDGSITIPDVLINYMGG 416

Query: 420 LAVI 423
           L  I
Sbjct: 417 LQKI 420


>gi|325266501|ref|ZP_08133178.1| serine--tRNA ligase [Kingella denitrificans ATCC 33394]
 gi|324981944|gb|EGC17579.1| serine--tRNA ligase [Kingella denitrificans ATCC 33394]
          Length = 467

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 206/428 (48%), Positives = 284/428 (66%), Gaps = 11/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R + +     L +R     +E    L+ + + L  + E+++A+RNS S QIG 
Sbjct: 36  MLDIQLLRNDIQTTAQRLAQRGFVLDTERFGELEGRRKQLQIRSEELQAQRNSLSKQIGV 95

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            + +G     +A K + + LK  +  +E E  +V ++L  L+  IPN+P E VP+G    
Sbjct: 96  LMGQGKKDEAEAAKAQVAQLKTDMENIESELPQVQAALDDLLLRIPNLPHESVPVGKDET 155

Query: 121 ENILIRSVGKKPSAIHLS-REHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           EN+ +R VG  P    L  ++H ++G ALGL DF++A +LSGARFS++ G +A L RAL 
Sbjct: 156 ENVEVRKVGT-PRTFDLDIKDHVDLGAALGL-DFEKAAELSGARFSLMKGKIARLHRALA 213

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTS 232
           QFM+D HT +HGYTE   P +V D  + GTGQ+PKF +D+F  T G       ++LIPT+
Sbjct: 214 QFMLDTHTQQHGYTECYTPYIVNDSTLLGTGQLPKFGEDLFHVTRGGDETKLTQYLIPTA 273

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV+LTN     I+  K LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I + 
Sbjct: 274 EVTLTNTVRDTILAEKDLPLKLTAHSPCFRSEAGSHGKDTRGLIRQHQFDKVEMVQIVQP 333

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISS
Sbjct: 334 EKSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISS 393

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS C +FQ+RRM +R++D N ++ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  
Sbjct: 394 CSNCEDFQARRMKARFKDENGRN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAA 452

Query: 413 LRPYMNNL 420
           LRPY+  L
Sbjct: 453 LRPYLGGL 460


>gi|94967422|ref|YP_589470.1| seryl-tRNA synthetase [Candidatus Koribacter versatilis Ellin345]
 gi|94549472|gb|ABF39396.1| seryl-tRNA synthetase [Candidatus Koribacter versatilis Ellin345]
          Length = 432

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 202/422 (47%), Positives = 275/422 (65%), Gaps = 7/422 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS--EYILSLDEKNRILIKKIEDIRARRNSNSAQI 58
           MLD+ ++R N   ++  L++R + P    +    +D + R  I + E ++A+RN  S QI
Sbjct: 3   MLDLGFVRDNLALVEEKLRQRGMNPDEVLKGFPEIDARRRAAITEAETLKAQRNKASEQI 62

Query: 59  GQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTS 118
            Q   + N     AL  ET   +E++   EK       ++ +++  IPN+P E VP+G S
Sbjct: 63  AQL--KKNKQDATALIEETKQAREKIAEFEKNAEAAEGAMCEILVSIPNLPHESVPVGRS 120

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
            ++N  +R  G KP+     + H+E+GE LG++D +RA K++GARF+V     A LERAL
Sbjct: 121 EHDNQEVRQWGTKPTFDFTPKPHWELGEELGVLDMERAAKITGARFAVYWDLGAKLERAL 180

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGR---WLIPTSEVS 235
             FM+DLHT EHGYTEV  P LV  ++MYGTGQ+PKF  D+F    G    +LIPT+EV 
Sbjct: 181 MNFMLDLHTKEHGYTEVLPPFLVNADSMYGTGQLPKFEADLFKVPHGERNLYLIPTAEVP 240

Query: 236 LTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDS 295
           +TNLY  E +++  LP   T   P FRSEAGS G+D RG++RQHQF K ELV  T+ E+S
Sbjct: 241 VTNLYRDETLDAAQLPTSLTAYTPCFRSEAGSYGKDVRGIIRQHQFQKVELVKFTKPEES 300

Query: 296 FTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCST 355
           + EHE++   AEE+L+RL LHYR + LCTGD+GFS+ KTYD+EVWL GQNLYREISSCS 
Sbjct: 301 YAEHEKLTRNAEEVLQRLGLHYRTMVLCTGDMGFSSAKTYDIEVWLPGQNLYREISSCSN 360

Query: 356 CGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
             +FQ+RR N RYR          HT+NGSG+A+GR  +AI+ENY  ADG+V IP VLRP
Sbjct: 361 FESFQARRANIRYRPEGKNKTDLVHTINGSGLAIGRTWVAIIENYQQADGTVVIPEVLRP 420

Query: 416 YM 417
           Y+
Sbjct: 421 YI 422


>gi|88607906|ref|YP_505030.1| seryl-tRNA synthetase [Anaplasma phagocytophilum HZ]
 gi|123736440|sp|Q2GKS1|SYS_ANAPZ RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|88598969|gb|ABD44439.1| seryl-tRNA synthetase [Anaplasma phagocytophilum HZ]
          Length = 428

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 212/425 (49%), Positives = 284/425 (66%), Gaps = 15/425 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQI-- 58
           M DI++I+ NPE  D A+  R LE Q+  I+ LD + R L+ ++  +R +RN+ + ++  
Sbjct: 1   MHDIEFIKNNPELFDKAMLSRGLESQAAKIIELDLQKRKLLTELYALREQRNAITKEVTV 60

Query: 59  ---GQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
                A    ++     L +E S L+E++    K +    + L  L+  +PN+P + VP 
Sbjct: 61  LKQSGADCSSHVETSKKLAHEISELEERI----KRD----TGLSYLLCSLPNIPDDAVPF 112

Query: 116 GTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLE 175
           G SA++N+ +RS G+K S     + H+ +GE L LMDF RA  LSG+RFS+L+G LA LE
Sbjct: 113 GKSADDNVEVRSYGQKRSFSFEIKPHYVLGEMLNLMDFRRAAFLSGSRFSILSGQLAALE 172

Query: 176 RALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVS 235
           R L  FM+++HT E GYTEV  P LV D AM+  GQ+PKF  D F TTD   L+PTSEV 
Sbjct: 173 RGLASFMLEMHTKEFGYTEVFHPSLVNDLAMFNVGQLPKFTHDSFQTTDAMRLVPTSEVV 232

Query: 236 LTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDS 295
           LTNL ++  +   SLPLRFT  +  FRSEAGSAG+DTRGM+RQHQF K ELVSIT    S
Sbjct: 233 LTNLVANTNLHRNSLPLRFTAYSQCFRSEAGSAGQDTRGMIRQHQFSKVELVSITDASQS 292

Query: 296 FTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCST 355
             E ERMLS AEE+LKRL+L YRVV LCTGD+GFSA  +YD+EVW+  QN YREISSCS 
Sbjct: 293 NVELERMLSVAEEVLKRLELPYRVVLLCTGDMGFSASISYDIEVWMPAQNKYREISSCSN 352

Query: 356 CGNFQSRRMNSR--YRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           C +FQ+RRM ++  Y +  +K   F HTLNGS +A+GR + AI+ENY N+DG++TIP  L
Sbjct: 353 CKDFQARRMGAKCFYLEKQNKRSSFVHTLNGSALALGRTIAAIMENYQNSDGTITIPDAL 412

Query: 414 RPYMN 418
           R +M+
Sbjct: 413 RKFMS 417


>gi|190574986|ref|YP_001972831.1| seryl-tRNA synthetase [Stenotrophomonas maltophilia K279a]
 gi|229559993|sp|B2FKE4|SYS_STRMK RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|190012908|emb|CAQ46540.1| putative seryl-tRNA synthetase [Stenotrophomonas maltophilia K279a]
          Length = 426

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 210/427 (49%), Positives = 277/427 (64%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALK-KRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD   +R  P  L   L+  R  E     + SL+   + +  + +++++ RNS S  IG
Sbjct: 1   MLDPALLRHQPADLAERLRTSRGFELDVSALESLEADRKRIQVRTQELQSLRNSRSKAIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA A+G    V A+  E +   ++L   E    E+   ++ +   IPN+P ++VP G   
Sbjct: 61  QAKAKGED--VSAIMAEVAAFADELKASEVALDELREKIEAISMGIPNLPADDVPAGADE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           N+N+     G          +H E+G   G +D + A KLSG+RF+VL G +A L RAL 
Sbjct: 119 NDNVEQSRWGTPRQFDFKVLDHVELGARNGWLDGETAAKLSGSRFTVLRGPIARLHRALA 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG---RWLIPTSEVSL 236
           QFM+DLHT EHGY E + PLLV  +++ GT Q+PKF DD+F T  G   R+LIPTSEV L
Sbjct: 179 QFMVDLHTGEHGYEETNVPLLVNADSLRGTSQLPKFEDDLFKTAVGDSTRYLIPTSEVPL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+   EI++++ LPLR T  +  FR+EAGS GRD RGM+RQHQF K ELVSI+R EDS 
Sbjct: 239 TNIVRDEIVDAERLPLRMTAHSMCFRAEAGSGGRDVRGMIRQHQFEKVELVSISRPEDSD 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            EH+RM  CAE +L++L L YR V LCTGD+GFSA KTYDLEVWL  Q  YREISSCS C
Sbjct: 299 AEHQRMTRCAEVVLEKLGLPYRKVLLCTGDMGFSAVKTYDLEVWLPSQETYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +R+R+P +   +  HTLNGSGVAVGR +IA++ENY NADGS+T+P  LRPY
Sbjct: 359 GDFQARRMQARWRNPATGKPELAHTLNGSGVAVGRAMIAVMENYQNADGSITVPEALRPY 418

Query: 417 MNNLAVI 423
           M  L  I
Sbjct: 419 MGGLETI 425


>gi|254524009|ref|ZP_05136064.1| seryl-tRNA synthetase [Stenotrophomonas sp. SKA14]
 gi|219721600|gb|EED40125.1| seryl-tRNA synthetase [Stenotrophomonas sp. SKA14]
          Length = 426

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 210/427 (49%), Positives = 276/427 (64%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALK-KRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD   +R  P  L   L+  R  E     + SL+   + +  + +++++ RNS S  IG
Sbjct: 1   MLDPALLRHQPADLAERLRTSRGFELDVSALESLEADRKRIQVRTQELQSLRNSRSKAIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA A+G    V A+  E +   ++L   E    E+   +  +   IPN+P ++VP G   
Sbjct: 61  QAKAKGED--VSAIMAEVAAFADELKASEVALDELREKIDAISMGIPNIPADDVPAGADE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           N+N+     G          +H E+G   G +D + A KLSG+RF+VL G +A L RAL 
Sbjct: 119 NDNVEQARWGTPRQFDFKVLDHVELGARNGWLDGETAAKLSGSRFTVLRGPIARLHRALA 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG---RWLIPTSEVSL 236
           QFM+DLHT EHGY E + PLLV  +++ GT Q+PKF DD+F T  G   R+LIPTSEV L
Sbjct: 179 QFMVDLHTGEHGYEETNVPLLVNADSLRGTSQLPKFEDDLFKTAVGDSTRYLIPTSEVPL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+   EI++++ LPLR T  +  FR+EAGS GRD RGM+RQHQF K ELVSI+R EDS 
Sbjct: 239 TNIVRDEIVDAERLPLRMTAHSMCFRAEAGSGGRDVRGMIRQHQFEKVELVSISRPEDSD 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            EH+RM  CAE +L++L L YR V LCTGD+GFSA KTYDLEVWL  Q  YREISSCS C
Sbjct: 299 AEHQRMTRCAEVVLEKLGLPYRKVLLCTGDMGFSAIKTYDLEVWLPSQETYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +R+R+P +   +  HTLNGSGVAVGR +IA++ENY NADGS+T+P  LRPY
Sbjct: 359 GDFQARRMQARWRNPATGKPELAHTLNGSGVAVGRAMIAVMENYQNADGSITVPEALRPY 418

Query: 417 MNNLAVI 423
           M  L  I
Sbjct: 419 MGGLETI 425


>gi|194366308|ref|YP_002028918.1| seryl-tRNA synthetase [Stenotrophomonas maltophilia R551-3]
 gi|238693459|sp|B4SP40|SYS_STRM5 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|194349112|gb|ACF52235.1| seryl-tRNA synthetase [Stenotrophomonas maltophilia R551-3]
          Length = 426

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 210/427 (49%), Positives = 276/427 (64%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALK-KRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD   +R  P  L   L+  R  E     + SL+   + +  + +++++ RNS S  IG
Sbjct: 1   MLDPALLRHQPADLAERLRTSRGFELDVSALESLEADRKRIQVRTQELQSLRNSRSKAIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA A+G    V A+  E +   ++L   E    E+   +  +   IPN+P ++VP G   
Sbjct: 61  QAKAKGED--VSAIMAEVAAFADELKASEVALDELREKIDAISMGIPNLPADDVPAGADE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           N+N+     G          +H E+G   G +D + A KLSG+RF+VL G +A L RAL 
Sbjct: 119 NDNVEQARWGTARQFDFKVLDHVELGARNGWLDGETAAKLSGSRFTVLRGPIARLHRALA 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG---RWLIPTSEVSL 236
           QFM+DLHT EHGY E + PLLV  +++ GT Q+PKF DD+F T  G   R+LIPTSEV L
Sbjct: 179 QFMVDLHTGEHGYEETNVPLLVNADSLRGTSQLPKFEDDLFKTAVGDSTRYLIPTSEVPL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+   EI++++ LPLR T  +  FR+EAGS GRD RGM+RQHQF K ELVSI+R EDS 
Sbjct: 239 TNIVRDEIVDAERLPLRMTAHSMCFRAEAGSGGRDVRGMIRQHQFEKVELVSISRPEDSD 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            EH+RM  CAE +L++L L YR V LCTGD+GFSA KTYDLEVWL  Q  YREISSCS C
Sbjct: 299 AEHQRMTRCAEVVLEKLGLPYRKVLLCTGDMGFSAVKTYDLEVWLPSQETYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +R+R+P +   +  HTLNGSGVAVGR +IA++ENY NADGS+T+P  LRPY
Sbjct: 359 GDFQARRMQARWRNPATGKPELAHTLNGSGVAVGRAMIAVMENYQNADGSITVPEALRPY 418

Query: 417 MNNLAVI 423
           M  L  I
Sbjct: 419 MGGLETI 425


>gi|254462156|ref|ZP_05075572.1| seryl-tRNA synthetase [Rhodobacterales bacterium HTCC2083]
 gi|206678745|gb|EDZ43232.1| seryl-tRNA synthetase [Rhodobacteraceae bacterium HTCC2083]
          Length = 430

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 204/429 (47%), Positives = 283/429 (65%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR N E  D AL +R   P SE IL++D   R  I+  E+ +A +N  S  +G 
Sbjct: 1   MHDIRAIRDNAETFDAALARRGDAPLSEQILAIDSARRSKIQAAEEAQAEQNKASKLVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  + L+   +  K  +  L +E     + L  +++ IPN+P  +VP G   +
Sbjct: 61  AKASGDEAEFERLRALVTEKKAAVAQLNEEAKAEDARLTDMLARIPNLPAVDVPDGADED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N  +R  G   +    ++EHFEI      MDFD A K+SGARF +L G +A + RAL Q
Sbjct: 121 DNKEVRLWGAPRTFNFDAKEHFEIAGVAASMDFDTAAKISGARFVMLKGPVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMID H  E+G TEV++P+LVRDEAMYGT ++PKF +D + TT+G WL+PTSEV LT   
Sbjct: 181 FMIDTHVDENGLTEVNSPVLVRDEAMYGTDKLPKFGEDSYQTTNGWWLVPTSEVPLTYSV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + ++++  +LP+R T     FRSEAGSAGRDT GMLRQHQF K E+VS+T  +DS  E +
Sbjct: 241 AGDVLDHSALPIRMTAHTLCFRSEAGSAGRDTSGMLRQHQFEKVEMVSVTHPDDSDAEQK 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML+CAE +L++L + YR + LCTGD+GF A +T+D+E WL GQN YREISS ST G+FQ
Sbjct: 301 RMLACAEGLLEKLGVPYRTILLCTGDMGFGAHRTFDIEAWLPGQNAYREISSVSTTGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++  +    +F HTLNGSG+AVGRCLIA+LEN    DGS+ +P VL PY+   
Sbjct: 361 ARRMNARFKPEDGGKPQFVHTLNGSGLAVGRCLIAVLENGQQTDGSIELPEVLAPYLGGK 420

Query: 421 AVIKKEHIL 429
           + +  + +L
Sbjct: 421 STLTADGVL 429


>gi|78355243|ref|YP_386692.1| seryl-tRNA synthetase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|123768909|sp|Q316Z9|SYS_DESDG RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|78217648|gb|ABB36997.1| seryl-tRNA synthetase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 427

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 204/424 (48%), Positives = 284/424 (66%), Gaps = 4/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++ ++ NPE +  AL KR+         +LD++ R L+ ++E +++ RN  S  + +
Sbjct: 1   MLDLKLLQNNPEVVAEALAKRNSGIDITLFTALDQRRRELLLEVEALKSERNKASGDVAR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G  +  DAL  +   L +++  L+ E   V + + + +  +PN+P E VP G   N
Sbjct: 61  MKRAGENA--DALIEKLGALSDRIKTLDAETETVKAEVHQWLISLPNIPHESVPAGADEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ + + G+KPS     +EH+EIG ALGL DF+R ++L+G+RF+VL    A LERAL  
Sbjct: 119 DNVFLHAWGEKPSFDFTPKEHWEIGPALGL-DFERGSRLTGSRFTVLWHWAAKLERALTA 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLTNL 239
           F +D+HT EHGY EV  P +V  + M GTGQ+PKF +D+F   D  + LIPT+EV LTNL
Sbjct: 178 FFLDVHTREHGYMEVYPPAMVNAQTMTGTGQLPKFEEDLFKLRDSEYYLIPTAEVPLTNL 237

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +S E++  + LP+ +T     FRSEAGS G+DT+G +RQHQF K E+V     E SF E 
Sbjct: 238 HSGEVVPEEKLPIAYTAQTQCFRSEAGSYGKDTKGFIRQHQFTKVEMVRFAHPEKSFEEL 297

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++ S AE +L++L LHYRVV+LC+GD+GFSA KTYDLEVWL GQ+ YREISSCS C +F
Sbjct: 298 EKLRSHAEVLLQKLGLHYRVVTLCSGDMGFSAAKTYDLEVWLPGQDKYREISSCSNCTDF 357

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N R R  ++K   F HTLNGSG+AVGR L+AILENY  ADGSV +P VLRPYM  
Sbjct: 358 QARRANIRTRLADAKKPVFLHTLNGSGLAVGRTLVAILENYQQADGSVVVPEVLRPYMGG 417

Query: 420 LAVI 423
           +A++
Sbjct: 418 VALL 421


>gi|227518153|ref|ZP_03948202.1| seryl-tRNA synthetase [Enterococcus faecalis TX0104]
 gi|257081307|ref|ZP_05575668.1| seryl-tRNA synthetase [Enterococcus faecalis E1Sol]
 gi|227074396|gb|EEI12359.1| seryl-tRNA synthetase [Enterococcus faecalis TX0104]
 gi|256989337|gb|EEU76639.1| seryl-tRNA synthetase [Enterococcus faecalis E1Sol]
          Length = 423

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 209/427 (48%), Positives = 284/427 (66%), Gaps = 7/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQ--SEYILSLDEKNRILIKKIEDIRARRNSNSAQI 58
           MLD++ +RQN + +   L+ R ++ +   E+ L LDE  R L+ K+E+++  RN  SA+I
Sbjct: 1   MLDVKMMRQNFDEVKAKLQTRGVKEEILVEF-LRLDESRRDLLVKVEEMKKYRNDVSAEI 59

Query: 59  GQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTS 118
            Q   + N     A   E   +   +  L+ E + +   L+ + + +PN+P   VP+G  
Sbjct: 60  AQL--KRNKEDATAKIAEMKEVGGNIKALDAEINAIDEELRGITTTLPNLPDASVPVGAG 117

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
             EN+ +R   +  +     + H+E+ E LG++DF+R  K++G+RF    G  A LERAL
Sbjct: 118 EEENVEVRRWSEPRTFAFEPKPHWEVAENLGILDFERGAKVAGSRFVYYKGLGARLERAL 177

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLT 237
             FM+DLH  EHGYTE+  P +V D AM+GTGQ PKF +D+F   D    LIPT+EV LT
Sbjct: 178 YNFMLDLHVYEHGYTEMITPYIVNDTAMFGTGQFPKFKEDVFQLQDTDLTLIPTAEVPLT 237

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           N Y++EI++ K LP+ FT L+PSFRSEAGSAGRDTRG++R HQF K E+V  +  E S+ 
Sbjct: 238 NYYNNEILDGKDLPIYFTALSPSFRSEAGSAGRDTRGLIRLHQFNKVEMVKFSDAEHSYE 297

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E E+M + AEEIL++L L YRV++L TGD+GFSA KTYDLEVW+  Q  YREISSCS C 
Sbjct: 298 ELEKMTNNAEEILQKLGLPYRVMALSTGDMGFSAAKTYDLEVWIPAQETYREISSCSNCE 357

Query: 358 NFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +FQ+RR   RYRD N K +++ HTLNGSG+AVGR + AILENY N DGSVT+P VL PYM
Sbjct: 358 DFQARRAMIRYRDENDK-VQYAHTLNGSGLAVGRTVAAILENYQNEDGSVTVPEVLVPYM 416

Query: 418 NNLAVIK 424
            NL VIK
Sbjct: 417 GNLTVIK 423


>gi|325915438|ref|ZP_08177752.1| seryl-tRNA synthetase [Xanthomonas vesicatoria ATCC 35937]
 gi|325538320|gb|EGD10002.1| seryl-tRNA synthetase [Xanthomonas vesicatoria ATCC 35937]
          Length = 426

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 211/427 (49%), Positives = 280/427 (65%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKK-RHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD   +RQ+P  L   L+  R     +  + SL+ + + +  + +++++ RNS S  IG
Sbjct: 1   MLDPALLRQHPADLAERLRSTRSFSLDTAELESLESERKRIQVRTQELQSMRNSKSKAIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA A+G    V AL  E +   ++L   E     + + L+ +   +PN+P  +VP+G   
Sbjct: 61  QAKAKGED--VAALMAEVAGFGDELKASEDALDVIRAKLETIALGLPNLPAADVPLGKDE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +EN+     G   S     ++H E+G   G +D + A KLSGARF+VL G +A L RAL 
Sbjct: 119 SENVEQSRWGTPRSFDFSVKDHVELGAPHGWLDGETAAKLSGARFTVLRGPIARLHRALA 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG---RWLIPTSEVSL 236
           QFM+DLH  EHGY E + PLLV  E+M GTGQ+PKF DD+F T  G   R+LIPTSEV L
Sbjct: 179 QFMLDLHVGEHGYEETNVPLLVNAESMRGTGQLPKFEDDLFQTEVGESRRYLIPTSEVPL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+   EI++++ LPLR T  +  FR+EAGS GRDTRGM+RQHQF K ELV+    +DS 
Sbjct: 239 TNIVRDEIVDAERLPLRMTAHSMCFRAEAGSGGRDTRGMIRQHQFEKVELVTACAPDDSD 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            EH+RM  CAE +L+RL L YR V LCTGD+GF+A KTYDLEVWL  QN YREISSCS C
Sbjct: 299 AEHQRMTRCAEVVLERLGLPYRKVLLCTGDMGFAAIKTYDLEVWLPSQNTYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +R+R+P S   +  H+LNGSG AVGR +IA++ENY NADGS+ +P VLRPY
Sbjct: 359 GDFQARRMQARWRNPASGKPELLHSLNGSGTAVGRAMIAVMENYQNADGSIDVPQVLRPY 418

Query: 417 MNNLAVI 423
           M  L  I
Sbjct: 419 MGGLERI 425


>gi|157829048|ref|YP_001495290.1| seryl-tRNA synthetase [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165933773|ref|YP_001650562.1| seryl-tRNA synthetase [Rickettsia rickettsii str. Iowa]
 gi|166223282|sp|A8GTQ7|SYS_RICRS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|189083581|sp|B0BV96|SYS_RICRO RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|157801529|gb|ABV76782.1| seryl-tRNA synthetase [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165908860|gb|ABY73156.1| seryl-tRNA synthetase [Rickettsia rickettsii str. Iowa]
          Length = 425

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 209/424 (49%), Positives = 285/424 (67%), Gaps = 5/424 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           ML+I+WIR+N E  D  L +R +EP S  I  LD + R +   I++++  R   S  +G 
Sbjct: 1   MLNIKWIRENKELFDEKLSQRFIEPMSSKIAMLDGEKRKITSLIQELQHARKVKSKILGN 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +A  +    + L+ +   + E+L  LE  +    + L +L++  PN+P EEVP G  A+
Sbjct: 61  -MASKSGEEFEGLQRDVKHINEKLEALE-HDLNNNNELNELLNMFPNIPDEEVPYGMDAS 118

Query: 121 ENILIRSVGK-KPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            N L+R+ G+  P+A  L+++HFE+G  L LMDF++  K+SG +F  L G LA LERAL 
Sbjct: 119 MNKLVRTYGETNPNA--LNKQHFELGIKLNLMDFEQTAKISGTKFVTLKGDLAKLERALI 176

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNL 239
            FMID+HT E  + E+S P+LVRD AMY  GQ+PKFA++ F TT+G  LIPT+EVSL N+
Sbjct: 177 NFMIDVHTKEWDFFEISPPVLVRDNAMYNAGQLPKFAEESFATTNGYRLIPTAEVSLVNM 236

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
            +  II  + LP+R+      FRSEAGS+GRDTRGM+R HQF K ELVSIT  E+S  EH
Sbjct: 237 VADTIIPREKLPIRYVAYTQCFRSEAGSSGRDTRGMIRLHQFGKVELVSITTPEESTNEH 296

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E + + +E IL++L+L YRV+ LCTGD+GF+A KTYD+EVWL GQ  YREI+SCS CG+F
Sbjct: 297 EYITNASETILQKLNLPYRVMLLCTGDMGFAAKKTYDIEVWLPGQKQYREIASCSNCGDF 356

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RRM +RY++  S      HTLN SG+ +GR ++AILENY N DGS+TIP VL  YM  
Sbjct: 357 QARRMKARYKEFGSNETTLVHTLNASGLPIGRTMVAILENYQNEDGSITIPDVLINYMGG 416

Query: 420 LAVI 423
           L  I
Sbjct: 417 LQKI 420


>gi|258405089|ref|YP_003197831.1| seryl-tRNA synthetase [Desulfohalobium retbaense DSM 5692]
 gi|257797316|gb|ACV68253.1| seryl-tRNA synthetase [Desulfohalobium retbaense DSM 5692]
          Length = 426

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 202/426 (47%), Positives = 285/426 (66%), Gaps = 7/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++++R++PE +  AL+KR+++   +   ++D K R  ++++ED+++RRN  S QIGQ
Sbjct: 1   MLDLKFVRKSPETVKDALRKRNMDLDLDAFQAIDAKRREYLQEVEDLKSRRNEVSKQIGQ 60

Query: 61  AIAEGNLS--LVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTS 118
               G  +  L+ A+      +KE   + ++ E EV    +  +  +PN+P   VP G  
Sbjct: 61  RKKNGEDAEDLIQAMGEAAERIKELDALAKEAEAEV----QDWMLSLPNIPDTSVPDGED 116

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
             +N  +R+ G  P+   L +EH+E+G  L  +DF+RA KL+G+RF+V  G  A LERAL
Sbjct: 117 DADNEELRTWGALPTFSFLPKEHWELGVQLSGLDFERAAKLTGSRFAVYWGWAAKLERAL 176

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLT 237
            QFM+D+ T+EH YTEV  P++V  + M GTGQ+PKF +D+F      + LIPT+EV LT
Sbjct: 177 AQFMLDIQTTEHDYTEVMPPVIVNSQTMRGTGQLPKFEEDLFKLEGWEYYLIPTAEVPLT 236

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           NL++ E+++ + LP  +    P FRSEAGS G+DT+G++RQHQF K ELV     + SF 
Sbjct: 237 NLHAGEVLDEQDLPRGYAAFTPCFRSEAGSYGKDTKGLIRQHQFNKVELVRFAHPDHSFE 296

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E E +L  AE +LKRL+L YRVV+LC GD+GFSA KTYDLEVWL GQ+ YREISSCS CG
Sbjct: 297 ELENLLGHAETVLKRLELPYRVVTLCGGDIGFSAVKTYDLEVWLPGQDTYREISSCSNCG 356

Query: 358 NFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +FQ+RR   R++   +K  +F HTLNGSG+AVGR L+A+LENY   DGSV IP  L+PYM
Sbjct: 357 DFQARRAGIRFKRAGAKKAEFLHTLNGSGLAVGRTLVAVLENYQQEDGSVAIPEALKPYM 416

Query: 418 NNLAVI 423
             L  I
Sbjct: 417 GGLERI 422


>gi|114767457|ref|ZP_01446244.1| seryl-tRNA synthetase [Pelagibaca bermudensis HTCC2601]
 gi|114540467|gb|EAU43548.1| seryl-tRNA synthetase [Roseovarius sp. HTCC2601]
          Length = 430

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 195/419 (46%), Positives = 271/419 (64%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D AL +R +EPQS  IL +DE+ R  I   E  +A +   +  +G 
Sbjct: 1   MHDIRAIRENPAAFDAALSRRGMEPQSPSILKIDEERRAAIHAAETAQADQKKAAKDVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A GN +  + L+      K ++  ++     + + L +L+  +PN+P ++VP G   +
Sbjct: 61  AKASGNEAEFERLRALVGAKKAEVSEMQDRAKALDAQLDELLMGLPNLPFDDVPDGADED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I   G   +     +EH+++      MDF+ A KLSG+RF VL+G +  + RAL Q
Sbjct: 121 DNVEIHRWGTPATFDFAPKEHYQLAAVQKGMDFETAAKLSGSRFVVLSGGVVRIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H  E+G TE   P+LVR+E MYGTGQ+PKF +D + T +G WL+PT+EV+LTN+ 
Sbjct: 181 FMLDTHVEENGLTETWTPVLVREEMMYGTGQLPKFGEDSYQTREGWWLVPTAEVTLTNIV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + E +E   LP R+      FRSEAGSAGRDT GMLRQHQF K E+VS+T  + S  E +
Sbjct: 241 NGETVEESYLPRRYVAHTQCFRSEAGSAGRDTSGMLRQHQFEKVEMVSVTHPDKSREELD 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CA+ IL++L L YR V LCTGD+GF A +T+D+EVWL GQN YREISS S CG+FQ
Sbjct: 301 RMTACAQGILEKLGLPYRTVVLCTGDIGFGARRTHDIEVWLPGQNTYREISSVSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           +RRMN+R++        + HTLNGSG+AVGRCLIA+LEN    DGSV +P  L P++  
Sbjct: 361 ARRMNARFKPAGGGKPDYVHTLNGSGLAVGRCLIAVLENGQQEDGSVKLPEALHPWLGG 419


>gi|21242403|ref|NP_641985.1| seryl-tRNA synthetase [Xanthomonas axonopodis pv. citri str. 306]
 gi|30173178|sp|Q8PLY2|SYS_XANAC RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|21107843|gb|AAM36521.1| seryl-tRNA synthetase [Xanthomonas axonopodis pv. citri str. 306]
          Length = 426

 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 211/427 (49%), Positives = 280/427 (65%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKK-RHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD   +RQ+P  L   L+  R     +  + SL+ + + +  + ++++++RNS S  IG
Sbjct: 1   MLDPALLRQHPADLAERLRSTRGFSLDTAELESLESERKRIQVRTQELQSQRNSKSKAIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA A+G    V AL  E +   ++L   E     + + L+ +   +PN+P E VP+G   
Sbjct: 61  QAKAKGED--VAALMAEVAGFGDELKASEDALDAIRAKLEGIALGLPNLPAEGVPLGKDE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +EN+     G         ++H E+G   G +D + A KLSGARF+VL G +A L RAL 
Sbjct: 119 SENLEQSRWGTPRQFDFAVKDHVELGAPHGWLDGETAAKLSGARFTVLRGPVARLHRALA 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG---RWLIPTSEVSL 236
           QFM+DLH  EHGY E + PLLV  ++M GTGQ+PKF DD+F T  G   R+LIPTSEV L
Sbjct: 179 QFMLDLHVGEHGYEETNVPLLVNADSMRGTGQLPKFEDDLFQTEVGESRRYLIPTSEVPL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+   EI++++ LPLR T  +  FR+EAGS GRDTRGM+RQHQF K ELV+    EDS 
Sbjct: 239 TNIVREEIVDAERLPLRMTAHSMCFRAEAGSGGRDTRGMIRQHQFEKVELVTACAPEDSD 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            EH+RM  CAE +L++L L YR V LCTGD+GFSA KTYDLEVWL  QN YREISSCS C
Sbjct: 299 AEHQRMTRCAEVVLEQLGLPYRKVLLCTGDMGFSAIKTYDLEVWLPSQNTYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +R+R+P S   +  HTLNGSG AVGR +IA++ENY NADGS+ +P VLRPY
Sbjct: 359 GDFQARRMQARWRNPVSGKPELLHTLNGSGTAVGRAMIAVMENYQNADGSIDVPQVLRPY 418

Query: 417 MNNLAVI 423
           M  +  I
Sbjct: 419 MGGIERI 425


>gi|328943493|ref|ZP_08240958.1| serine--tRNA ligase [Atopobium vaginae DSM 15829]
 gi|327491462|gb|EGF23236.1| serine--tRNA ligase [Atopobium vaginae DSM 15829]
          Length = 427

 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 201/425 (47%), Positives = 282/425 (66%), Gaps = 3/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKR-HLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+++R+NP+ +D +   R +     E    LDE  R  I ++E ++A RNS S QIG
Sbjct: 1   MLDIRFVRENPDVVDKSCASRQNAHWDREQFFELDELRRSTIVEVERLQAERNSASKQIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           + + EG      A K + +  K ++  LE++       L  L+S IPN+P E VP G   
Sbjct: 61  KLMQEGKKDEAQAAKEQVAAGKARIAELEEQRASAEKQLHDLVSAIPNIPHESVPYGKDD 120

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +EN  +R  G   S    +R H+++G    ++DFDR  KL+G+RF VL G+ A +ERAL 
Sbjct: 121 SENKEVRKWGTPRSFDFDARAHWDLGTQTHMIDFDRGVKLAGSRFYVLGGYGAQMERALI 180

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNL 239
            F ID+H +E G+ E   P+L   ++++GTGQ+PKF +D+F  ++  +LIPT+EV LTNL
Sbjct: 181 NFFIDMH-NEAGFKEWWPPVLTNYDSLFGTGQLPKFDEDLFHVSNDLYLIPTAEVMLTNL 239

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +  E++++  LPL++T   P FR EAGSAGRDTRG++R H+F K E+V   + EDS  + 
Sbjct: 240 HRDEVLDASQLPLKYTAFTPCFREEAGSAGRDTRGIIRVHEFDKVEMVKFAKPEDSMNQL 299

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E M++ AE+ L+ L L YRVVSLCTGD+GFSACK YDLEVWL   N Y+EISSCS C +F
Sbjct: 300 ESMVAEAEKCLQVLGLAYRVVSLCTGDIGFSACKCYDLEVWLPSYNNYKEISSCSNCWDF 359

Query: 360 QSRRMNSRYRDPNS-KSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           Q+RR N +YRDP+  K  ++ HTLNGSG+AVGRC+ AI+ENY NADGS+++P  L+PYM 
Sbjct: 360 QARRANIKYRDPSEFKGTRYVHTLNGSGLAVGRCMAAIMENYQNADGSISVPEALQPYMR 419

Query: 419 NLAVI 423
            L  I
Sbjct: 420 GLKTI 424


>gi|312880090|ref|ZP_07739890.1| seryl-tRNA synthetase [Aminomonas paucivorans DSM 12260]
 gi|310783381|gb|EFQ23779.1| seryl-tRNA synthetase [Aminomonas paucivorans DSM 12260]
          Length = 424

 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 203/420 (48%), Positives = 275/420 (65%), Gaps = 3/420 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++W+R + E     LK R+     + ++ ++E+ R ++ + E ++ARRN  S ++G 
Sbjct: 1   MLDLKWVRDHLEETRTFLKNRNHSFDLDGLMQVEERRRSVLGEAETLQARRNEGSRRVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G  S   A   E   L E++  LE E+  +  +L   +  IPN P E VP+G S  
Sbjct: 61  LRGRGEDS--SAAMEEMRLLGERVKELETEQKRLDEALVDRMLQIPNRPHESVPVGASEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N  +R  G   S     + H+E+GEALG++DF+R  +L+ +RF VL G  A LERAL Q
Sbjct: 119 DNPEVRRWGIPRSFPFEPKPHWELGEALGILDFERGVRLAESRFVVLKGWGARLERALTQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGRWLIPTSEVSLTNL 239
           FM+D HT  HG+ E++ P LV  + M GTGQ+PKFA+D++ C+ D  WLIPT+EV +TNL
Sbjct: 179 FMLDRHTQNHGFLEIAPPYLVNSKTMRGTGQLPKFAEDLYRCSNDDLWLIPTAEVPMTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           ++ EI++ K LPL +T   P FR EAG+ GRD +GMLR HQF K ELV + R EDS+ E 
Sbjct: 239 HAGEILQEKELPLYYTAYTPCFRREAGTYGRDMKGMLRVHQFDKVELVKLCRPEDSYEEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E +  CAE IL+ L+L +R + LCTGD+GFSA KTYDLEVW+  QN YREISSCS C +F
Sbjct: 299 ESLTRCAESILQDLELPFRTICLCTGDMGFSAAKTYDLEVWIPSQNCYREISSCSNCEDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           QSRRM++RYR       +F HTLNGSG+AVGRCLIA+LENY   DG+V IP  L PY+  
Sbjct: 359 QSRRMDTRYRPEGGGKPRFVHTLNGSGIAVGRCLIALLENYQEEDGAVRIPQALVPYLGG 418


>gi|238022770|ref|ZP_04603196.1| hypothetical protein GCWU000324_02681 [Kingella oralis ATCC 51147]
 gi|237865973|gb|EEP67109.1| hypothetical protein GCWU000324_02681 [Kingella oralis ATCC 51147]
          Length = 430

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/427 (47%), Positives = 284/427 (66%), Gaps = 9/427 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R +   +   L  R  E        L+ + ++L  + E+ +A+ N+ S QIG+
Sbjct: 1   MLDIQLLRNDLAGVAARLATRGFELDIAAFEQLENQRKVLQVQNEEAQAKVNTLSKQIGE 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            + +G     +A+K E + +K     L ++   + ++L  L+  IPN+P   VP+G    
Sbjct: 61  LMKQGKREEAEAVKAEVAQVKALQEQLNQDLPRIQAALDDLLLRIPNLPHSSVPVGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG   +     ++H ++G ALGL DF++A +LSGARFS++ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPKTFDFEVKDHVDLGAALGL-DFEKAAELSGARFSLMKGKVARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGYTE   P +V D A+ GTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTQQHGYTECYTPYIVSDAALLGTGQLPKFAEDLFHVTRGGDESKLSQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN+    I+  K LPL+FT  +P FRSEAGS G+DTRG++RQHQF K E+V + + E
Sbjct: 240 VTLTNIVRDTIVAEKDLPLKFTAHSPCFRSEAGSHGKDTRGLIRQHQFDKVEMVQVVQPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
           +S+   E M+S AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 NSYAALEEMVSHAENILKLLELPYRVITLCTGDMGFGAAKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++  + K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKGEDGKN-RLLHTLNGSGLAVGRTLVAVLENHQNADGSINIPQAL 418

Query: 414 RPYMNNL 420
           RPY+  L
Sbjct: 419 RPYLGGL 425


>gi|224368220|ref|YP_002602383.1| SerS [Desulfobacterium autotrophicum HRM2]
 gi|259511665|sp|C0QLD3|SYS_DESAH RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|223690936|gb|ACN14219.1| SerS [Desulfobacterium autotrophicum HRM2]
          Length = 427

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 206/428 (48%), Positives = 287/428 (67%), Gaps = 5/428 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           ML+I+++R+N E +  AL KR  +   E     ++K R L+++IE++R +RN+ S +I +
Sbjct: 1   MLEIKYVRENIEEVKQALAKRAGKADFEGFARAEKKRRELLQQIEELRHQRNTVSDEIAR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
                  +    L  E  T+ +++  L+K   E    +++ +  IPN+P  +VP+G S  
Sbjct: 61  MKRNKEDAGTSIL--EMRTVSDEIKTLDKTLAEQDDFIQQFMMAIPNMPHPDVPMGASDA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N L + VG   S     + H++IGE LG++DF RA K++GARFS+  G  A LERAL  
Sbjct: 119 DNTLEKKVGTPRSFDFPIKAHWDIGEDLGILDFPRAAKITGARFSLYLGSGAKLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGR--WLIPTSEVSLTN 238
           FM+DLHT+EHGYTE   P +V  E++ GTGQ+PKF +D+F   +G+  +LIPTSEV +TN
Sbjct: 179 FMLDLHTNEHGYTETLPPFIVNRESLLGTGQLPKFEEDLF-KIEGQEYYLIPTSEVPMTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           +Y  E++  ++LP++FT   P FRSEAGS G+DTRG++RQHQF K ELV  T  E S+ E
Sbjct: 238 IYRDEVLNEENLPIKFTAYTPCFRSEAGSYGKDTRGLIRQHQFNKVELVKYTTPETSYQE 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E +L+ AE +LKRL L Y+VV+LC+GDLGFSA +TYD+EVW+ GQ+ YREISSCS C  
Sbjct: 298 LESLLANAETVLKRLGLPYQVVTLCSGDLGFSATRTYDIEVWMPGQDKYREISSCSNCEA 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N ++R    K L+F HTLNGSG+AVGR + AILEN+   DGSV IP VLRPYM 
Sbjct: 358 FQARRANIKFRRAGQKKLEFVHTLNGSGLAVGRTVAAILENFQQPDGSVVIPEVLRPYMG 417

Query: 419 NLAVIKKE 426
               I  E
Sbjct: 418 GKETITNE 425


>gi|163736768|ref|ZP_02144187.1| seryl-tRNA synthetase [Phaeobacter gallaeciensis BS107]
 gi|161390638|gb|EDQ14988.1| seryl-tRNA synthetase [Phaeobacter gallaeciensis BS107]
          Length = 430

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 203/419 (48%), Positives = 277/419 (66%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D AL +R     S  IL+LDE  R  I+  E  +A +N  +  IG 
Sbjct: 1   MHDIRAIRENPAAFDAALARRGDAAMSSDILALDESRRAKIQAAETAQADQNKAAKAIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G  +  + L+ E +  K ++  L+ E  E+ + L  +++ IPN+P E+VP G   +
Sbjct: 61  AKAKGEDAEFERLRAEVAGKKAEVAALQTEAKELDAKLTDVLARIPNLPAEDVPAGADED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G  P+     +EHFEI      MDF+ A K+SGARF +L G +A + RAL Q
Sbjct: 121 DNVEVSKWGALPNFAFDPKEHFEIKGVAAAMDFETAAKISGARFVLLKGAVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H  E+G TEV++P+LVRDEAMYGT ++PKF DD + TT+G WL+PTSEV LT   
Sbjct: 181 FMVDTHVDENGLTEVNSPVLVRDEAMYGTDKLPKFGDDSYQTTNGWWLVPTSEVPLTYSV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + + ++  +LP+R T     FRSEAGSAG+DT GMLRQHQF K E+VS+     S  E +
Sbjct: 241 AGDTLDEAALPIRMTAHTLCFRSEAGSAGKDTSGMLRQHQFEKVEMVSVVHPTQSDDEQK 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML CAE IL++L + YR V LCTGD+GF A +T+D+E W+ GQN YREISS ST G+FQ
Sbjct: 301 RMLRCAEGILEKLGIPYRTVVLCTGDMGFGARRTFDIEAWVPGQNTYREISSVSTTGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           +RRMN+R++  +    ++ HTLNGSG+AVGRCLIA+LEN    DGSV +P VL PY+  
Sbjct: 361 ARRMNARFKPADGGKPEYLHTLNGSGLAVGRCLIAVLENGQQEDGSVKLPEVLAPYLGG 419


>gi|328954851|ref|YP_004372184.1| seryl-tRNA synthetase [Coriobacterium glomerans PW2]
 gi|328455175|gb|AEB06369.1| seryl-tRNA synthetase [Coriobacterium glomerans PW2]
          Length = 433

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 198/426 (46%), Positives = 286/426 (67%), Gaps = 2/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++++R+ P+ +D A+  R           LD + R LI ++E+++A RN+ S +IG 
Sbjct: 1   MLDMKFVREMPDEIDAAMAARQTSWDRARFFELDGRRRALICRVEELQATRNAESKKIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            + +G     +A K+    + ++  +L  E   +   L++ ++ +PN+P    P+G+  +
Sbjct: 61  LMRQGQREQAEAAKDAVRAIGDEAAVLNDELGAIDDELERFMARLPNIPAATTPVGSDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+  R     P+     R H+E+G  LG++DFDR +KLSGARF+VL G  A L+RAL  
Sbjct: 121 DNVECRRWSTPPAFAFDPRPHWELGVDLGILDFDRGSKLSGARFTVLAGAGAALDRALQS 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           F ++ H + HG+TE   P++V  E MYGTGQ+PKF +D +   D ++LIPT+EV+LTNL+
Sbjct: 181 FFLNTHIA-HGFTEFIPPVIVNREIMYGTGQLPKFEEDAYHVGDDQFLIPTAEVALTNLH 239

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + E+++  SLPLR+T   P FR EAGSAGRDTRG++RQH+F K E+V   R E+S  E E
Sbjct: 240 AGEVLDGASLPLRYTAGTPCFREEAGSAGRDTRGIIRQHEFTKVEMVKFARPEESDDELE 299

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
            M + AE +L++L+L YRV+SLCTGDLGFSA +TYD+EVWL   N Y+EISSCS CG+FQ
Sbjct: 300 SMTAEAELLLQQLELPYRVISLCTGDLGFSARQTYDIEVWLPSYNAYKEISSCSNCGDFQ 359

Query: 361 SRRMNSRYRDPNS-KSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           +RR + RYRDP   K  +F HTLNGSG+  GR + AI+ENY N DGS+T+P VLRPYM  
Sbjct: 360 ARRASIRYRDPERFKGTRFVHTLNGSGLPTGRTMAAIMENYQNEDGSITVPEVLRPYMGG 419

Query: 420 LAVIKK 425
           L  I++
Sbjct: 420 LERIEQ 425


>gi|163743213|ref|ZP_02150595.1| seryl-tRNA synthetase [Phaeobacter gallaeciensis 2.10]
 gi|161383630|gb|EDQ08017.1| seryl-tRNA synthetase [Phaeobacter gallaeciensis 2.10]
          Length = 430

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 204/429 (47%), Positives = 281/429 (65%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D AL +R     S  IL+LDE  R  I+  E  +A +N  +  IG 
Sbjct: 1   MHDIRAIRENPAAFDAALARRGDAAMSSDILALDESRRAKIQAAETAQADQNKAAKAIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+ +  + L+ E +  K ++  L+ E  E+ + L  +++ IPN+P E+VP G   +
Sbjct: 61  AKAKGDDAEFERLRAEVAGKKAEVAALQTEAKELDAKLTDVLARIPNLPAEDVPQGADED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G  P+     +EHF+I      MDF+ A K+SGARF +L G +A + RAL Q
Sbjct: 121 DNVEVSKWGAIPNFAFDPKEHFDIKGVSAAMDFETAAKISGARFVLLKGAVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H  E+G TEV++P+LVRDEAMYGT ++PKF DD + TT+G WL+PTSEV LT   
Sbjct: 181 FMVDTHVDENGLTEVNSPVLVRDEAMYGTDKLPKFGDDSYQTTNGWWLVPTSEVPLTYSV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + + ++  +LP+R T     FRSEAGSAG+DT GMLRQHQF K E+VS+     S  E +
Sbjct: 241 AGDTLDEAALPIRMTAHTLCFRSEAGSAGKDTSGMLRQHQFEKVEMVSVVHPTQSDDEQK 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML CAE IL++L + YR V LCTGD+GF A +T+D+E W+ GQN YREISS ST G+FQ
Sbjct: 301 RMLRCAEGILEKLGIPYRTVVLCTGDMGFGARRTFDIEAWVPGQNTYREISSVSTTGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++  +    ++ HTLNGSG+AVGRCLIA+LEN    DGSV +P VL PY+   
Sbjct: 361 ARRMNARFKPADGGKPEYLHTLNGSGLAVGRCLIAVLENGQQEDGSVKLPEVLAPYLGGR 420

Query: 421 AVIKKEHIL 429
             +  E  L
Sbjct: 421 LSLTAEGAL 429


>gi|253996801|ref|YP_003048865.1| seryl-tRNA synthetase [Methylotenera mobilis JLW8]
 gi|253983480|gb|ACT48338.1| seryl-tRNA synthetase [Methylotenera mobilis JLW8]
          Length = 424

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 210/426 (49%), Positives = 282/426 (66%), Gaps = 7/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R + + +   L+ R  E  +    +L+++ + +    +D++A+RN+ S QIG 
Sbjct: 1   MLDIQALRNDLDGVVSQLQVRGFEFDAAKFSALEQERKTVQTNTQDLQAKRNNASKQIGF 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A ++G    V A+  E + L EQL   E    E+ + L+ L+  +PN+P   VP G S  
Sbjct: 61  AKSKG--EDVSAIMAEVAGLGEQLKAGEVRLAELQADLQSLLLNVPNLPHVSVPQGKSEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R VG   +     ++H ++G  LGL DFD  TKLSGARF+++ G +A + RAL Q
Sbjct: 119 DNVEVRKVGTPRTFDFEVKDHTDVGTPLGL-DFDTGTKLSGARFTLMRGQIAKMHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT--DGR-WLIPTSEVSLT 237
           FM+D  T +HGY E   P LV  E + GTGQ+PKF +D+F     D + +LIPTSEV+LT
Sbjct: 178 FMLDTQTEQHGYEECYTPYLVNAETLTGTGQLPKFEEDLFSLAHNDSKLYLIPTSEVTLT 237

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           N    EI+  +SLP++ T   P FRSEAGS GRDT+GM+RQHQF K E+V I   E S+ 
Sbjct: 238 NTVRDEIVPLESLPIKLTAHTPCFRSEAGSYGRDTKGMIRQHQFDKVEMVQIVHPETSYQ 297

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
             E M+  AE +LK L L YRVVSLCTGD+GF A KTYDLEVWL  QN YREISS S C 
Sbjct: 298 ALEEMVGHAENVLKALGLPYRVVSLCTGDMGFGAAKTYDLEVWLPAQNTYREISSVSNCE 357

Query: 358 NFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
            FQ+RR+ +R+R+ + K  +  HTLNGSG+AVGR L+A+LENY NADGSVT+P VLRPYM
Sbjct: 358 AFQARRLQARFRNESGKP-ELVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPEVLRPYM 416

Query: 418 NNLAVI 423
           NNLAV+
Sbjct: 417 NNLAVM 422


>gi|319787313|ref|YP_004146788.1| seryl-tRNA synthetase [Pseudoxanthomonas suwonensis 11-1]
 gi|317465825|gb|ADV27557.1| seryl-tRNA synthetase [Pseudoxanthomonas suwonensis 11-1]
          Length = 425

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 209/426 (49%), Positives = 275/426 (64%), Gaps = 5/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R         L +R     ++ + SL+ + + +  + ++++  RN+ S  IGQ
Sbjct: 1   MLDPSLLRSQIAATAERLARRGYALDTQALESLEAERKAIQVRTQELQNLRNTRSKAIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G    V AL  E +   ++L   E    E+   L  +   IPN+P ++VP+G    
Sbjct: 61  AKAKGED--VSALLAEVAGFGDELKASEARLEEIRGRLDAITQGIPNLPADDVPVGADEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+     G   S    +R+H E+G   G +D D A KLSGARF+VL G LA L RAL Q
Sbjct: 119 GNVEQHRHGTPRSFEFEARDHVELGARNGWLDADTAAKLSGARFTVLRGQLARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG---RWLIPTSEVSLT 237
           FM+DLHT EHGY E + P++V  +++ GTGQ+PKF +D+F T  G   R+LIPTSEV LT
Sbjct: 179 FMLDLHTGEHGYEETNVPVIVNADSLRGTGQLPKFEEDLFSTELGEHRRYLIPTSEVPLT 238

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           N+    I++   LPLR T  +  FRSEAGS GRD RGM+RQHQF K ELVSITR E+S  
Sbjct: 239 NIVRDGILDGDKLPLRMTAHSMCFRSEAGSGGRDVRGMIRQHQFEKVELVSITRPEESDA 298

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           EHERM  CAE +L++L L YR + LCTGD+GFSA KTYDLEVWL  Q+ YREISSCS CG
Sbjct: 299 EHERMTRCAEVVLEKLGLPYRRMLLCTGDMGFSARKTYDLEVWLPSQHTYREISSCSNCG 358

Query: 358 NFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +FQ+RRM +R+R+P +   +  HTLNGSGVAVGR LIA++ENY NADGS+ +P VL+PYM
Sbjct: 359 DFQARRMQARWRNPATGKPELVHTLNGSGVAVGRALIAVMENYQNADGSIDVPEVLQPYM 418

Query: 418 NNLAVI 423
                I
Sbjct: 419 GGATRI 424


>gi|229587145|ref|YP_002845646.1| seryl-tRNA synthetase [Rickettsia africae ESF-5]
 gi|259511679|sp|C3PLR3|SYS_RICAE RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|228022195|gb|ACP53903.1| Seryl-tRNA synthetase [Rickettsia africae ESF-5]
          Length = 425

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 209/424 (49%), Positives = 283/424 (66%), Gaps = 5/424 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           ML+I+WIR+N E  D  L +R +EP S  I  LD K R +   I++ +  R   S  +G 
Sbjct: 1   MLNIKWIRENKELFDEKLSQRFIEPMSSKIAMLDGKKRKITSLIQEFQHARKVKSKILGN 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +A  +    + L+ +   + E+L  LE+E +      + L +  PN+P EEVP G   +
Sbjct: 61  -MASKSGEEFEGLQRDVKHINEKLEALEQELNNNNELNELL-NMFPNIPDEEVPYGMDES 118

Query: 121 ENILIRSVGK-KPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            N L+R+ G+  P+A  L+++HFE+G  L LMDF++  K+SG RF  L G LA LERAL 
Sbjct: 119 MNKLVRTYGETNPNA--LNKQHFELGIKLNLMDFEQTAKISGTRFVTLKGDLAKLERALI 176

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNL 239
            FMID+HT E  + E+S P+LVRD AMY  GQ+PKFA++ F TT+G  LIPT+EVSL N+
Sbjct: 177 NFMIDVHTKEWDFFEISPPVLVRDNAMYNAGQLPKFAEESFATTNGYRLIPTAEVSLVNM 236

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
            +  II  + LP+R+    P FRSEAGS+G+DTRGM+R HQF K ELVSIT  E+S  EH
Sbjct: 237 VADTIIPREKLPIRYVAYTPCFRSEAGSSGKDTRGMIRLHQFGKVELVSITTPEESTNEH 296

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E + + +E IL++L+L YRV+ LCTGD+GF+A KTYD+E+WL GQ  YREI+SCS CG+F
Sbjct: 297 EYITNASETILQKLNLPYRVMLLCTGDMGFAAKKTYDIEIWLPGQKQYREIASCSNCGDF 356

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RRM +RY++  S      HTLN SG+ +GR ++AILENY N DGS+TIP VL  YM  
Sbjct: 357 QARRMKARYKEFGSNETTLVHTLNASGLPIGRTMVAILENYQNEDGSITIPDVLINYMGG 416

Query: 420 LAVI 423
           L  I
Sbjct: 417 LQKI 420


>gi|289662416|ref|ZP_06483997.1| seryl-tRNA synthetase [Xanthomonas campestris pv. vasculorum
           NCPPB702]
 gi|289667711|ref|ZP_06488786.1| seryl-tRNA synthetase [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 426

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 210/427 (49%), Positives = 280/427 (65%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKK-RHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD   +RQ+P  L   L+  R     +  + SL+ + + L  + ++++++RNS S  IG
Sbjct: 1   MLDPALLRQHPADLAERLRSTRSFSLDTAELESLESERKRLQVRTQELQSQRNSKSKAIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
            A A+G    V AL  E +   ++L   E     + + L+ +   +PN+P ++VP+G   
Sbjct: 61  HAKAKGED--VAALMAEVAGFGDELKASEDALDAIRAKLEIIALGLPNLPADDVPLGKDE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +EN+     G         ++H E+G   G +D + A KLSGARF+VL G +A L RAL 
Sbjct: 119 SENVEQSRWGTPRQFDFEVKDHVELGAPHGWLDGETAAKLSGARFTVLRGPVARLHRALA 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG---RWLIPTSEVSL 236
           QFM+DLH  EHGY E + PLLV  ++M GTGQ+PKF DD+F T  G   R+LIPTSEV L
Sbjct: 179 QFMLDLHVGEHGYEETNVPLLVNADSMRGTGQLPKFEDDLFQTEVGESRRYLIPTSEVPL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+   EI++++ LPLR T  +  FR+EAGS GRDTRGM+RQHQF K ELV+    EDS 
Sbjct: 239 TNIVRDEIVDAERLPLRMTAHSMCFRAEAGSGGRDTRGMIRQHQFEKVELVTACAPEDSD 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            EH+RM  CAE +L++L L YR V LCTGD+GFSA KTYDLEVWL  QN YREISSCS C
Sbjct: 299 AEHQRMTRCAELVLEQLGLPYRKVLLCTGDMGFSAIKTYDLEVWLPSQNTYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +R+R+P S   +  HTLNGSG AVGR +IA++ENY NADGS+ +P VLRPY
Sbjct: 359 GDFQARRMQARWRNPVSGKPELLHTLNGSGTAVGRAMIAVMENYQNADGSIDVPQVLRPY 418

Query: 417 MNNLAVI 423
           M  +  I
Sbjct: 419 MGGIERI 425


>gi|325295343|ref|YP_004281857.1| Seryl-tRNA synthetase [Desulfurobacterium thermolithotrophum DSM
           11699]
 gi|325065791|gb|ADY73798.1| Seryl-tRNA synthetase [Desulfurobacterium thermolithotrophum DSM
           11699]
          Length = 428

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 202/421 (47%), Positives = 278/421 (66%), Gaps = 4/421 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLE--PQSEYILSLDEKNRILIKKIEDIRARRNSNSAQI 58
           M+DI+ +R+ PE +   L +R  +     + +L++D + R +I ++ED++A+RN  S +I
Sbjct: 1   MIDIKLLRKEPEKVKELLSRRDKKYIAMVDELLAVDSERRAIISEVEDLKAKRNKYSKEI 60

Query: 59  GQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTS 118
           G+   EG       LK+E   + E++  LEKE  ++    ++LI  IPN P   VPIG  
Sbjct: 61  GKLFKEGRKEEALKLKSEVEKISERIVSLEKELTDIEKKFERLILSIPNPPHVSVPIGED 120

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
             +N++IR  G+KP        H++I + L ++DF+RATKL+G+RF +     A LERAL
Sbjct: 121 EEDNVVIRYWGEKPEFCFEPLPHWDIAKELNILDFERATKLAGSRFVIYKKWGAKLERAL 180

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGRWLIPTSEVSLT 237
             FM+DLHTS HGY E+  P LV  + M GTGQ+PKF +D++    +  WLIPT+EV LT
Sbjct: 181 INFMLDLHTSNHGYEEIIPPFLVNTKTMTGTGQLPKFEEDLYKIENEDLWLIPTAEVPLT 240

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           N+++ EI+  K LP  +T   P FR EAG+ GRD RG++R HQF K ELV I   E S+ 
Sbjct: 241 NIHAGEILPEKELPKYYTAYTPCFRREAGAHGRDVRGIMRLHQFNKVELVKIVHPETSYE 300

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E E+++  AE++L+ L LHYRVV LCTGDLGFSA KTYD+EVW+  QN YREISSCS C 
Sbjct: 301 ELEKLVREAEKVLQLLGLHYRVVELCTGDLGFSAAKTYDIEVWIPSQNKYREISSCSNCE 360

Query: 358 NFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +FQ+RR   R+RD N K+ +F HTLNGSG+AVGR +IAILE Y   DGSV +P VLR Y+
Sbjct: 361 DFQARRAKIRFRDKNGKT-RFVHTLNGSGLAVGRTVIAILEQYQQEDGSVIVPEVLRDYI 419

Query: 418 N 418
            
Sbjct: 420 K 420


>gi|139438647|ref|ZP_01772131.1| Hypothetical protein COLAER_01130 [Collinsella aerofaciens ATCC
           25986]
 gi|133775727|gb|EBA39547.1| Hypothetical protein COLAER_01130 [Collinsella aerofaciens ATCC
           25986]
          Length = 436

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 197/425 (46%), Positives = 280/425 (65%), Gaps = 2/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+++R+NP+ +D+A+  R      E    LD++ R +I ++E+++A RN+ S +IG 
Sbjct: 10  MLDIKFVRENPDAIDVAMANRQTSWDREKFFELDDERRAVITEVEELQATRNAESKKIGA 69

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            + EG     +A K     + E++  L +    +       ++ +PN+P E  P G   +
Sbjct: 70  LMKEGKKDEAEAAKEAVRAVNEKIDGLAERRTALEQEQYDFMAHLPNIPCEATPYGKDED 129

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           ENI  R  G         + H+++G  L ++DF+R  KLSG+RF+VL G  A LERAL  
Sbjct: 130 ENIERRRWGTPREFDFDFKPHWDLGTDLDILDFERGNKLSGSRFTVLGGAGARLERALIN 189

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           F +D HTS  G+ E   P++V+ + M+GTGQ+PKF DD +  +   +LIPT+EV LTNL+
Sbjct: 190 FFLDTHTS-RGFKEWWPPIVVKRQTMFGTGQLPKFEDDAYHVSGDNFLIPTAEVVLTNLH 248

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + E++++ +LP R+T   P FR EAGSAGRDTRG++RQH+F K E+V   + E+S  E E
Sbjct: 249 AGEVLDADTLPRRYTAFTPCFREEAGSAGRDTRGIIRQHEFDKVEMVKFAKPEESDEELE 308

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
            M + AE +L++L L YRV+SLCTGDLGFSA +TYD+EVWL   N Y+EISSCS CG+FQ
Sbjct: 309 SMTAEAEYLLQQLGLPYRVISLCTGDLGFSARQTYDVEVWLPSYNAYKEISSCSNCGDFQ 368

Query: 361 SRRMNSRYRDP-NSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           +RR N +YRDP N K  ++ HTLNGSG+  GR + AILENY NADG++TIP VLRPYM  
Sbjct: 369 ARRANIKYRDPENFKGSRYLHTLNGSGLPAGRTMAAILENYQNADGTITIPEVLRPYMGG 428

Query: 420 LAVIK 424
           L  I+
Sbjct: 429 LEKIE 433


>gi|258544668|ref|ZP_05704902.1| serine--tRNA ligase [Cardiobacterium hominis ATCC 15826]
 gi|258520086|gb|EEV88945.1| serine--tRNA ligase [Cardiobacterium hominis ATCC 15826]
          Length = 426

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 212/428 (49%), Positives = 282/428 (65%), Gaps = 9/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKR-HLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           M+D + +RQ+   +   L+ R +  P  EY   L++  +    K E ++A RNS SAQIG
Sbjct: 1   MIDSKLLRQDAAAIAARLQSRGYTFPLDEY-QRLEDARKTAQVKAEQLQATRNSLSAQIG 59

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA   G  +  DAL  + + L  +    E++  E+ ++L  L++ +PN P E VP+G   
Sbjct: 60  QAKKNGENA--DALMAQVAALDSEQKDSEQQYAEIQNALDALLATVPNPPHESVPVGKDE 117

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+ +R  G         +EH ++ E +GL DFD   KL+GARF+VL G LA L RA+ 
Sbjct: 118 DDNLEVRRWGTPRVFDFPPKEHADL-ENIGL-DFDAGAKLAGARFTVLRGDLARLHRAIA 175

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGR---WLIPTSEVSL 236
           QFM+D HT + GYTE+  P L   +A++GTGQ+PKF +D+F T  G    +LIPTSEVSL
Sbjct: 176 QFMLDTHTRDEGYTEMYVPYLANAQALFGTGQLPKFEEDLFKTALGERHFYLIPTSEVSL 235

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TNL +  ++E   LPL +T   P FRSEAGS GRD RGM+RQHQF K E+V I   E S+
Sbjct: 236 TNLVADSVLEEADLPLYYTAHTPCFRSEAGSHGRDVRGMIRQHQFDKVEMVKIVAPETSY 295

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            E E++ + AE IL++L+L YRVV LCTGD+GFSA KTYDLEVWL GQ  YREISSCS C
Sbjct: 296 DELEKLTANAENILQKLNLPYRVVLLCTGDMGFSAAKTYDLEVWLPGQGKYREISSCSNC 355

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
            +FQ+RRM +RYR  +SK  +  HTLNGSG+AVGR L+AILENY NADGS+TIP  L PY
Sbjct: 356 TDFQARRMQARYRPKDSKKPQPVHTLNGSGLAVGRTLVAILENYQNADGSITIPEALLPY 415

Query: 417 MNNLAVIK 424
           M  +  I+
Sbjct: 416 MGGITEIR 423


>gi|308186248|ref|YP_003930379.1| Seryl-tRNA synthetase [Pantoea vagans C9-1]
 gi|308056758|gb|ADO08930.1| Seryl-tRNA synthetase [Pantoea vagans C9-1]
          Length = 430

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 204/431 (47%), Positives = 273/431 (63%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   E + SL+E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGYKLDVETLRSLEERRKVLQVETENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E  E+ + ++     +PN+P +EVP+G   +
Sbjct: 61  AKARG--EDIEPLRQEVNALGERLDAAKAELDELQNQIRDFALALPNIPADEVPLGKDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN  +   G         ++H E+GEA   +DF  A KL+G+RF V+ G +A L RAL Q
Sbjct: 119 ENQEVSRWGTPREFSFQVKDHVELGEAAKGLDFAAAVKLTGSRFVVMQGQIARLHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FMIDLHT +HGY E   P LV  E +YGTGQ+PKF +D+F T        +    LIPT+
Sbjct: 179 FMIDLHTEQHGYLETYVPYLVNHETLYGTGQLPKFGEDLFHTRPLEEQSDSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI+E  SLP++ T   P FRSEAGS GRDTRG++R HQF K E+V I   
Sbjct: 239 EVPLTNLMRDEIVEEDSLPVKLTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVTP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E S    E +   AE++L+ L+L YR V LCTGD+GF + KTYDLEVWL  QN YREISS
Sbjct: 299 EQSMDALEELTGHAEKVLQLLNLPYRKVLLCTGDMGFGSTKTYDLEVWLPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS  G+FQ+RRM +RYR+   K  +  HTLNGSG+AVGR L+A+LENY   DG +T+P V
Sbjct: 359 CSNMGDFQARRMQARYRNKQEKKPRLVHTLNGSGLAVGRTLVAVLENYQQEDGRITVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN + VI
Sbjct: 419 LRPYMNGVDVI 429


>gi|327480895|gb|AEA84205.1| seryl-tRNA synthetase [Pseudomonas stutzeri DSM 4166]
          Length = 426

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 203/432 (46%), Positives = 280/432 (64%), Gaps = 16/432 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R  +     I +L+ + + +  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLVRTQLQDVAARLATRGYQLDVARIEALEAQRKTVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A   G      L+ VD + +E  + K++L         + S L +L+  IPN+P E VP+
Sbjct: 61  AKQRGEDIAPLLADVDRMGSELESGKQEL-------DRIQSELDQLMLSIPNLPHESVPV 113

Query: 116 GTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLE 175
           G    EN+ +R  G   +     ++H  +GE  G +DF+ A KLSGARF+++ G +A L 
Sbjct: 114 GADEEENVEVRRWGTPKAFDFPVQDHVALGEQHGWLDFETAAKLSGARFALMRGPIARLH 173

Query: 176 RALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIPT 231
           RAL QFMIDLHT EHGY E   P LV+  A+ GTGQ+PKF DD+F  + +G    +LIPT
Sbjct: 174 RALAQFMIDLHTREHGYEEAYTPYLVQAPALQGTGQLPKFEDDLFKISREGEADFYLIPT 233

Query: 232 SEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITR 291
           +EVSLTN+ + EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I  
Sbjct: 234 AEVSLTNIVAGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVE 293

Query: 292 EEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREIS 351
              SF   E +   AE++L+ L+L YRV+SLCTGD+GF A KTYDLEVW+  Q+ YREIS
Sbjct: 294 PSKSFEALEELTGNAEKVLQLLELPYRVLSLCTGDMGFGATKTYDLEVWVPSQDKYREIS 353

Query: 352 SCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPT 411
           SCS CG+FQ+RRM +RYR+P +   +  HTLNGSG+AVGR L+A+LENY  ADG + +P 
Sbjct: 354 SCSNCGDFQARRMQARYRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGRILVPE 413

Query: 412 VLRPYMNNLAVI 423
           VL+PYM  + VI
Sbjct: 414 VLKPYMGGIEVI 425


>gi|226941475|ref|YP_002796549.1| Sys [Laribacter hongkongensis HLHK9]
 gi|254783032|sp|C1DBY7|SYS_LARHH RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|226716402|gb|ACO75540.1| Sys [Laribacter hongkongensis HLHK9]
          Length = 426

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 206/423 (48%), Positives = 274/423 (64%), Gaps = 7/423 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R   + +   L  R     +E   +L+ + + L  + +D++ARRNS S Q+G+
Sbjct: 1   MLDIQLLRTQLDTVAARLAARGYTLDTEAFTALENERKALQTRTQDLQARRNSLSKQVGE 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G  +   A+  E S L ++L   E     +   L +L+  IPN+P E VP+G    
Sbjct: 61  AKRRGEDA--SAVLAEVSGLGDELKANEAALEGLQGRLAELLQAIPNLPHESVPVGRDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ IR VG   S     ++H +IG  LGL D +   KLSGARF+VL G +A L RAL Q
Sbjct: 119 GNVEIRRVGVPRSFDFQVKDHVDIGTPLGL-DAETGAKLSGARFTVLRGQMARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGR---WLIPTSEVSLT 237
           FM++ H  EHGYTEV  P +V   +MYGTGQ+PKF +D+F    G    +L+PT+EV +T
Sbjct: 178 FMLNTHADEHGYTEVYTPYMVNATSMYGTGQLPKFEEDLFRVPRGDENFYLVPTAEVPVT 237

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           N    EI+++  LPLR+    P FRSEAG+ GRDTRGM+RQHQF K ELV + R E+S  
Sbjct: 238 NFVRDEIVKAADLPLRYVAHTPCFRSEAGAYGRDTRGMIRQHQFDKVELVQVVRPEESLN 297

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
             E +   AE ILK+L L YRV+ LCTGD+GF + KTYD+EVWL  Q+ YREISSCS+ G
Sbjct: 298 ALETLTGHAETILKKLGLPYRVIVLCTGDMGFGSQKTYDIEVWLPAQDTYREISSCSSMG 357

Query: 358 NFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +FQ+RRM +R++D   K+ +  HTLNGSG+AVGR L+A+LENY NADGSVT+P VLRPYM
Sbjct: 358 DFQARRMQARFKDEAGKN-QLVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPEVLRPYM 416

Query: 418 NNL 420
             L
Sbjct: 417 GGL 419


>gi|260575191|ref|ZP_05843191.1| seryl-tRNA synthetase [Rhodobacter sp. SW2]
 gi|259022451|gb|EEW25747.1| seryl-tRNA synthetase [Rhodobacter sp. SW2]
          Length = 429

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 216/430 (50%), Positives = 280/430 (65%), Gaps = 1/430 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D +L +R + P S  IL+ DE  R  I+  E  +A +N+ S  +G 
Sbjct: 1   MHDIRAIRENPAAFDASLARRGIAPLSPEILAHDEARRSAIQAAESAQAAQNTASKAVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A GN +  + L+   +  K ++  +    +     L+ L++ IPN+PL EVP G    
Sbjct: 61  AKAAGNDAEFERLRALVAEKKAEIAAMTTTANAEDLRLRDLLAGIPNLPLAEVPDGRDEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G   +     +EHFEI      MDF  A KLSGARF +L G +  + RALGQ
Sbjct: 121 DNVEVRRWGSPRNLSFTPKEHFEIKAVQPGMDFAAAAKLSGARFVLLRGAVLRVHRALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H +EHG TE   P+LV+DEAM+GTG +PKFA+D + TT+G WLIPT+EV+LTN  
Sbjct: 181 FMLDTHINEHGLTETWTPVLVKDEAMFGTGNLPKFAEDSYQTTNGWWLIPTAEVTLTNTV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++   LP+R   L   FRSEAGSAG+DT GMLRQHQF K E+VSIT  E S  EH+
Sbjct: 241 AGEILDDAQLPIRMCALTQCFRSEAGSAGKDTSGMLRQHQFEKVEMVSITTPEASLAEHD 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE IL++L L YR + LCTGD+GF + KT+DLEVWL GQN YREISS S CG+FQ
Sbjct: 301 RMTRCAEAILEKLGLPYRTIVLCTGDMGFGSQKTHDLEVWLPGQNTYREISSVSICGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R+R    K  +F HTLNGSG+AVGRCLIA+LEN    DGSV +P VL PY+   
Sbjct: 361 ARRMNARFRAQGGKP-EFVHTLNGSGLAVGRCLIAVLENGQQEDGSVDLPAVLHPYLGGN 419

Query: 421 AVIKKEHILE 430
             I     LE
Sbjct: 420 TRINAAGGLE 429


>gi|121635325|ref|YP_975570.1| seryl-tRNA synthetase [Neisseria meningitidis FAM18]
 gi|166222753|sp|A1KV93|SYS_NEIMF RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|120867031|emb|CAM10794.1| seryl-tRNA synthetase [Neisseria meningitidis FAM18]
 gi|325132820|gb|EGC55500.1| seryl-tRNA synthetase [Neisseria meningitidis M6190]
 gi|325138723|gb|EGC61275.1| seryl-tRNA synthetase [Neisseria meningitidis ES14902]
 gi|325198782|gb|ADY94238.1| seryl-tRNA synthetase [Neisseria meningitidis G2136]
          Length = 431

 Score =  405 bits (1040), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 204/431 (47%), Positives = 278/431 (64%), Gaps = 9/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L +R  +  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLARRGYDFDTARFDALEERRKSVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E+VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLEAVQKELDAWLLSIPNLPHEDVPFGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTLQHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIK 424
           +PYM  +A ++
Sbjct: 419 QPYMGGVAKLE 429


>gi|85703424|ref|ZP_01034528.1| seryl-tRNA synthetase [Roseovarius sp. 217]
 gi|85672352|gb|EAQ27209.1| seryl-tRNA synthetase [Roseovarius sp. 217]
          Length = 430

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 205/429 (47%), Positives = 274/429 (63%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+ P+  D AL +R L P +  IL+LDE  R  I   E  +A +N  S + G 
Sbjct: 1   MHDIRAIRETPDAFDAALARRGLAPVTPEILALDEARRTRIHAAETAQAEQNRASKEAGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G+ +  + L+   +  K ++  ++ E   +   L   +  +PN+P ++VP GT  +
Sbjct: 61  AKGRGDEAEFERLRALVADKKAEMAAMQAEAKALDMQLTDHLMALPNLPFDDVPDGTDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G         +EH+EI      MDF+ A KLSGARF VL+G +A L RAL Q
Sbjct: 121 GNVELRRWGTPAIFDFQPKEHYEITGVQPGMDFETAAKLSGARFVVLSGSIARLHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H  E+G  E   P+LVR E M GTGQ+PKF +D + TT+G WL+PT+EV+LTN+ 
Sbjct: 181 FMLDTHIEENGLQETWTPVLVRPEMMLGTGQLPKFGEDSYETTNGWWLVPTAEVTLTNIV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             E +E+ +LP R+      FRSEAGSAGRDT GMLRQHQF K E+VSIT  ++S  E +
Sbjct: 241 HGETVEAATLPRRYVAHTQCFRSEAGSAGRDTAGMLRQHQFEKVEMVSITHPDESRAELD 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE IL+RL L YR + LCTGD+GF A +T+D+EVWL GQN YREISS S CG+FQ
Sbjct: 301 RMTGCAEGILERLGLPYRTIVLCTGDMGFGARRTHDIEVWLPGQNTYREISSVSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++       +F HTLNGSG+AVGRCLIA+LEN   ADGSV IP  L PY+   
Sbjct: 361 ARRMNARFKPQGGGKPEFLHTLNGSGLAVGRCLIAVLENGQQADGSVRIPDALHPYLRGK 420

Query: 421 AVIKKEHIL 429
            ++  +  L
Sbjct: 421 TILNADGSL 429


>gi|157363097|ref|YP_001469864.1| seryl-tRNA synthetase [Thermotoga lettingae TMO]
 gi|166987318|sp|A8F3R6|SYS_THELT RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|157313701|gb|ABV32800.1| seryl-tRNA synthetase [Thermotoga lettingae TMO]
          Length = 424

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 206/419 (49%), Positives = 279/419 (66%), Gaps = 3/419 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           M+DI+ IR+ P+ +  AL+KR+ E +  + +LSLD + R L  +I  +RA+RNS S  + 
Sbjct: 1   MIDIRLIREKPDFVKKALEKRNYEKKMVDDLLSLDAQFRELTNQINQLRAQRNSISKMVA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA + G    ++ L  E   +  Q+  +E +  E+   ++KL+  +PN+P + VP G   
Sbjct: 61  QAKSSGKTEEIENLTEEGKKIGRQIDSIEDQLKEIKVQMEKLMLLVPNIPDDSVPEGKDE 120

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
             N  IR  G      +  + H+++G +LGLMDFDRA KLSG+RF+V+ G  A LERAL 
Sbjct: 121 TSNREIRKWGDPKKFDYNPQAHWDLGPSLGLMDFDRAAKLSGSRFTVMYGMFAKLERALT 180

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGRWLIPTSEVSLTN 238
            FM+D+HT EHGYTEV  P +V+ E M  TGQ+PKF ++ +    D  +LIPT+EV L  
Sbjct: 181 NFMLDMHTKEHGYTEVWLPHIVKRETMTITGQLPKFEEEAYRIEADDLFLIPTAEVPLVA 240

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L S+EI+E K LPL +T   P +R EAGS G+D RGM+RQHQF K ELV IT  E SF +
Sbjct: 241 LRSNEILEEKDLPLLYTAYTPCYRREAGSYGKDVRGMIRQHQFDKVELVWITTPERSFED 300

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E ++S AEE+L+RL+L YRV+ LC+GDLGF A KTYDLEVWL   N Y+EISSCS   +
Sbjct: 301 LETLVSHAEEVLRRLELPYRVIQLCSGDLGFGAAKTYDLEVWLPSYNSYKEISSCSNDTD 360

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           FQ+RR N RYR  + K + F HTLNGSGVAVGR L+AI+ENY  ADG + +P  L+PY+
Sbjct: 361 FQARRGNIRYRRKDGK-ISFVHTLNGSGVAVGRTLVAIIENYQRADGRIDVPKALQPYL 418


>gi|77409224|ref|ZP_00785933.1| seryl-tRNA synthetase [Streptococcus agalactiae COH1]
 gi|77172167|gb|EAO75327.1| seryl-tRNA synthetase [Streptococcus agalactiae COH1]
          Length = 425

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 204/426 (47%), Positives = 284/426 (66%), Gaps = 5/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILS-LDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IR + + +   L  R ++ ++   L  LD K R L+ K E+ +A+RN  SA I 
Sbjct: 1   MLDLKRIRTDFDAVAKKLATRGVDQETLTTLKELDIKRRELLIKSEEAKAQRNVASAAIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA  + N    D       TL   +  ++ E  +V ++L+ +++ +PN P ++VP+G   
Sbjct: 61  QA--KRNKENADEQITAMQTLSADIKAIDAELADVDANLQSMVTVLPNTPADDVPLGADE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +EN+ +R  G        ++ H+++GE+LG++D++R  K++G+RF    G  A LERA+ 
Sbjct: 119 DENVEVRRWGTPREFDFEAKAHWDLGESLGILDWERGAKVTGSRFLFYKGLGARLERAIY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLTN 238
            FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F   D  + LIPT+EV LTN
Sbjct: 179 SFMLDEHAKE-GYTEVIPPYMVNHDSMFGTGQYPKFKEDTFELADSPFVLIPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  EII+ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E+S+ E
Sbjct: 238 YYRDEIIDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESYQE 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M + AE IL++L+L YRV++LCTGD+GFSA KTYDLEVW+  QN YREISSCS   +
Sbjct: 298 LEKMTANAENILQKLNLPYRVITLCTGDMGFSAAKTYDLEVWIPAQNTYREISSCSNTED 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   RYRD     ++  HTLNGSG+AVGR + AILENY N DGSVTIP VLRPYM 
Sbjct: 358 FQARRAQIRYRDEVDGKVRLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVLRPYMG 417

Query: 419 NLAVIK 424
           N+ +IK
Sbjct: 418 NIDIIK 423


>gi|319744352|gb|EFV96713.1| serine--tRNA ligase [Streptococcus agalactiae ATCC 13813]
          Length = 425

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 204/426 (47%), Positives = 284/426 (66%), Gaps = 5/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILS-LDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IR + + +   L  R ++ ++   L  LD K R L+ K E+ +A+RN  SA I 
Sbjct: 1   MLDLKRIRTDFDAVAKKLATRGVDQETLTTLKELDIKRRELLIKAEEAKAQRNVASAAIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA  + N    D       TL   +  ++ E  +V ++L+ +++ +PN P ++VP+G   
Sbjct: 61  QA--KRNKENADEQIAAMQTLSADIKAIDAELADVDANLQSMVTVLPNTPADDVPLGADE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +EN+ +R  G        ++ H+++GE+LG++D++R  K++G+RF    G  A LERA+ 
Sbjct: 119 DENVEVRRWGTPREFDFEAKAHWDLGESLGILDWERGAKVTGSRFLFYKGLGARLERAIY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLTN 238
            FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F   D  + LIPT+EV LTN
Sbjct: 179 SFMLDEHAKE-GYTEVIPPYMVNHDSMFGTGQYPKFKEDTFELADSPFVLIPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  EII+ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E+S+ E
Sbjct: 238 YYRDEIIDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESYQE 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M + AE IL++L+L YRV++LCTGD+GFSA KTYDLEVW+  QN YREISSCS   +
Sbjct: 298 LEKMTANAENILQKLNLPYRVITLCTGDMGFSAAKTYDLEVWIPAQNTYREISSCSNTED 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   RYRD     ++  HTLNGSG+AVGR + AILENY N DGSVTIP VLRPYM 
Sbjct: 358 FQARRAQIRYRDEVDGKVRLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVLRPYMG 417

Query: 419 NLAVIK 424
           N+ +IK
Sbjct: 418 NIDIIK 423


>gi|325982390|ref|YP_004294792.1| seryl-tRNA synthetase [Nitrosomonas sp. AL212]
 gi|325531909|gb|ADZ26630.1| seryl-tRNA synthetase [Nitrosomonas sp. AL212]
          Length = 438

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 207/432 (47%), Positives = 285/432 (65%), Gaps = 15/432 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           ML+IQ +R + +++   L KR      E   +L+ K +I+  + ++++A+RN+ S +IGQ
Sbjct: 1   MLEIQQLRSDLDNVIRQLAKRGYVFPVETFNTLEAKRKIIQTQTQELQAQRNTTSKRIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A ++G    + A+  E + L + L + E +  ++  +L+K++  +PN+P   VP G    
Sbjct: 61  AKSKG--EDISAIMTEVTHLGDALKLAEDQLEQIQYNLQKILLEVPNLPHISVPDGKDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ IR  G+        ++H  IGE LGL+DF+ A KLSGARFS++ G LA L RAL Q
Sbjct: 119 GNVQIRHWGEPRQFDFAIKDHVSIGEGLGLLDFETAAKLSGARFSLMKGGLARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW------------L 228
           FM+D HT EHGYTE   P LV   ++ GTGQ+PKFA D+F  T G              L
Sbjct: 179 FMLDTHTLEHGYTETYVPYLVNRNSLRGTGQLPKFAQDLFAITAGDAESSSAGNISEYHL 238

Query: 229 IPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVS 288
           IPT+EV +TN+   EI+  +SLPL++ +  P FRSEAGS GRDTRG++RQHQF K ELV 
Sbjct: 239 IPTAEVPITNMVRDEIVPLQSLPLKYVSHTPCFRSEAGSYGRDTRGLIRQHQFDKVELVH 298

Query: 289 ITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYR 348
           I   + S+   E+++  AE+IL++L L YRV++LCTGD+GFSA KTYD+EVWL  QN YR
Sbjct: 299 IVHPDQSYDALEQLVGHAEKILQKLMLPYRVMALCTGDMGFSAAKTYDIEVWLPAQNTYR 358

Query: 349 EISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVT 408
           EISSCS C  FQ+RRM +R+R+ N K +   HTLNGSG+AVGR L+A+LENY NADGS+ 
Sbjct: 359 EISSCSNCEAFQARRMQARFRNENGKPM-LLHTLNGSGLAVGRTLVAVLENYQNADGSII 417

Query: 409 IPTVLRPYMNNL 420
           IP VLR YMN L
Sbjct: 418 IPEVLRSYMNGL 429


>gi|317120858|ref|YP_004100861.1| seryl-tRNA synthetase [Thermaerobacter marianensis DSM 12885]
 gi|315590838|gb|ADU50134.1| seryl-tRNA synthetase [Thermaerobacter marianensis DSM 12885]
          Length = 425

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 204/428 (47%), Positives = 283/428 (66%), Gaps = 8/428 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++++RQNPE +  AL++R L+P + + +L  D + R  ++++E++RARRN  S  IG
Sbjct: 1   MLDLRFVRQNPEVVREALRRRRLDPAELDALLDADARWRQDLQQLEELRARRNQTSEAIG 60

Query: 60  QAIAEGNLS--LVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGT 117
           +   EG  +  L+ A++    ++KE    LE+    +   ++  +  IP +P  +VP G 
Sbjct: 61  RLRREGADASELIAAMRQVGDSIKE----LEERVRGLEQEIQDRLLRIPMIPDPDVPEGD 116

Query: 118 SANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
            A++N+ +R  G  PS     + H+E+G ALGL+DF+RA K++GARF+V  G  A L RA
Sbjct: 117 DADDNVEVRRWGTPPSFDFTPKAHWELGPALGLLDFERAAKITGARFTVFRGRGARLVRA 176

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSL 236
           L QFM+DLHT EHGYTEV  P LV  ++M GTGQ+PKF +D F   D  + L+PT+EV +
Sbjct: 177 LIQFMLDLHTQEHGYTEVLPPFLVHRQSMVGTGQLPKFEEDAFRVADSDFFLVPTAEVPV 236

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TNLY  EI++   LP+      P FR+EAGSAGRDTRG++RQHQF K ELV     + S 
Sbjct: 237 TNLYRDEILDGAQLPIYHVAYTPCFRAEAGSAGRDTRGLIRQHQFDKVELVKFVHPDRSA 296

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            EHE++++ AE +L+RL L YR+V +CTGD+GF+  K YDLEVW+     Y EISSCS  
Sbjct: 297 EEHEKLVADAEAVLQRLGLPYRLVLICTGDMGFAQAKQYDLEVWMPSYGRYVEISSCSNY 356

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
            ++Q+RR N R+R       +F HTLNGSG+AVGR L A+LENY  ADGSV IP  LRPY
Sbjct: 357 RDYQARRANIRFRPEPGARPQFVHTLNGSGLAVGRTLAALLENYQQADGSVVIPEALRPY 416

Query: 417 MNNLAVIK 424
           M  L V+K
Sbjct: 417 MGGLDVLK 424


>gi|254512184|ref|ZP_05124251.1| seryl-tRNA synthetase [Rhodobacteraceae bacterium KLH11]
 gi|221535895|gb|EEE38883.1| seryl-tRNA synthetase [Rhodobacteraceae bacterium KLH11]
          Length = 430

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/429 (45%), Positives = 280/429 (65%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D AL +R   P S  +L LDE  R  I   E  +A +N  S ++G 
Sbjct: 1   MHDIRAIRENPAAFDAALARRGDAPMSSELLRLDESRRAKILAAETAQAEQNKASKEVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G+ +  + L+   +  K ++  ++ E  ++ + L   ++ I N+P ++VP G+  +
Sbjct: 61  AKGRGDEAEFERLRALVAEKKAEIARMQTEAKDLDALLTDQLARIANLPADDVPEGSDED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G   +     +EH+EI      MDF+ A K SG+RF  L+  +A + RAL Q
Sbjct: 121 DNVEVTRWGAPRNFSFTPKEHYEIPAVAAAMDFETAAKTSGSRFVNLSKGVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H  ++G TE+  P+LVRDEAMYGT ++PKF +D + TT+G WLIPTSEV+LT   
Sbjct: 181 FMLDTHIDKNGLTEMQTPVLVRDEAMYGTDKLPKFGEDSYQTTNGWWLIPTSEVTLTYSV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + +I++  +LP+R T     FRSEAGSAG+DT GMLRQHQF K E+VS+T  ++S  E +
Sbjct: 241 AGDILDEAALPIRMTAHTACFRSEAGSAGKDTAGMLRQHQFEKVEMVSVTHPDNSDAEQK 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML CAE++L++L + YR V LCTGD+GF A +T+D+E WL GQ+ YREISS ST G FQ
Sbjct: 301 RMLRCAEDLLEQLGIPYRTVVLCTGDMGFGARRTFDIEAWLPGQDAYREISSVSTTGAFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R+R       ++ HTLNGSG+AVGRCLIA+LEN  NADG+VT+P VL PY+   
Sbjct: 361 ARRMNARFRPEGGGKPEYVHTLNGSGLAVGRCLIAVLENGQNADGTVTLPDVLAPYLGGK 420

Query: 421 AVIKKEHIL 429
             ++ +  L
Sbjct: 421 LTLQADGTL 429


>gi|161870532|ref|YP_001599704.1| seryl-tRNA synthetase [Neisseria meningitidis 053442]
 gi|189083575|sp|A9M1Q6|SYS_NEIM0 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|161596085|gb|ABX73745.1| seryl-tRNA synthetase [Neisseria meningitidis 053442]
 gi|254674222|emb|CBA10006.1| Seryl-tRNA synthetase [Neisseria meningitidis alpha275]
          Length = 431

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 205/431 (47%), Positives = 276/431 (64%), Gaps = 9/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L  R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLAARGYEFDAARFNALEEQRKAVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPAGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTLQHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYETLEEMVGHAENILKALELPYRVITLCTGDMGFGAAKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIK 424
           +PYM  +A ++
Sbjct: 419 QPYMGGVAKLE 429


>gi|77414886|ref|ZP_00790994.1| seryl-tRNA synthetase [Streptococcus agalactiae 515]
 gi|77159061|gb|EAO70264.1| seryl-tRNA synthetase [Streptococcus agalactiae 515]
          Length = 425

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 204/426 (47%), Positives = 284/426 (66%), Gaps = 5/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILS-LDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IR + + +   L  R ++ ++   L  LD K R L+ K E+ +A+RN  SA I 
Sbjct: 1   MLDLKRIRTDFDAVAKKLAMRGVDQETLTTLKELDIKRRELLIKAEEAKAQRNVASAAIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA  + N    D       TL   +  ++ E  +V ++L+ +++ +PN P ++VP+G   
Sbjct: 61  QA--KRNKENADEQIAAMQTLSADIKAIDAELADVDANLQSMVTVLPNTPADDVPLGADE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +EN+ +R  G        ++ H+++GE+LG++D++R  K++G+RF    G  A LERA+ 
Sbjct: 119 DENVEVRRWGTPREFDFETKAHWDLGESLGILDWERGAKVTGSRFLFYKGLGARLERAIY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLTN 238
            FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F   D  + LIPT+EV LTN
Sbjct: 179 SFMLDEHAKE-GYTEVIPPYMVNHDSMFGTGQYPKFKEDTFELADSPFVLIPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  EII+ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E+S+ E
Sbjct: 238 YYRDEIIDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESYQE 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M + AE IL++L+L YRV++LCTGD+GFSA KTYDLEVW+  QN YREISSCS   +
Sbjct: 298 LEKMTANAENILQKLNLPYRVITLCTGDMGFSAAKTYDLEVWIPAQNTYREISSCSNTED 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   RYRD     ++  HTLNGSG+AVGR + AILENY N DGSVTIP VLRPYM 
Sbjct: 358 FQARRAQIRYRDEVDGKVRLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVLRPYMG 417

Query: 419 NLAVIK 424
           N+ +IK
Sbjct: 418 NIDIIK 423


>gi|330721801|gb|EGG99781.1| Seryl-tRNA synthetase [gamma proteobacterium IMCC2047]
          Length = 426

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 204/425 (48%), Positives = 282/425 (66%), Gaps = 4/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R N + +   LKK+  +     +  L+ + + +  + E ++  RNS S  IG+
Sbjct: 1   MLDSKLLRANLQDVADLLKKKKYQLDVARVTELEAQRKAIQTETEQLQNDRNSRSKNIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    +  L  E +++ E+L   + + ++V + L+ ++S +PN+P E VP G    
Sbjct: 61  AKAAG--EDIAPLIAEMNSMGERLDECKAKLNDVQAQLEGILSGVPNLPHESVPEGEDEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ + + G+  S     ++H ++G   G +DF+ A KL+GARF+ + G +A L RAL Q
Sbjct: 119 DNVTVLTWGEPRSFDFEPKDHVDVGANTGGLDFETAAKLTGARFATMKGQMAQLHRALIQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGRW-LIPTSEVSLTN 238
           FM++LHT +HGY EV  P +V  E +YGTGQ+PKFA+D+F   ++  W LIPT+EV +TN
Sbjct: 179 FMLNLHTQQHGYEEVYVPYIVNSETLYGTGQLPKFAEDLFKVGSENDWYLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           +Y  EI+++  LP RFT   P FRSEAGS GRDTRGM+RQHQF K ELV +     SF  
Sbjct: 239 MYRGEILDAGELPKRFTAHTPCFRSEAGSYGRDTRGMIRQHQFEKVELVQLVEPTKSFDA 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E ++  AE++L+ L+L YR V LC GDLGFSA KTYDLEVWL GQ+ YREISSCS C +
Sbjct: 299 LEELVGQAEKVLQLLNLPYRKVILCGGDLGFSATKTYDLEVWLPGQDKYREISSCSNCLD 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRM  R+R+P +   +  HTLNGSG+AVGR L+AILENY NADGSVTIP VLRPYMN
Sbjct: 359 FQARRMQLRWRNPETGKPELLHTLNGSGLAVGRTLVAILENYQNADGSVTIPEVLRPYMN 418

Query: 419 NLAVI 423
           N   I
Sbjct: 419 NAEFI 423


>gi|261392091|emb|CAX49588.1| seryl-tRNA synthetase (serine--tRNA ligase; SerRS) [Neisseria
           meningitidis 8013]
          Length = 431

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 205/431 (47%), Positives = 276/431 (64%), Gaps = 9/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L  R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLAARGYEFDAARFNALEEQRKAVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPAGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTLQHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYETLEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIK 424
           +PYM  +A ++
Sbjct: 419 QPYMGGVAKLE 429


>gi|254805440|ref|YP_003083661.1| Seryl-tRNA synthetase [Neisseria meningitidis alpha14]
 gi|254668982|emb|CBA07314.1| Seryl-tRNA synthetase [Neisseria meningitidis alpha14]
 gi|325127114|gb|EGC50069.1| seryl-tRNA synthetase [Neisseria meningitidis N1568]
          Length = 431

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 204/431 (47%), Positives = 277/431 (64%), Gaps = 9/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L +R     +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLARRGYNFDTARFDALEERRKSVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E+VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLEAVQKELDAWLLSIPNLPHEDVPFGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTLQHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYETLEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIK 424
           +PYM  +A ++
Sbjct: 419 QPYMGGVAKLE 429


>gi|22536539|ref|NP_687390.1| seryl-tRNA synthetase [Streptococcus agalactiae 2603V/R]
 gi|25010417|ref|NP_734812.1| seryl-tRNA synthetase [Streptococcus agalactiae NEM316]
 gi|76787984|ref|YP_329077.1| seryl-tRNA synthetase [Streptococcus agalactiae A909]
 gi|76798994|ref|ZP_00781192.1| seryl-tRNA synthetase [Streptococcus agalactiae 18RS21]
 gi|77406550|ref|ZP_00783601.1| seryl-tRNA synthetase [Streptococcus agalactiae H36B]
 gi|77411466|ref|ZP_00787811.1| seryl-tRNA synthetase [Streptococcus agalactiae CJB111]
 gi|54039691|sp|P67566|SYS_STRA5 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|54042042|sp|P67565|SYS_STRA3 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|123602391|sp|Q3K326|SYS_STRA1 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|22533373|gb|AAM99262.1|AE014208_2 seryl-tRNA synthetase [Streptococcus agalactiae 2603V/R]
 gi|23094769|emb|CAD45988.1| seryl-tRNA synthetase [Streptococcus agalactiae NEM316]
 gi|76563041|gb|ABA45625.1| seryl-tRNA synthetase [Streptococcus agalactiae A909]
 gi|76585644|gb|EAO62204.1| seryl-tRNA synthetase [Streptococcus agalactiae 18RS21]
 gi|77162469|gb|EAO73435.1| seryl-tRNA synthetase [Streptococcus agalactiae CJB111]
 gi|77174857|gb|EAO77675.1| seryl-tRNA synthetase [Streptococcus agalactiae H36B]
          Length = 425

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 204/426 (47%), Positives = 284/426 (66%), Gaps = 5/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILS-LDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IR + + +   L  R ++ ++   L  LD K R L+ K E+ +A+RN  SA I 
Sbjct: 1   MLDLKRIRTDFDVVAKKLATRGVDQETLTTLKELDIKRRELLIKAEEAKAQRNVASAAIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA  + N    D       TL   +  ++ E  +V ++L+ +++ +PN P ++VP+G   
Sbjct: 61  QA--KRNKENADEQIAAMQTLSADIKAIDAELADVDANLQSMVTVLPNTPADDVPLGADE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +EN+ +R  G        ++ H+++GE+LG++D++R  K++G+RF    G  A LERA+ 
Sbjct: 119 DENVEVRRWGTPREFDFETKAHWDLGESLGILDWERGAKVTGSRFLFYKGLGARLERAIY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLTN 238
            FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F   D  + LIPT+EV LTN
Sbjct: 179 SFMLDEHAKE-GYTEVIPPYMVNHDSMFGTGQYPKFKEDTFELADSPFVLIPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  EII+ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E+S+ E
Sbjct: 238 YYRDEIIDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESYQE 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M + AE IL++L+L YRV++LCTGD+GFSA KTYDLEVW+  QN YREISSCS   +
Sbjct: 298 LEKMTANAENILQKLNLPYRVITLCTGDMGFSAAKTYDLEVWIPAQNTYREISSCSNTED 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   RYRD     ++  HTLNGSG+AVGR + AILENY N DGSVTIP VLRPYM 
Sbjct: 358 FQARRAQIRYRDEVDGKVRLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVLRPYMG 417

Query: 419 NLAVIK 424
           N+ +IK
Sbjct: 418 NIDIIK 423


>gi|261378875|ref|ZP_05983448.1| serine--tRNA ligase [Neisseria cinerea ATCC 14685]
 gi|269144690|gb|EEZ71108.1| serine--tRNA ligase [Neisseria cinerea ATCC 14685]
          Length = 431

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 203/431 (47%), Positives = 277/431 (64%), Gaps = 9/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L +R  +  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTASVAERLARRGYDFDTARFDALEERRKSVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPTGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +AHL RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMRGQIAHLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTLKHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  I++   LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVAGSILDEGGLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIK 424
           +PYM  +A ++
Sbjct: 419 QPYMGGVAKLE 429


>gi|146282637|ref|YP_001172790.1| seryl-tRNA synthetase [Pseudomonas stutzeri A1501]
 gi|166223273|sp|A4VLU7|SYS_PSEU5 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|145570842|gb|ABP79948.1| seryl-tRNA synthetase [Pseudomonas stutzeri A1501]
          Length = 426

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 202/432 (46%), Positives = 280/432 (64%), Gaps = 16/432 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R  +     I +L+ + + +  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLVRTQLQDVAARLATRGYQLDVARIEALEAQRKTVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A   G      L+ VD + +E  + K++L         + S L +L+  IPN+P + VP+
Sbjct: 61  AKQRGEDIAPLLADVDRMGSELESGKQEL-------DRIQSELDQLMLSIPNLPHDSVPV 113

Query: 116 GTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLE 175
           G    EN+ +R  G   +     ++H  +GE  G +DF+ A KLSGARF+++ G +A L 
Sbjct: 114 GADEEENVEVRRWGTPKAFDFPVQDHVALGEQHGWLDFETAAKLSGARFALMRGPIARLH 173

Query: 176 RALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIPT 231
           RAL QFMIDLHT EHGY E   P LV+  A+ GTGQ+PKF DD+F  + +G    +LIPT
Sbjct: 174 RALAQFMIDLHTREHGYEEAYTPYLVQAPALQGTGQLPKFEDDLFKISREGEADFYLIPT 233

Query: 232 SEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITR 291
           +EVSLTN+ + EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I  
Sbjct: 234 AEVSLTNIVAGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVE 293

Query: 292 EEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREIS 351
              SF   E +   AE++L+ L+L YRV+SLCTGD+GF A KTYDLEVW+  Q+ YREIS
Sbjct: 294 PSKSFEALEELTGNAEKVLQLLELPYRVLSLCTGDMGFGATKTYDLEVWVPSQDKYREIS 353

Query: 352 SCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPT 411
           SCS CG+FQ+RRM +RYR+P +   +  HTLNGSG+AVGR L+A+LENY  ADG + +P 
Sbjct: 354 SCSNCGDFQARRMQARYRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGRILVPE 413

Query: 412 VLRPYMNNLAVI 423
           VL+PYM  + VI
Sbjct: 414 VLKPYMGGIEVI 425


>gi|325134782|gb|EGC57419.1| seryl-tRNA synthetase [Neisseria meningitidis M13399]
          Length = 431

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 203/431 (47%), Positives = 278/431 (64%), Gaps = 9/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L +R  +  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLARRGYDFDTARFDALEERRKSVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E+VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLEAVQKELDAWLLSIPNLPHEDVPFGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTLQHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGAAKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RR+ +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRLKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIK 424
           +PYM  +A ++
Sbjct: 419 QPYMGGVAKLE 429


>gi|319638614|ref|ZP_07993376.1| seryl-tRNA synthetase [Neisseria mucosa C102]
 gi|317400363|gb|EFV81022.1| seryl-tRNA synthetase [Neisseria mucosa C102]
          Length = 431

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 201/427 (47%), Positives = 273/427 (63%), Gaps = 9/427 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L  R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLAARGYEFDTARFNALEEQRKAVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP+G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKADLEQAAADLDAVQKELDAWLLSIPNLPHESVPVGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +AHL RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMKGQIAHLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTLKHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDESKKTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  I+    LPL+ T  +P FRSEAG+ G+D RG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIVAGSDLPLKLTAHSPCFRSEAGAYGKDVRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ +P VL
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINVPAVL 418

Query: 414 RPYMNNL 420
           +PYM  +
Sbjct: 419 QPYMGGV 425


>gi|320323766|gb|EFW79850.1| seryl-tRNA synthetase [Pseudomonas syringae pv. glycinea str. B076]
 gi|320327907|gb|EFW83912.1| seryl-tRNA synthetase [Pseudomonas syringae pv. glycinea str. race
           4]
          Length = 426

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 207/433 (47%), Positives = 281/433 (64%), Gaps = 18/433 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R        I SL+ + +++  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRTQLQDVADRLASRGFTLDVARIESLEAQRKVVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A   G      ++ V+ + NE S  K +L  ++ E       L  L+  IPN+P E VP+
Sbjct: 61  AKQRGEDIAPLMADVERMGNELSEGKVELDGIQAE-------LDALVLSIPNLPHESVPV 113

Query: 116 GTSANENILIRSVGKKPSAIHLS-REHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           G     N+ +R  G  P+A     ++H  +GE  G +DFD A KLSGARF++L G +A L
Sbjct: 114 GADEEGNVEVRRWGT-PTAFDFEVKDHVALGEKFGWLDFDTAAKLSGARFALLRGPIARL 172

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIP 230
            RAL QFMI+LH +EHGY E   P LV+  A+ GTGQ+PKF +D+F  T +G    +LIP
Sbjct: 173 HRALAQFMINLHINEHGYEETYTPYLVQAPALQGTGQLPKFEEDLFKITREGEADLYLIP 232

Query: 231 TSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT 290
           T+EVSLTN+ S EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I 
Sbjct: 233 TAEVSLTNIVSGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIV 292

Query: 291 REEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREI 350
             EDS    E +   AE +L+ L+L YR ++LCTGD+GFSA KTYDLEVW+  Q+ YREI
Sbjct: 293 APEDSMAALESLTGNAERVLQLLELPYRTLALCTGDMGFSAVKTYDLEVWIPSQDKYREI 352

Query: 351 SSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIP 410
           SSCS CG+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P
Sbjct: 353 SSCSNCGDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVP 412

Query: 411 TVLRPYMNNLAVI 423
            VL+PYM  L VI
Sbjct: 413 EVLKPYMGGLEVI 425


>gi|15677532|ref|NP_274688.1| seryl-tRNA synthetase [Neisseria meningitidis MC58]
 gi|30173214|sp|Q9JY95|SYS_NEIMB RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|7226938|gb|AAF42032.1| seryl-tRNA synthetase [Neisseria meningitidis MC58]
 gi|316984831|gb|EFV63788.1| seryl-tRNA synthetase [Neisseria meningitidis H44/76]
 gi|325140853|gb|EGC63363.1| seryl-tRNA synthetase [Neisseria meningitidis CU385]
 gi|325199722|gb|ADY95177.1| seryl-tRNA synthetase [Neisseria meningitidis H44/76]
          Length = 431

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 204/431 (47%), Positives = 277/431 (64%), Gaps = 9/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L +R  +  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLARRGYDFDTARFDTLEERRKSVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  N+ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMNQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPAGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTLQHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYETLEEMVGHAENILKALELPYRVITLCTGDMGFGAAKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RR+ +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRLKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIK 424
           +PYM  +A ++
Sbjct: 419 QPYMGGVAKLE 429


>gi|116512562|ref|YP_811469.1| seryl-tRNA synthetase [Lactococcus lactis subsp. cremoris SK11]
 gi|123025253|sp|Q02XG6|SYS_LACLS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|116108216|gb|ABJ73356.1| seryl-tRNA synthetase [Lactococcus lactis subsp. cremoris SK11]
          Length = 423

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 209/428 (48%), Positives = 285/428 (66%), Gaps = 9/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IR + + +   L  R +E +  E +  LD K R LI K E ++A RNS S +I 
Sbjct: 1   MLDIKKIRADFDGIAAKLATRGVEKEKLEKLHDLDIKRRELIVKSEALKAERNSVSDEIS 60

Query: 60  QAI-AEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTS 118
           Q   A+G+ S   A   + S    ++  ++ E  E+  +L ++I  +PN+P E  PIG  
Sbjct: 61  QVKRAKGDASTQIAAMQKVSA---EIKAIDAELAEIEENLNEIIIMLPNLPHESTPIGAD 117

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
            ++N+ +R VG+ P+     + H+++GE LG++D++R  K++G+RF    G  A LERAL
Sbjct: 118 EDDNVEVRRVGQTPTFNFEPKAHWDLGEDLGILDWERGGKVTGSRFLFYKGAGARLERAL 177

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW--LIPTSEVSL 236
             FM+D H  E GYTE+  P +V  E+M+GTGQ PKF +D F   D R   LIPT+EV L
Sbjct: 178 YNFMLDEHGKE-GYTEMITPYMVNQESMFGTGQYPKFKEDTFELKDDRGFVLIPTAEVPL 236

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN Y  EI++   LP++FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + + S+
Sbjct: 237 TNYYRGEILDGSELPIKFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPDQSY 296

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            E E+M + AE IL++L L YRVV+L TGD+GFSA KTYDLEVW+  QN YREISSCS C
Sbjct: 297 DELEKMTANAENILQKLGLAYRVVALSTGDMGFSAAKTYDLEVWIPAQNTYREISSCSNC 356

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
            +FQ+RR   RYRD + K ++  HTLNGSG+AVGR + AILENY N DGS+T+P +LRPY
Sbjct: 357 EDFQARRAQIRYRDEDGK-VQLLHTLNGSGLAVGRTVAAILENYQNEDGSITVPEILRPY 415

Query: 417 MNNLAVIK 424
           M  L VIK
Sbjct: 416 MGGLEVIK 423


>gi|15597808|ref|NP_251302.1| seryl-tRNA synthetase [Pseudomonas aeruginosa PAO1]
 gi|107102134|ref|ZP_01366052.1| hypothetical protein PaerPA_01003183 [Pseudomonas aeruginosa PACS2]
 gi|116050599|ref|YP_790582.1| seryl-tRNA synthetase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218891227|ref|YP_002440093.1| seryl-tRNA synthetase [Pseudomonas aeruginosa LESB58]
 gi|254235598|ref|ZP_04928921.1| seryl-tRNA synthetase [Pseudomonas aeruginosa C3719]
 gi|254241045|ref|ZP_04934367.1| seryl-tRNA synthetase [Pseudomonas aeruginosa 2192]
 gi|296388929|ref|ZP_06878404.1| seryl-tRNA synthetase [Pseudomonas aeruginosa PAb1]
 gi|30173211|sp|Q9I0M6|SYS_PSEAE RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|122259722|sp|Q02NA4|SYS_PSEAB RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|226701396|sp|B7UW10|SYS_PSEA8 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|9948677|gb|AAG06000.1|AE004689_12 seryl-tRNA synthetase [Pseudomonas aeruginosa PAO1]
 gi|115585820|gb|ABJ11835.1| seryl-tRNA synthetase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126167529|gb|EAZ53040.1| seryl-tRNA synthetase [Pseudomonas aeruginosa C3719]
 gi|126194423|gb|EAZ58486.1| seryl-tRNA synthetase [Pseudomonas aeruginosa 2192]
 gi|218771452|emb|CAW27219.1| seryl-tRNA synthetase [Pseudomonas aeruginosa LESB58]
          Length = 426

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 202/432 (46%), Positives = 281/432 (65%), Gaps = 16/432 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R  P+ +   L  R  +     I +L+E+ + +  + E ++A RN+ S  IGQ
Sbjct: 1   MLDPKLVRTQPQEVAARLATRGFQLDVARIEALEEQRKSVQTRTEQLQAERNARSKAIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A   G      L+ VD + +E    K QL  ++ E       L  ++  IPN+P E VP+
Sbjct: 61  AKQRGEDIAPLLADVDRMGSELEEGKRQLDAIQGE-------LDAMLLGIPNLPHESVPV 113

Query: 116 GTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLE 175
           G   + N+ +R  G   +     ++H  +GE  G +DF+ A KLSGARF+++ G +A L 
Sbjct: 114 GADEDANVEVRRWGTPKTFDFEVKDHVALGERHGWLDFETAAKLSGARFALMRGPIARLH 173

Query: 176 RALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIPT 231
           RAL QFMI+LHT+EHGY E   P LV+  A+ GTGQ+PKF +D+F    DG    +LIPT
Sbjct: 174 RALAQFMINLHTAEHGYEEAYTPYLVQAPALQGTGQLPKFEEDLFKIGRDGEADLYLIPT 233

Query: 232 SEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITR 291
           +EVSLTN+ S +I+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I  
Sbjct: 234 AEVSLTNIVSGQILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVD 293

Query: 292 EEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREIS 351
              S+   E + + AE +L+ L+L YRV++LCTGD+GF A KTYDLEVW+  Q+ YREIS
Sbjct: 294 PATSYEALEGLTANAERVLQLLELPYRVLALCTGDMGFGATKTYDLEVWVPSQDKYREIS 353

Query: 352 SCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPT 411
           SCS CG+FQ+RRM +RYR+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P 
Sbjct: 354 SCSNCGDFQARRMQARYRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPE 413

Query: 412 VLRPYMNNLAVI 423
           VL+PYM  + VI
Sbjct: 414 VLKPYMAGIEVI 425


>gi|313107648|ref|ZP_07793831.1| seryl-tRNA synthetase [Pseudomonas aeruginosa 39016]
 gi|310880333|gb|EFQ38927.1| seryl-tRNA synthetase [Pseudomonas aeruginosa 39016]
          Length = 426

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 202/432 (46%), Positives = 281/432 (65%), Gaps = 16/432 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R  P+ +   L  R  +     I +L+E+ + +  + E ++A RN+ S  IGQ
Sbjct: 1   MLDPKLVRTQPQEVAARLATRGFQLDVARIEALEEQRKSVQTRTEQLQAERNARSKAIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A   G      L+ VD + +E    K QL  ++ E       L  ++  IPN+P E VP+
Sbjct: 61  AKQRGEDIAPLLADVDRMGSELEEGKRQLDAIQGE-------LDAMLLGIPNLPHESVPV 113

Query: 116 GTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLE 175
           G   + N+ +R  G   +     ++H  +GE  G +DF+ A KLSGARF+++ G +A L 
Sbjct: 114 GADEDANVEVRRWGTPKTFDFEVKDHVALGERHGWLDFETAAKLSGARFALMRGPIARLH 173

Query: 176 RALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIPT 231
           RAL QFMI+LHT+EHGY E   P LV+  A+ GTGQ+PKF +D+F    DG    +LIPT
Sbjct: 174 RALAQFMINLHTAEHGYEEAYTPYLVQAPALQGTGQLPKFEEDLFKIGRDGEADLYLIPT 233

Query: 232 SEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITR 291
           +EVSLTN+ S +I+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I  
Sbjct: 234 AEVSLTNIVSGQILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVD 293

Query: 292 EEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREIS 351
              S+   E + + AE +L+ L+L YRV++LCTGD+GF A KTYDLEVW+  Q+ YREIS
Sbjct: 294 PATSYEALEGLTANAERVLQLLELPYRVLALCTGDMGFGATKTYDLEVWVPSQDKYREIS 353

Query: 352 SCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPT 411
           SCS CG+FQ+RRM +RYR+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P 
Sbjct: 354 SCSNCGDFQARRMQTRYRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPE 413

Query: 412 VLRPYMNNLAVI 423
           VL+PYM  + VI
Sbjct: 414 VLKPYMAGIEVI 425


>gi|125623578|ref|YP_001032061.1| seryl-tRNA synthetase [Lactococcus lactis subsp. cremoris MG1363]
 gi|166222737|sp|A2RJ76|SYS_LACLM RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|124492386|emb|CAL97327.1| SerS protein [Lactococcus lactis subsp. cremoris MG1363]
 gi|300070342|gb|ADJ59742.1| seryl-tRNA synthetase [Lactococcus lactis subsp. cremoris NZ9000]
          Length = 423

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 209/428 (48%), Positives = 285/428 (66%), Gaps = 9/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IR + + +   L  R +E +  E +  LD K R LI K E ++A RNS S +I 
Sbjct: 1   MLDIKKIRADFDGVAAKLATRGVEKEKLEKLHDLDIKRRELIVKSEALKAERNSVSDEIS 60

Query: 60  QAI-AEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTS 118
           Q   A+G+ S   A   + S    ++  ++ E  E+  +L ++I  +PN+P E  PIG  
Sbjct: 61  QVKRAKGDASTQIAAMQKVSA---EIKAIDAELAEIEENLNEIIIMLPNLPHESTPIGAD 117

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
            ++N+ +R VG+ P+     + H+++GE LG++D++R  K++G+RF    G  A LERAL
Sbjct: 118 EDDNVEVRRVGQTPTFNFEPKAHWDLGEDLGILDWERGGKVTGSRFLFYKGAGARLERAL 177

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW--LIPTSEVSL 236
             FM+D H  E GYTE+  P +V  E+M+GTGQ PKF +D F   D R   LIPT+EV L
Sbjct: 178 YNFMLDEHGKE-GYTEMITPYMVNQESMFGTGQYPKFKEDTFELKDDRGFVLIPTAEVPL 236

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN Y  EI++   LP++FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + + S+
Sbjct: 237 TNYYRGEILDGSELPIKFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPDQSY 296

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            E E+M + AE IL++L L YRVV+L TGD+GFSA KTYDLEVW+  QN YREISSCS C
Sbjct: 297 DELEKMTANAENILQKLGLAYRVVALSTGDMGFSAAKTYDLEVWIPAQNTYREISSCSNC 356

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
            +FQ+RR   RYRD + K ++  HTLNGSG+AVGR + AILENY N DGS+T+P +LRPY
Sbjct: 357 EDFQARRAQIRYRDEDGK-VQLLHTLNGSGLAVGRTVAAILENYQNEDGSITVPEILRPY 415

Query: 417 MNNLAVIK 424
           M  L VIK
Sbjct: 416 MGGLEVIK 423


>gi|240113545|ref|ZP_04728035.1| seryl-tRNA synthetase [Neisseria gonorrhoeae MS11]
 gi|268599610|ref|ZP_06133777.1| seryl-tRNA synthetase [Neisseria gonorrhoeae MS11]
 gi|268583741|gb|EEZ48417.1| seryl-tRNA synthetase [Neisseria gonorrhoeae MS11]
          Length = 431

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 205/427 (48%), Positives = 275/427 (64%), Gaps = 9/427 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L +R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLARRGYEFDTARFDALEERRKSVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPPGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTLQHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVAGSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYGALEEMVGHAENILKALELPYRVITLCTGDMGFSAAKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNL 420
           +PYM  +
Sbjct: 419 QPYMGGV 425


>gi|15673694|ref|NP_267868.1| seryl-tRNA synthetase [Lactococcus lactis subsp. lactis Il1403]
 gi|281492294|ref|YP_003354274.1| seryl-tRNA synthetase [Lactococcus lactis subsp. lactis KF147]
 gi|30173210|sp|Q9CEX2|SYS_LACLA RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|12724729|gb|AAK05810.1|AE006401_11 seryl-tRNA synthetase [Lactococcus lactis subsp. lactis Il1403]
 gi|281375958|gb|ADA65449.1| Seryl-tRNA synthetase [Lactococcus lactis subsp. lactis KF147]
 gi|326407178|gb|ADZ64249.1| seryl-tRNA synthetase [Lactococcus lactis subsp. lactis CV56]
          Length = 423

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 210/428 (49%), Positives = 284/428 (66%), Gaps = 9/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IR + + +   L  R +E +  E +  LD K R LI K E ++A RNS S +I 
Sbjct: 1   MLDIKKIRADFDGVAAKLATRGVEKEKLEKLHDLDIKRRELIVKSEALKAERNSVSDEIS 60

Query: 60  QAI-AEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTS 118
           Q   A+G+ S   A   + S    ++  ++ E  E+  +L ++I  +PN+P E  PIG  
Sbjct: 61  QVKRAKGDASAQIAAMQKVSA---EIKAIDAELAEIEENLNEIIIMLPNLPHESTPIGAD 117

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
            ++N+ +R VG+ P+     + H+++GE LG++D++R  K++G+RF    G  A LERAL
Sbjct: 118 EDDNVEVRRVGQTPTFNFEPKAHWDLGEDLGILDWERGGKVTGSRFLFYKGAGARLERAL 177

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW--LIPTSEVSL 236
             FM+D H  E GYTE+  P +V  E+M+GTGQ PKF +D F   D R   LIPT+EV L
Sbjct: 178 YNFMLDEHGKE-GYTEMITPYMVNQESMFGTGQYPKFKEDTFELKDDRGFVLIPTAEVPL 236

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN Y  EI++   LP++FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + + S+
Sbjct: 237 TNYYRGEILDGAELPIKFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPDQSY 296

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            E E+M + AE IL++L L YRVV+L TGD+GFSA KTYDLEVW+  QN YREISSCS C
Sbjct: 297 DELEKMTANAENILQKLGLAYRVVALSTGDMGFSAAKTYDLEVWIPAQNTYREISSCSNC 356

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
            +FQ+RR   RYRD   K ++  HTLNGSG+AVGR + AILENY N DGS+T+P VLRPY
Sbjct: 357 EDFQARRAQIRYRDEEGK-VQLLHTLNGSGLAVGRTVAAILENYQNEDGSITVPEVLRPY 415

Query: 417 MNNLAVIK 424
           M  L VIK
Sbjct: 416 MGGLEVIK 423


>gi|325144922|gb|EGC67206.1| seryl-tRNA synthetase [Neisseria meningitidis M01-240013]
 gi|325205599|gb|ADZ01052.1| seryl-tRNA synthetase [Neisseria meningitidis M04-240196]
          Length = 431

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 203/431 (47%), Positives = 278/431 (64%), Gaps = 9/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L +R  +  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLARRGYDFDTARFDALEERRKSVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E+VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLEAVQKELDAWLLSIPNLPHEDVPFGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTLQHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RR+ +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRLKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIK 424
           +PYM  +A ++
Sbjct: 419 QPYMGGVAKLE 429


>gi|325130726|gb|EGC53464.1| seryl-tRNA synthetase [Neisseria meningitidis OX99.30304]
 gi|325136667|gb|EGC59267.1| seryl-tRNA synthetase [Neisseria meningitidis M0579]
 gi|325201659|gb|ADY97113.1| seryl-tRNA synthetase [Neisseria meningitidis M01-240149]
 gi|325208606|gb|ADZ04058.1| seryl-tRNA synthetase [Neisseria meningitidis NZ-05/33]
          Length = 431

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 204/428 (47%), Positives = 275/428 (64%), Gaps = 9/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L  R  +  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLAARGYKFDAARFNALEEQRKAVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E+VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLEAVQKELDAWLLSIPNLPHEDVPFGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTLKHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDESKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVAGSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYETLEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLA 421
           +PYM  +A
Sbjct: 419 QPYMGGVA 426


>gi|198282690|ref|YP_002219011.1| seryl-tRNA synthetase [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218667554|ref|YP_002424882.1| seryl-tRNA synthetase [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|226701652|sp|B7J4C9|SYS_ACIF2 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|238689968|sp|B5EMC5|SYS_ACIF5 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|198247211|gb|ACH82804.1| seryl-tRNA synthetase [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218519767|gb|ACK80353.1| seryl-tRNA synthetase [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 421

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 204/425 (48%), Positives = 275/425 (64%), Gaps = 6/425 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R +PE +   L +RH       + +LD++ + L  ++E +R  RN  S QIGQ
Sbjct: 1   MLDPSLLRSSPETVAAGLARRHFTLDVAALNALDQQRKALQIQLEQLRNARNEASRQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A  +G  +   A++   ++  E++  LE+      +    L   +PN+P + VP G    
Sbjct: 61  ARRQGLDT--GAMQAAAASNGEEIKTLEQSLERTLAEWDTLTIGLPNIPQDSVPDGRDEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+++R  G   +     R+H E+GEALG++DF    +L+G RF VL G  A LERAL Q
Sbjct: 119 DNVVLRHWGSPSTFAFPPRDHVELGEALGIIDFAAGARLAGTRFVVLRGAGARLERALTQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-RWLIPTSEVSLTNL 239
           FM+DLHT+EHGYTE++ P L   +++YGTGQ+PKF +D+F   D   +LIPT+EV LTNL
Sbjct: 179 FMLDLHTTEHGYTEIAPPFLANADSLYGTGQLPKFEEDLFALRDDPYYLIPTAEVPLTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
              EI+   SLP RF    P FR EAG+ GRDTRGM+RQHQF K ELV I R EDS   H
Sbjct: 239 LRGEIV--ASLPQRFCAYTPCFRREAGAYGRDTRGMIRQHQFDKVELVQIVRPEDSAQAH 296

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E + + AE++L+ L+L YRV +LC GDLGFSA KTYDLEVWL GQN YREISSCS   +F
Sbjct: 297 ETLTAHAEKVLQLLELPYRVTALCAGDLGFSAAKTYDLEVWLPGQNQYREISSCSNFESF 356

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR+  RYR  + K  +  HTLNGSG+AVGR L+A+LEN+  ADG + IP  LRPY+  
Sbjct: 357 QARRLQLRYRAEDGKP-QLVHTLNGSGLAVGRTLVALLENHQQADGRIRIPAALRPYLGG 415

Query: 420 LAVIK 424
           + VI+
Sbjct: 416 MTVIQ 420


>gi|116748863|ref|YP_845550.1| seryl-tRNA synthetase [Syntrophobacter fumaroxidans MPOB]
 gi|166223302|sp|A0LI63|SYS_SYNFM RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|116697927|gb|ABK17115.1| seryl-tRNA synthetase [Syntrophobacter fumaroxidans MPOB]
          Length = 423

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/429 (46%), Positives = 285/429 (66%), Gaps = 13/429 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++++R N + +D+ L+ R ++     ++ LD + R +++++E+++ RRN  S +I  
Sbjct: 1   MLDLRFVRDNVDKIDMMLRNRRMDLSLAPLIELDTQRRRILREVEELKFRRNKASEEISN 60

Query: 61  AIAEGNLS--LVDALKN---ETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
              E   S  L++ +K       TL ++L ++E  EH      +  +  IPN+P E VP+
Sbjct: 61  LKREKKDSSLLIEEMKEVSRRVKTLDQELTVIE--EH-----FRDFLLLIPNMPHESVPV 113

Query: 116 GTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLE 175
           G    +N + ++ G KP      + H+EIGEALG++DF+RA K++GARF++     A LE
Sbjct: 114 GADEKDNPVAKTWGSKPELDFEPKPHWEIGEALGILDFERAAKIAGARFALYWKMGAALE 173

Query: 176 RALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-GRWLIPTSEV 234
           RAL  FM+D+HT  HGYTEV  P +V   ++ GTGQ+PKF +D+F   D   +L+PT+EV
Sbjct: 174 RALIAFMLDIHTKRHGYTEVLPPFIVNSTSLLGTGQLPKFKEDLFKLEDRDFYLVPTAEV 233

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            +TN++ +E +E   LP  +T   P FRSEAGS G+DTRG++RQHQF K ELV + + E 
Sbjct: 234 PVTNIHMNETLEESELPKLYTAFTPCFRSEAGSYGKDTRGLIRQHQFNKVELVKLVKPES 293

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCS 354
           S+ E E++L  AE IL+ L LHYRVV+LCTGD+GFS+ KTYD+EVWL GQN YREISSCS
Sbjct: 294 SYEELEKLLLDAERILQELGLHYRVVTLCTGDMGFSSAKTYDIEVWLPGQNTYREISSCS 353

Query: 355 TCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR 414
              +FQ+RR N R+R       +F HTLNGSG+AVGR L+AILEN   ADGSV+IP  LR
Sbjct: 354 NFEDFQARRANIRFRRKGQSKTEFVHTLNGSGLAVGRTLVAILENGQQADGSVSIPPALR 413

Query: 415 PYMNNLAVI 423
           PY+ N+  I
Sbjct: 414 PYLGNIERI 422


>gi|114320852|ref|YP_742535.1| seryl-tRNA synthetase [Alkalilimnicola ehrlichii MLHE-1]
 gi|122311524|sp|Q0A7Z2|SYS_ALHEH RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|114227246|gb|ABI57045.1| seryl-tRNA synthetase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 424

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 208/423 (49%), Positives = 275/423 (65%), Gaps = 5/423 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +RQ+PE +  AL +R       +  +LDE+ R L  + ++++  RN+ S  IGQ
Sbjct: 1   MLDTRKLRQDPEGVARALARRGYRLDVAHYRALDERRRELQVRTQELQNERNTRSKGIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ LK E + L  QL   + E   V   L  +   +PN+P  +VP G   +
Sbjct: 61  AKARGED--IEPLKAEVADLGRQLEAAKGELQAVQDELHDIHVGMPNLPHPDVPEGEDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEAL-GLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           EN+ +R  G  P      R+H E+GE L G +DF+ A KL+GARF V+ G +A L RAL 
Sbjct: 119 ENVEVRRWGTPPEFGFRPRDHVELGELLDGGLDFEAAAKLTGARFVVMRGAVARLHRALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC--TTDGRWLIPTSEVSLT 237
           QFM+D HT+EHGY E+  P +V  ++++GTGQ+PKFA D+F        +LIPT+EV +T
Sbjct: 179 QFMLDTHTAEHGYQEIYVPYMVNRDSLFGTGQLPKFAADLFHLDAEQDYYLIPTAEVPVT 238

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           N+   EII    LPL+F    P FRSEAGS G+DTRGM+RQHQF K ELV + R E S+ 
Sbjct: 239 NMARDEIIADGQLPLKFACHTPCFRSEAGSHGKDTRGMIRQHQFEKVELVQMVRPEASWE 298

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
             E +   AE IL+RLDL YRVV+LCTGDLGFS+ KTYD+EVWL  Q  YREISSCS   
Sbjct: 299 ALEALTGHAETILQRLDLPYRVVTLCTGDLGFSSAKTYDIEVWLPAQETYREISSCSNFL 358

Query: 358 NFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +FQ+RRM +R+R+P +   +  HTLNGSG+AVGRCL+AILENY  ADG VT+P  LRPYM
Sbjct: 359 DFQARRMQARWRNPETGKPEPLHTLNGSGLAVGRCLVAILENYQEADGRVTVPEALRPYM 418

Query: 418 NNL 420
             +
Sbjct: 419 GGI 421


>gi|126736003|ref|ZP_01751747.1| seryl-tRNA synthetase [Roseobacter sp. CCS2]
 gi|126714560|gb|EBA11427.1| seryl-tRNA synthetase [Roseobacter sp. CCS2]
          Length = 486

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/417 (47%), Positives = 264/417 (63%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP   D AL +R   P S  IL+LDE  R  I   E  +A  N  + ++G 
Sbjct: 57  MHDIRTIRDNPAAFDAALSRRGNAPVSSQILALDEARRAKILAAETAQAEANKAAKEVGA 116

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G+      L+      K ++  L  E     ++L  ++  IPN+P   +P G   +
Sbjct: 117 AKGRGDEDEFARLRALVGEKKAEIAALNDEAKAQDAALTDMLMGIPNLPDASIPDGDDED 176

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I   G   +      EHF+I      MDF+ A KLSG+RF +L+G +A L RAL Q
Sbjct: 177 DNVEIHRHGTPRTLDFDPLEHFDIPAIRPGMDFETAAKLSGSRFVLLSGAVARLHRALAQ 236

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D+H  EHG  E   P+LVR+E MYGTGQ+PKF +D + TT+G WLIPT+EV+LTN+ 
Sbjct: 237 FMLDVHVEEHGLLETITPVLVREEMMYGTGQLPKFGEDSYQTTNGWWLIPTAEVTLTNIV 296

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           +   ++   LP R+      FRSEAGSAGRDT GMLRQHQF K E+VS+T+ EDS  EH+
Sbjct: 297 NGLTVDESYLPRRYVAHTQCFRSEAGSAGRDTSGMLRQHQFEKVEMVSVTKPEDSAAEHD 356

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CA+ IL++L+L YR V LCTGDLGF   KT+D+EVWL GQN YREISS S  G++Q
Sbjct: 357 RMTGCAQAILEKLELPYRTVVLCTGDLGFGMTKTHDIEVWLPGQNTYREISSVSVAGDYQ 416

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +RRMN+R++       +F HTLNGSG+AVGR LIA++EN   ADGSV +P  L PY+
Sbjct: 417 ARRMNARFKPEAGGKPQFVHTLNGSGLAVGRALIAVVENGQQADGSVDLPAALHPYL 473


>gi|110834155|ref|YP_693014.1| seryl-tRNA synthetase [Alcanivorax borkumensis SK2]
 gi|123345548|sp|Q0VQ06|SYS_ALCBS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|110647266|emb|CAL16742.1| seryl-tRNA synthetase [Alcanivorax borkumensis SK2]
          Length = 429

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 208/433 (48%), Positives = 283/433 (65%), Gaps = 13/433 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+ +RQ+ E +  AL KR      E   +LD K +    + ++++A R   S Q+G+
Sbjct: 1   MLDIRALRQDGEAIKAALSKRGYTLDLEEFAALDAKRKQADMRSQELQADRKKASKQVGE 60

Query: 61  ------AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVP 114
                 A+ E    + DAL+   + L +++   +  + E+    ++ +  IPNVP E VP
Sbjct: 61  LIKSGMAVDEAKAQVADALQTIDTELDKEVASAKAIQDEI----REYLMGIPNVPQEAVP 116

Query: 115 IGTSANENILIRSVGKKPSAIHLSREHFEIGEAL-GLMDFDRATKLSGARFSVLTGHLAH 173
            G   ++N+ +R  G   +     ++H +IGEAL G +DF+RA KLSGARF+V++G LA 
Sbjct: 117 AGNDEDDNVEVRRWGTPKTLPFEPKDHVDIGEALEGGLDFERAAKLSGARFAVMSGGLAR 176

Query: 174 LERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGR--WLIPT 231
           + RAL  FM+D+H+ EHGY EV  P LV  EA+ GTGQ+PKFA+D+F     R  +LIPT
Sbjct: 177 MHRALIDFMLDIHSDEHGYQEVYVPFLVGPEALRGTGQLPKFAEDLFKIEGERELYLIPT 236

Query: 232 SEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITR 291
           +EV +TNL + EI+E+ ++P R+T   P FRSEAGS GRDTRGM+RQHQF K ELV + R
Sbjct: 237 AEVPVTNLAADEILEANTMPRRYTCHTPCFRSEAGSHGRDTRGMIRQHQFEKVELVQMVR 296

Query: 292 EEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREIS 351
            E+S    E +   AE IL++LDL YRVV LC GDLGFS+ KTYD+EVWL  Q  YREIS
Sbjct: 297 PEESDAALEALTGHAEAILQKLDLPYRVVILCGGDLGFSSSKTYDIEVWLPSQQCYREIS 356

Query: 352 SCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPT 411
           SCS   ++QSRRM +R+R+P +   +  HTLNGS +AVGR L+AILENY N DGSVT+P 
Sbjct: 357 SCSNFRDYQSRRMQARWRNPETGKPELVHTLNGSALAVGRTLVAILENYQNDDGSVTVPE 416

Query: 412 VLRPYMNNLAVIK 424
            LRPYM  L  +K
Sbjct: 417 ALRPYMRGLERLK 429


>gi|308389806|gb|ADO32126.1| seryl-tRNA synthetase [Neisseria meningitidis alpha710]
          Length = 431

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 204/431 (47%), Positives = 276/431 (64%), Gaps = 9/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L  R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLAARGYEFDAARFNALEEQRKAVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPAGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTLQHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYETLEEMVGHAENILKALELPYRVITLCTGDMGFGAAKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RR+ +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRLKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIK 424
           +PYM  +A ++
Sbjct: 419 QPYMGGVAKLE 429


>gi|313667939|ref|YP_004048223.1| seryl-tRNA synthetase [Neisseria lactamica ST-640]
 gi|313005401|emb|CBN86835.1| seryl-tRNA synthetase [Neisseria lactamica 020-06]
          Length = 431

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 204/431 (47%), Positives = 275/431 (63%), Gaps = 9/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L  R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQSLRSNTAAVAERLAARGYEFDAARFNALEEQRKAVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +S IPN+P E VP G    
Sbjct: 61  LKGQGRHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLSGIPNLPHESVPAGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRRVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT EHGYTE   P +V    +YGTGQ+PKF +D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTLEHGYTEHYTPYIVNGGTLYGTGQLPKFGEDLFHVTRGGDESKTAQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAG+ G+D RG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVAGSIIPSEQLPLKLTAHSPCFRSEAGAYGKDVRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYGALEEMVGHAENILKALELPYRVITLCTGDMGFGAAKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIK 424
           +PYM  +A ++
Sbjct: 419 QPYMGGVAKLE 429


>gi|71906935|ref|YP_284522.1| seryl-tRNA synthetase [Dechloromonas aromatica RCB]
 gi|123627807|sp|Q47GH9|SYS_DECAR RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|71846556|gb|AAZ46052.1| seryl-tRNA synthetase [Dechloromonas aromatica RCB]
          Length = 427

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 206/429 (48%), Positives = 281/429 (65%), Gaps = 11/429 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N + +   L KR          +L+ + + L  + +D++A+RNS S QIG 
Sbjct: 1   MLDIQQLRSNLDAVAEGLAKRGKPIDFSEFSALEAERKTLQTRTQDLQAQRNSLSKQIGM 60

Query: 61  AIAEGNLSLVDA--LKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTS 118
              +G     DA  +  +  ++ ++L   E    E+ +    +++ +PN+P + VP+G+ 
Sbjct: 61  LKGKGE----DASEVMAQVGSIGDELKASEARLAELLTQFNAILAALPNIPDDSVPVGSD 116

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
              N+ I+  G         ++H ++GEALG +DF  A K+SGARFS+L G LA L RAL
Sbjct: 117 ETGNVEIKRWGTPRVFDFEVKDHTDVGEALGQLDFGTAAKISGARFSLLKGGLARLHRAL 176

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGR----WLIPTSEV 234
            QFM+D HT+EHGYTE+ AP LV   ++YGTGQ+PKF +D+F    G     +LIPT+EV
Sbjct: 177 AQFMLDTHTAEHGYTELYAPYLVNAASLYGTGQLPKFEEDLFKVLRGDQDPLYLIPTAEV 236

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            +TN+   EI+ +++LPL+F    P FRSEAGS GRD RGM+RQHQF K ELV +   E 
Sbjct: 237 PVTNIVRDEILSAEALPLKFVCHTPCFRSEAGSGGRDVRGMIRQHQFDKVELVQVVHPEK 296

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCS 354
           S   HE +   AE IL++L+L YR ++LC+GD+GFSA KTYDLEVWL  QN YREISSCS
Sbjct: 297 SAEAHEELTRQAEIILEKLELPYRRMALCSGDMGFSAAKTYDLEVWLPAQNTYREISSCS 356

Query: 355 TCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR 414
             G FQ+RRM +R+R+  +K+ +  HTLNGSG+AVGR L+AILEN  NADGSVTIP VLR
Sbjct: 357 NFGAFQARRMQARFRNDKNKT-ELCHTLNGSGLAVGRTLVAILENNQNADGSVTIPAVLR 415

Query: 415 PYMNNLAVI 423
           PYM  L V+
Sbjct: 416 PYMGGLEVL 424


>gi|152989408|ref|YP_001347960.1| seryl-tRNA synthetase [Pseudomonas aeruginosa PA7]
 gi|166223270|sp|A6V4H5|SYS_PSEA7 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|150964566|gb|ABR86591.1| seryl-tRNA synthetase [Pseudomonas aeruginosa PA7]
          Length = 426

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 201/432 (46%), Positives = 281/432 (65%), Gaps = 16/432 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R  P+ +   L  R  +     I +L+E+ + +  + E ++A RN+ S  IGQ
Sbjct: 1   MLDPKLVRTQPQEVAARLATRGFQLDVARIEALEEQRKSVQTRTEQLQAERNARSKAIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A   G      L+ VD + +E    K QL  ++ E       L  ++  IPN+P E VP+
Sbjct: 61  AKQRGEDIAPLLADVDRMGSELEEGKRQLDAIQGE-------LDSMLLGIPNLPHESVPV 113

Query: 116 GTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLE 175
           G   + N+ +R  G   +     ++H  +GE  G +DF+ A KLSGARF+++ G +A L 
Sbjct: 114 GADEDANVEVRRWGMPKTFDFEVKDHVALGERHGWLDFETAAKLSGARFALMRGPIARLH 173

Query: 176 RALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIPT 231
           RAL QFMI+LHT+EHGY E   P LV+  A+ GTGQ+PKF +D+F    DG    +LIPT
Sbjct: 174 RALAQFMINLHTAEHGYEEAYTPYLVQAPALQGTGQLPKFEEDLFKIGRDGEADLYLIPT 233

Query: 232 SEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITR 291
           +EVSLTN+ S +I++++ LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I  
Sbjct: 234 AEVSLTNIVSGQILDARQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVD 293

Query: 292 EEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREIS 351
              S+   E + + AE +L+ L+L YRV++LCTGD+GF A KTYDLEVW+  Q+ YREIS
Sbjct: 294 PATSYEALEGLTANAERVLQLLELPYRVLALCTGDMGFGATKTYDLEVWVPSQDKYREIS 353

Query: 352 SCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPT 411
           SCS CG+FQ+RRM +RYR+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P 
Sbjct: 354 SCSNCGDFQARRMQARYRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPD 413

Query: 412 VLRPYMNNLAVI 423
           VL+PYM  + VI
Sbjct: 414 VLKPYMGGIEVI 425


>gi|307706061|ref|ZP_07642880.1| seryl-tRNA synthetase [Streptococcus mitis SK321]
 gi|307618461|gb|EFN97609.1| seryl-tRNA synthetase [Streptococcus mitis SK321]
          Length = 424

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 205/426 (48%), Positives = 279/426 (65%), Gaps = 5/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IR + + +   L  R ++      +  +D K R ++ K+E ++A RN+ SA+I 
Sbjct: 1   MLDIKRIRTDFDSVAEKLATRGVDAAVLNDMKEIDAKRRDILVKVETLKAERNTVSAEIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA  + N    D       TL  ++  L+ E  E+ + L +  + +PN+P + VP+G   
Sbjct: 61  QA--KRNKENADDKIAAMQTLSAEVKALDAELAEIDAKLTEFTTTLPNIPADSVPVGADE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            +N+ +R  G         + H+++GE LG++D++R  K++GARF    G  A LERA+ 
Sbjct: 119 EDNVEVRRWGTPREFDFEPKAHWDLGEDLGILDWERGGKVTGARFLFYKGLGARLERAIY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLTN 238
            FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+EV LTN
Sbjct: 179 NFMLDEHGKE-GYTEVITPYMVNHDSMFGTGQYPKFKEDTFELSDSNYVLIPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E+S+ E
Sbjct: 238 YYRDEILDGKDLPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESYEE 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M + AE IL++L+L YRVV+L TGD+GFSA KTYDLEVW+  QN YREISSCS   +
Sbjct: 298 LEKMTANAENILQKLNLPYRVVALSTGDMGFSAAKTYDLEVWIPAQNTYREISSCSNTED 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY NADGSVTIP VLRPYM 
Sbjct: 358 FQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNADGSVTIPEVLRPYMG 417

Query: 419 NLAVIK 424
             AVIK
Sbjct: 418 GAAVIK 423


>gi|194099100|ref|YP_002002185.1| seryl-tRNA synthetase [Neisseria gonorrhoeae NCCP11945]
 gi|239999406|ref|ZP_04719330.1| seryl-tRNA synthetase [Neisseria gonorrhoeae 35/02]
 gi|240017028|ref|ZP_04723568.1| seryl-tRNA synthetase [Neisseria gonorrhoeae FA6140]
 gi|240081336|ref|ZP_04725879.1| seryl-tRNA synthetase [Neisseria gonorrhoeae FA19]
 gi|240116105|ref|ZP_04730167.1| seryl-tRNA synthetase [Neisseria gonorrhoeae PID18]
 gi|240118389|ref|ZP_04732451.1| seryl-tRNA synthetase [Neisseria gonorrhoeae PID1]
 gi|240126134|ref|ZP_04739020.1| seryl-tRNA synthetase [Neisseria gonorrhoeae SK-92-679]
 gi|240128611|ref|ZP_04741272.1| seryl-tRNA synthetase [Neisseria gonorrhoeae SK-93-1035]
 gi|260440085|ref|ZP_05793901.1| seryl-tRNA synthetase [Neisseria gonorrhoeae DGI2]
 gi|268595226|ref|ZP_06129393.1| seryl-tRNA synthetase [Neisseria gonorrhoeae 35/02]
 gi|268597438|ref|ZP_06131605.1| seryl-tRNA synthetase [Neisseria gonorrhoeae FA19]
 gi|268601771|ref|ZP_06135938.1| seryl-tRNA synthetase [Neisseria gonorrhoeae PID18]
 gi|268604101|ref|ZP_06138268.1| seryl-tRNA synthetase [Neisseria gonorrhoeae PID1]
 gi|268684720|ref|ZP_06151582.1| seryl-tRNA synthetase [Neisseria gonorrhoeae SK-92-679]
 gi|268686999|ref|ZP_06153861.1| seryl-tRNA synthetase [Neisseria gonorrhoeae SK-93-1035]
 gi|291043373|ref|ZP_06569096.1| seryl-tRNA synthetase [Neisseria gonorrhoeae DGI2]
 gi|238690216|sp|B4RN50|SYS_NEIG2 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|193934390|gb|ACF30214.1| seryl-tRNA synthetase [Neisseria gonorrhoeae NCCP11945]
 gi|268548615|gb|EEZ44033.1| seryl-tRNA synthetase [Neisseria gonorrhoeae 35/02]
 gi|268551226|gb|EEZ46245.1| seryl-tRNA synthetase [Neisseria gonorrhoeae FA19]
 gi|268585902|gb|EEZ50578.1| seryl-tRNA synthetase [Neisseria gonorrhoeae PID18]
 gi|268588232|gb|EEZ52908.1| seryl-tRNA synthetase [Neisseria gonorrhoeae PID1]
 gi|268625004|gb|EEZ57404.1| seryl-tRNA synthetase [Neisseria gonorrhoeae SK-92-679]
 gi|268627283|gb|EEZ59683.1| seryl-tRNA synthetase [Neisseria gonorrhoeae SK-93-1035]
 gi|291012979|gb|EFE04962.1| seryl-tRNA synthetase [Neisseria gonorrhoeae DGI2]
 gi|317164654|gb|ADV08195.1| seryl-tRNA synthetase [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 431

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 204/427 (47%), Positives = 275/427 (64%), Gaps = 9/427 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L +R  +  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLARRGYDFDTARFDALEERRKSVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPPGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTLQHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVAGSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYGALEEMVGHAENILKALELPYRVITLCTGDMGFSAAKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNL 420
           +PYM  +
Sbjct: 419 QPYMGGV 425


>gi|152969482|ref|YP_001334591.1| seryl-tRNA synthetase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|238893954|ref|YP_002918688.1| seryl-tRNA synthetase [Klebsiella pneumoniae NTUH-K2044]
 gi|166222736|sp|A6T6Z0|SYS_KLEP7 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|150954331|gb|ABR76361.1| seryl-tRNA synthetase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|238546270|dbj|BAH62621.1| seryl-tRNA synthetase [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 430

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 203/431 (47%), Positives = 273/431 (63%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRTEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVQTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L EQL   + E   + + ++ +   IPN+P ++VP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEQLDAAKSELETLLAEIRDIALAIPNIPHDDVPVGRDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE  G +DF  A KL+G+RF V+ G LA L RAL Q
Sbjct: 119 DNVEVSRWGTPRQFDFEVRDHVTLGEMHGGLDFAAAVKLTGSRFVVMKGQLARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T        +    LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR V+LCTGD+GFSACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKVALCTGDMGFSACKTYDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + IP V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVALMENYQQADGRIEIPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMRGLEYI 429


>gi|290579784|ref|YP_003484176.1| putative seryl-tRNA synthetase [Streptococcus mutans NN2025]
 gi|254996683|dbj|BAH87284.1| putative seryl-tRNA synthetase [Streptococcus mutans NN2025]
          Length = 426

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 208/430 (48%), Positives = 281/430 (65%), Gaps = 15/430 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILS-LDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IR + + +   L +R ++ ++ + L  LD K R L+ K E+ +A RN+ SA I 
Sbjct: 1   MLDIKRIRNDFDQIAEKLARRGVDEKTLHDLKELDFKRRQLLIKSEEAKAERNTASAAIA 60

Query: 60  QAI-----AEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVP 114
           QA      A   ++ +  L  E   L  QL        E+   LK   + +PN+P ++VP
Sbjct: 61  QAKRNQEDASEQIAAMQKLSAEIKALDAQLV-------EIDGQLKTFTTTLPNIPADDVP 113

Query: 115 IGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           +G   +EN+ +R  GK        + H+++GE L ++D++R +K++G+RF    G  A L
Sbjct: 114 LGADEDENVEMRRWGKPRQFDFDIKAHWDLGEDLDILDWERGSKVTGSRFLFYKGLGARL 173

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSE 233
           ERA+  FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F   D  + LIPT+E
Sbjct: 174 ERAIYNFMLDEHAKE-GYTEVIPPYMVNHDSMFGTGQYPKFKEDTFELADNDYVLIPTAE 232

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V LTN Y  EII+ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E
Sbjct: 233 VPLTNYYRGEIIDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPE 292

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
           DS+ E E+M + AE IL++L+L YRV++LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 293 DSYNELEKMTANAENILQKLELPYRVITLCTGDMGFSAAKTYDLEVWIPAQNTYREISSC 352

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY NADGSVTIP VL
Sbjct: 353 SNTEDFQARRAQIRYRDEVDGKVKLLHTLNGSGLAVGRTVAAILENYQNADGSVTIPEVL 412

Query: 414 RPYMNNLAVI 423
           RPY+  + VI
Sbjct: 413 RPYIGGVQVI 422


>gi|256964070|ref|ZP_05568241.1| seryl-tRNA synthetase [Enterococcus faecalis HIP11704]
 gi|307274105|ref|ZP_07555314.1| seryl-tRNA synthetase [Enterococcus faecalis TX0855]
 gi|256954566|gb|EEU71198.1| seryl-tRNA synthetase [Enterococcus faecalis HIP11704]
 gi|306509230|gb|EFM78291.1| seryl-tRNA synthetase [Enterococcus faecalis TX0855]
          Length = 423

 Score =  401 bits (1031), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 206/428 (48%), Positives = 284/428 (66%), Gaps = 11/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEY-ILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IRQN E +   LK R ++ +     L+LDE+ R L+ K+E+++  RN  S +I 
Sbjct: 1   MLDMKKIRQNVEVVQKKLKTRGVDEEVLLRFLALDEERRALLVKVEELKKHRNQVSGEIA 60

Query: 60  Q---AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIG 116
           Q   A  + +  L++        + EQ+ +L++E   +      +   +PN+P E VP+G
Sbjct: 61  QLKRAQKDASQQLLN-----MQEVSEQIKVLDQEVVHLQEQCTAIAERLPNLPHESVPVG 115

Query: 117 TSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLER 176
                N+ +R      +     + H+EIGEALG++DF+R  K+SG+RF    G  A LER
Sbjct: 116 ADEAANVEVRRWSTPKTFSFEPKPHWEIGEALGILDFERGAKVSGSRFLYYKGLGARLER 175

Query: 177 ALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVS 235
           A+  FM+D H +EHGYTEV  P LV  +AM+GTGQ PKF +D+F   +    LIPT+EV 
Sbjct: 176 AVYNFMLDQHVNEHGYTEVIPPYLVNSKAMFGTGQFPKFKEDVFQVAESDLTLIPTAEVP 235

Query: 236 LTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDS 295
           LTN Y++EI+E++ LP+ FT L+PSFRSEAGSAGRDTRG++R HQF K E+V  +  E S
Sbjct: 236 LTNYYNNEILEAQELPIYFTALSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFSDAEHS 295

Query: 296 FTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCST 355
           + E E+M + A +IL++L L YRV++L TGD+GFSA KTYDLEVW+  Q +YREISSCS 
Sbjct: 296 YEELEKMTNNAGDILEKLGLPYRVITLSTGDMGFSAAKTYDLEVWIPAQKMYREISSCSN 355

Query: 356 CGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
           C +FQ+RR   RYRD  +  +++ HTLNGSG+AVGR + AILENY N DG+VTIP VLRP
Sbjct: 356 CEDFQARRALIRYRD-KTGHVQYAHTLNGSGLAVGRTVAAILENYQNEDGTVTIPEVLRP 414

Query: 416 YMNNLAVI 423
           YM  L  I
Sbjct: 415 YMGGLTKI 422


>gi|269214206|ref|ZP_05986067.2| serine--tRNA ligase [Neisseria lactamica ATCC 23970]
 gi|269210393|gb|EEZ76848.1| serine--tRNA ligase [Neisseria lactamica ATCC 23970]
          Length = 441

 Score =  401 bits (1031), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 204/428 (47%), Positives = 274/428 (64%), Gaps = 9/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L  R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 11  MLDIQSLRSNTAAVAERLAARGYEFDAARFNALEEQRKAVQVKTEELQASRNSISKQIGA 70

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +S IPN+P + VP G    
Sbjct: 71  LKGQGRHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLSGIPNLPHKSVPAGKDET 130

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 131 ENVEVRRVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMRGQIARLHRALAQ 189

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT EHGYTE   P +V    +YGTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 190 FMLDTHTLEHGYTEHYTPYIVNGGTLYGTGQLPKFAEDLFHVTRGGDESKTAQYLIPTAE 249

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II  + LPL+ T  +P FRSEAG+ G+D RG++RQHQF K E+V I   E
Sbjct: 250 VTLTNTVAGSIIPFEQLPLKLTAHSPCFRSEAGAYGKDVRGLIRQHQFDKVEMVQIVHPE 309

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 310 KSYGALEEMVGHAENILKALELPYRVITLCTGDMGFGAAKTYDLEVWVPAQNTYREISSC 369

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IPT L
Sbjct: 370 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPTAL 428

Query: 414 RPYMNNLA 421
           +PYM  +A
Sbjct: 429 QPYMGGVA 436


>gi|71737900|ref|YP_275259.1| seryl-tRNA synthetase [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|257485413|ref|ZP_05639454.1| seryl-tRNA synthetase [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|289625403|ref|ZP_06458357.1| seryl-tRNA synthetase [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289649314|ref|ZP_06480657.1| seryl-tRNA synthetase [Pseudomonas syringae pv. aesculi str. 2250]
 gi|298487528|ref|ZP_07005570.1| Seryl-tRNA synthetase [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|123635963|sp|Q48H74|SYS_PSE14 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|71558453|gb|AAZ37664.1| seryl-tRNA synthetase [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|298157912|gb|EFH98990.1| Seryl-tRNA synthetase [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|330866860|gb|EGH01569.1| seryl-tRNA synthetase [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330987919|gb|EGH86022.1| seryl-tRNA synthetase [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 426

 Score =  401 bits (1031), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 206/433 (47%), Positives = 281/433 (64%), Gaps = 18/433 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R        I SL+ + +++  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRTQLQDVADRLASRGFTLDVARIESLEAQRKVVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A   G      ++ V+ + NE S  K +L  ++ E       L  L+  IPN+P E VP+
Sbjct: 61  AKQRGEDIAPLMADVERMGNELSEGKVELDGIQAE-------LDALVLSIPNLPHESVPV 113

Query: 116 GTSANENILIRSVGKKPSAIHLS-REHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           G     N+ +R  G  P+A     ++H  +GE  G +DF+ A KLSGARF++L G +A L
Sbjct: 114 GADEEGNVEVRRWGT-PTAFDFEVKDHVALGEKFGWLDFETAAKLSGARFALLRGPIARL 172

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIP 230
            RAL QFMI+LH +EHGY E   P LV+  A+ GTGQ+PKF +D+F  T +G    +LIP
Sbjct: 173 HRALAQFMINLHINEHGYEETYTPYLVQAPALQGTGQLPKFEEDLFKITREGEADLYLIP 232

Query: 231 TSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT 290
           T+EVSLTN+ S EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I 
Sbjct: 233 TAEVSLTNIVSGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIV 292

Query: 291 REEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREI 350
             EDS    E +   AE +L+ L+L YR ++LCTGD+GFSA KTYDLEVW+  Q+ YREI
Sbjct: 293 APEDSMAALESLTGNAERVLQLLELPYRTLALCTGDMGFSAVKTYDLEVWIPSQDKYREI 352

Query: 351 SSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIP 410
           SSCS CG+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P
Sbjct: 353 SSCSNCGDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVP 412

Query: 411 TVLRPYMNNLAVI 423
            VL+PYM  L VI
Sbjct: 413 EVLKPYMGGLEVI 425


>gi|309378431|emb|CBX22926.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 431

 Score =  401 bits (1031), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 204/431 (47%), Positives = 274/431 (63%), Gaps = 9/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L  R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQSLRSNTAAVAERLAARGYEFDAARFNALEEQRKAVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G      A  ++ + +K  L     +   V   L   +S IPN+P E VP G    
Sbjct: 61  LKGRGRHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLSGIPNLPHESVPAGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRRVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT EHGYTE   P +V    +YGTGQ+PKF +D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTLEHGYTEHYTPYIVNGGTLYGTGQLPKFGEDLFHVTRGGDESKTAQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAG+ G+D RG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVAGSIIPSEQLPLKLTAHSPCFRSEAGAYGKDVRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYGALEEMVGHAENILKALELPYRVITLCTGDMGFGAAKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIK 424
           +PYM  +A ++
Sbjct: 419 QPYMGGVAKLE 429


>gi|300716073|ref|YP_003740876.1| Seryl-tRNA synthetase [Erwinia billingiae Eb661]
 gi|299061909|emb|CAX59025.1| Seryl-tRNA synthetase [Erwinia billingiae Eb661]
          Length = 430

 Score =  401 bits (1031), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 199/431 (46%), Positives = 277/431 (64%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + S +E+ ++L  + E ++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGYKLDVDTLRSQEERRKVLQVETETLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E L   + E  E+ ++++++ S IPN+P++EVP+G   +
Sbjct: 61  AKARGED--IEPLRQEVNALGESLDAAKAELDELLNAIREMASAIPNIPVDEVPLGKDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +   G         R+H E+GE    +DF    KL+G+RF V+ G +A + RAL Q
Sbjct: 119 ENLEVSRWGTPREFDFAVRDHVELGEMASGLDFAMGAKLTGSRFVVMQGQIALMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLHT +HGY E   P LV   +++GTGQ+PKF +D+F T        +    LIPTS
Sbjct: 179 FMLDLHTEQHGYLETYVPYLVNHASLHGTGQLPKFGEDLFHTRPLEEEASSSDYALIPTS 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTN+   EI+E +SLPL+FT   P FRSEAG+ GRDTRG++R HQF K E+V ITR 
Sbjct: 239 EVPLTNMVRDEILEEESLPLKFTAHTPCFRSEAGAYGRDTRGLIRMHQFDKVEMVHITRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E ++  AE++L+ L+L YR V LCTGD+GF +CKTYDLEVWL  Q+ YREISS
Sbjct: 299 EDSMDALEELVGHAEKVLQLLELPYRKVLLCTGDMGFGSCKTYDLEVWLPAQDTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS  G+FQ+RRM +R R    K  +  HTLNGSG+AVGR L+A+LENY  ADG + +P V
Sbjct: 359 CSNMGDFQARRMQARCRPKTEKKTRLVHTLNGSGLAVGRTLVAVLENYQQADGRIAVPEV 418

Query: 413 LRPYMNNLAVI 423
           L+PYM  L  +
Sbjct: 419 LKPYMKGLEFV 429


>gi|218768704|ref|YP_002343216.1| seryl-tRNA synthetase [Neisseria meningitidis Z2491]
 gi|30173212|sp|Q9JT77|SYS_NEIMA RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|121052712|emb|CAM09055.1| seryl-tRNA synthetase [Neisseria meningitidis Z2491]
 gi|319410937|emb|CBY91332.1| seryl-tRNA synthetase (serine-tRNA ligase; SerRS) [Neisseria
           meningitidis WUE 2594]
          Length = 431

 Score =  401 bits (1031), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 203/428 (47%), Positives = 275/428 (64%), Gaps = 9/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L +R  +  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLARRGYDFDTARFDALEERRKSVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G         ++ + +K  L     +   V   L   +  IPN+P E+VP G    
Sbjct: 61  LKGQGKHEEAQVAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHEDVPFGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTLKHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDESKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVAGSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYETLEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLA 421
           +PYM  +A
Sbjct: 419 QPYMGGVA 426


>gi|24380240|ref|NP_722195.1| seryl-tRNA synthetase [Streptococcus mutans UA159]
 gi|30173154|sp|Q8DSB7|SYS_STRMU RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|24378250|gb|AAN59501.1|AE015015_1 putative seryl-tRNA synthetase [Streptococcus mutans UA159]
          Length = 426

 Score =  401 bits (1031), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 205/425 (48%), Positives = 281/425 (66%), Gaps = 5/425 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILS-LDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IR + + +   L +R ++ ++ + L  LD K R L+ K E+ +A RN+ SA I 
Sbjct: 1   MLDIKRIRNDFDQIAEKLARRGVDEKTLHDLKELDFKRRQLLIKSEEAKAERNTASAAIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA  + N         +   L  ++  L+ +  E+   LK   + +PN+P ++VP+G   
Sbjct: 61  QA--KRNQEDASEQIADMQKLSAEIKALDAQLVEIDGQLKTFTTTLPNIPADDVPLGADE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +EN+ +R  GK        + H+++GE L ++D++R +K++G+RF    G  A LERA+ 
Sbjct: 119 DENVEMRRWGKPRQFDFDIKAHWDLGEDLDILDWERGSKVTGSRFLFYKGLGARLERAIY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLTN 238
            FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F   D  + LIPT+EV LTN
Sbjct: 179 NFMLDEHAKE-GYTEVIPPYMVNHDSMFGTGQYPKFKEDTFELADNDYVLIPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  EII+ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + EDS+ E
Sbjct: 238 YYRGEIIDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEDSYNE 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M + AE IL++L+L YRV++LCTGD+GFSA KTYDLEVW+  QN YREISSCS   +
Sbjct: 298 LEKMTANAENILQKLELPYRVITLCTGDMGFSAAKTYDLEVWIPAQNTYREISSCSNTED 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY NADGSVTIP VLRPY+ 
Sbjct: 358 FQARRAQIRYRDEVDGKVKLLHTLNGSGLAVGRTVAAILENYQNADGSVTIPEVLRPYIG 417

Query: 419 NLAVI 423
            + VI
Sbjct: 418 GVQVI 422


>gi|148543336|ref|YP_001270706.1| seryl-tRNA synthetase [Lactobacillus reuteri DSM 20016]
 gi|184152746|ref|YP_001841087.1| seryl-tRNA synthetase [Lactobacillus reuteri JCM 1112]
 gi|227364408|ref|ZP_03848498.1| seryl-tRNA synthetase [Lactobacillus reuteri MM2-3]
 gi|325683608|ref|ZP_08163124.1| serine--tRNA ligase [Lactobacillus reuteri MM4-1A]
 gi|166987314|sp|A5VHP5|SYS_LACRD RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|229890222|sp|B2G575|SYS_LACRJ RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|148530370|gb|ABQ82369.1| seryl-tRNA synthetase [Lactobacillus reuteri DSM 20016]
 gi|183224090|dbj|BAG24607.1| seryl-tRNA synthase [Lactobacillus reuteri JCM 1112]
 gi|227070501|gb|EEI08834.1| seryl-tRNA synthetase [Lactobacillus reuteri MM2-3]
 gi|324977958|gb|EGC14909.1| serine--tRNA ligase [Lactobacillus reuteri MM4-1A]
          Length = 435

 Score =  401 bits (1031), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 206/431 (47%), Positives = 292/431 (67%), Gaps = 6/431 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IRQ P+     L  R ++P+  + +++LD+K R L+++ E ++A+RN  S +IG
Sbjct: 1   MLDIKKIRQEPDFYKEKLATRGVKPEEIDEVIALDKKRRELLQQTETMKAQRNEASKKIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           +A   G  +  DA   ET  L +++  L+ E     + L   ++ +PNVP + VP+  + 
Sbjct: 61  EAKRNGESA--DAAIKETRELGDKIKELDTEVEANDAELHDKMAHLPNVPHDGVPVSLTE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +  + +R VGK        + H++IGE LG++DFDRA K+SGARF    G  A LERA+ 
Sbjct: 119 DGAVELRKVGKVRDFDFEPKHHWDIGENLGILDFDRAGKVSGARFVYYLGLGAQLERAVY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGRWLIPTSEVSLTN 238
            FM+D H  E GYTEV  P +V  ++MYGTGQ PKF + ++    +   LIPT+EV LTN
Sbjct: 179 NFMLDEHMKE-GYTEVLPPYIVNADSMYGTGQFPKFKEGVYQVNGEDMTLIPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  E+I ++ LP+  T L PSFRSEAG+AGRDTRG++R HQF K E+V  T+ E+S+ E
Sbjct: 238 YYRGEVIPTEELPVYVTALTPSFRSEAGAAGRDTRGLIRMHQFNKVEMVKYTKPENSWDE 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M + AE ILK+L+L Y V++L TGD+ F+A +T+DLE+W+  QN YRE+SSCS C +
Sbjct: 298 LEKMTANAENILKKLNLPYHVITLTTGDMSFTASETHDLELWMPAQNKYREVSSCSNCLD 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRM+++YRD N K L++ HTLNGSG+AVGR + AILENY NADGSVTIP VL PYM+
Sbjct: 358 FQARRMHTQYRDENGK-LQYVHTLNGSGLAVGRTVAAILENYQNADGSVTIPEVLVPYMH 416

Query: 419 NLAVIKKEHIL 429
            +  I KE+ +
Sbjct: 417 GVTKITKENAV 427


>gi|21231048|ref|NP_636965.1| seryl-tRNA synthetase [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66768947|ref|YP_243709.1| seryl-tRNA synthetase [Xanthomonas campestris pv. campestris str.
           8004]
 gi|188992061|ref|YP_001904071.1| seryl-tRNA synthetase [Xanthomonas campestris pv. campestris str.
           B100]
 gi|30173176|sp|Q8PA92|SYS_XANCP RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|81305089|sp|Q4UTD4|SYS_XANC8 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|229470725|sp|B0RUV8|SYS_XANCB RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|21112675|gb|AAM40889.1| seryl-tRNA synthetase [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66574279|gb|AAY49689.1| seryl-tRNA synthetase [Xanthomonas campestris pv. campestris str.
           8004]
 gi|167733821|emb|CAP52027.1| unnamed protein product [Xanthomonas campestris pv. campestris]
          Length = 426

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 209/427 (48%), Positives = 275/427 (64%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKK-RHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD   +RQ+P  L   L+  R  +  +  + SL+ + + +  + +++++ RNS S  IG
Sbjct: 1   MLDPALLRQHPADLAERLRSTRGFDLNTAELESLESERKRIQVRTQELQSLRNSKSKAIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA A+G    V AL  E +   ++L   E     + + L+ +   IPN+P   VP G   
Sbjct: 61  QAKAKGED--VAALMAEVAGFGDELKASEDALDVIRAQLEGIALGIPNLPAANVPAGKDE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +EN+     G         ++H E+G   G +D + A KLSGARF+VL G +A L RAL 
Sbjct: 119 SENVEQARWGTPRQFDFAVKDHVELGAPHGWLDGETAAKLSGARFTVLRGPIARLHRALA 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG---RWLIPTSEVSL 236
           QFM+DLH  EHGY E + PLLV  ++M GTGQ+PKF DD+F T  G   R+LIPTSEV L
Sbjct: 179 QFMLDLHVGEHGYEETNVPLLVNADSMRGTGQLPKFEDDLFQTEVGDSKRYLIPTSEVPL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+    I++++ LPLR T  +  FR+EAGS GRDTRGM+RQHQF K ELV+    EDS 
Sbjct: 239 TNIVRDAIVDAERLPLRMTAHSMCFRAEAGSGGRDTRGMIRQHQFEKVELVTACSPEDSE 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            EH+RM  CAE +L++L L YR V LCTGD+GFSA KTYDLEVWL  Q  YREISSCS C
Sbjct: 299 AEHQRMTRCAEVVLEKLGLPYRKVLLCTGDMGFSAIKTYDLEVWLPSQATYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +R+R+P S   +  HTLNGSG AVGR +IA++ENY NADGS+ +P  LRPY
Sbjct: 359 GDFQARRMQARWRNPASGKPELLHTLNGSGTAVGRAMIAVMENYQNADGSIDVPDALRPY 418

Query: 417 MNNLAVI 423
           M  L  I
Sbjct: 419 MGGLERI 425


>gi|194467495|ref|ZP_03073482.1| seryl-tRNA synthetase [Lactobacillus reuteri 100-23]
 gi|194454531|gb|EDX43428.1| seryl-tRNA synthetase [Lactobacillus reuteri 100-23]
          Length = 435

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 206/431 (47%), Positives = 292/431 (67%), Gaps = 6/431 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IRQ P+     L  R ++P+  + +++LD+K R L+++ E ++A+RN  S +IG
Sbjct: 1   MLDIKKIRQEPDFYKEKLATRGVKPEEIDEVIALDKKRRELLQQTETMKAQRNEASKKIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           +A   G  +  DA   ET  L +++  L+ E     + L   ++ +PNVP + VP+  + 
Sbjct: 61  EAKRNGESA--DAAIKETRELGDKIKELDAEVEANDAELHDKMAHLPNVPHDGVPVSLTE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +  + +R VGK        + H++IGE LG++DFDRA K+SGARF    G  A LERA+ 
Sbjct: 119 DGAVELRKVGKVRDFDFEPKHHWDIGENLGILDFDRAGKVSGARFVYYLGLGAQLERAVY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGRWLIPTSEVSLTN 238
            FM+D H  E GYTEV  P +V  ++MYGTGQ PKF + ++    +   LIPT+EV LTN
Sbjct: 179 NFMLDEHMKE-GYTEVLPPYIVNADSMYGTGQFPKFKEGVYQVNGEDMTLIPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  E+I ++ LP+  T L PSFRSEAG+AGRDTRG++R HQF K E+V  T+ E+S+ E
Sbjct: 238 YYRGEVIPTEELPVYVTALTPSFRSEAGAAGRDTRGLIRMHQFNKVEMVKYTKPENSWDE 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M + AE ILK+L+L Y V++L TGD+ F+A +T+DLE+W+  QN YRE+SSCS C +
Sbjct: 298 LEKMTANAENILKKLNLPYHVITLTTGDMSFTASETHDLELWMPAQNKYREVSSCSNCLD 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRM+++YRD N K L++ HTLNGSG+AVGR + AILENY NADGSVTIP VL PYM+
Sbjct: 358 FQARRMHTQYRDENGK-LQYVHTLNGSGLAVGRTVAAILENYQNADGSVTIPEVLVPYMH 416

Query: 419 NLAVIKKEHIL 429
            +  I KE+ +
Sbjct: 417 GVTKITKENAV 427


>gi|206577361|ref|YP_002239454.1| seryl-tRNA synthetase [Klebsiella pneumoniae 342]
 gi|238065104|sp|B5XY99|SYS_KLEP3 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|206566419|gb|ACI08195.1| seryl-tRNA synthetase [Klebsiella pneumoniae 342]
          Length = 430

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 202/431 (46%), Positives = 273/431 (63%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRTEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVQTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L EQL   + E   + + ++ +   IPN+P ++VP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEQLDAAKSELETLLAEIRDIALAIPNIPHDDVPVGRDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE  G +DF  A KL+G+RF V+ G LA L RAL Q
Sbjct: 119 DNVEVSRWGTPRQFDFEVRDHVTLGEMHGGLDFAAAVKLTGSRFVVMKGQLARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T        +    LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR V+LCTGD+GFSACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMVALEEMTGHAEKVLQLLGLPYRKVALCTGDMGFSACKTYDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + IP +
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVALMENYQQADGRIEIPEI 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMRGLEYI 429


>gi|288936304|ref|YP_003440363.1| seryl-tRNA synthetase [Klebsiella variicola At-22]
 gi|290510641|ref|ZP_06550011.1| seryl-tRNA synthetase [Klebsiella sp. 1_1_55]
 gi|288891013|gb|ADC59331.1| seryl-tRNA synthetase [Klebsiella variicola At-22]
 gi|289777357|gb|EFD85355.1| seryl-tRNA synthetase [Klebsiella sp. 1_1_55]
          Length = 430

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 202/431 (46%), Positives = 273/431 (63%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRTEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVQTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L EQL   + E   + + ++ +   IPN+P ++VP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEQLDAAKSELETLLAEIRDIALAIPNIPHDDVPVGRDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE  G +DF  A KL+G+RF V+ G LA L RAL Q
Sbjct: 119 DNVEVSRWGTPRQFDFEVRDHVTLGEMHGGLDFAAAVKLTGSRFVVMKGQLARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T        +    LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR V+LCTGD+GFSACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKVALCTGDMGFSACKTYDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + IP +
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVALMENYQQADGRIEIPEI 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMRGLEYI 429


>gi|324992052|gb|EGC23974.1| serine--tRNA ligase [Streptococcus sanguinis SK405]
 gi|325697635|gb|EGD39520.1| serine--tRNA ligase [Streptococcus sanguinis SK160]
 gi|327459354|gb|EGF05700.1| serine--tRNA ligase [Streptococcus sanguinis SK1]
 gi|327490570|gb|EGF22351.1| serine--tRNA ligase [Streptococcus sanguinis SK1058]
          Length = 425

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 205/430 (47%), Positives = 283/430 (65%), Gaps = 15/430 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IR + + +   L  R ++  +   + S+D++ R L+ K+E+++A RN+ SA+I 
Sbjct: 1   MLDLKRIRTDFDSVAEKLATRGVDAATLNQMKSIDKERRDLLVKVEELKAERNTVSAEIA 60

Query: 60  QAI-----AEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVP 114
           QA      A+  ++ +  L  E  TL   L        E+ + L +  + +PN+P E VP
Sbjct: 61  QAKRNKENADDKIAAMQKLSAEVKTLDATLA-------ELDAKLTEFTTTLPNIPHESVP 113

Query: 115 IGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           +G   +EN+ +R  G        ++ H+++GE L ++D++R  K++GARF    G  A L
Sbjct: 114 VGADEDENVEVRRWGTPRQFDFEAKAHWDLGEELDILDWERGAKVTGARFLFYKGLGARL 173

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSE 233
           ERA+  FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+E
Sbjct: 174 ERAIYNFMLDEHGKE-GYTEVITPYMVNHDSMFGTGQYPKFKEDTFELSDTNFVLIPTAE 232

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V LTN Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E
Sbjct: 233 VPLTNYYRDEILDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPE 292

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
           +S+ E E+M + AE IL++L+L YRVV+LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 293 ESYEELEKMTANAENILQKLNLPYRVVALCTGDMGFSAAKTYDLEVWIPAQNTYREISSC 352

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP VL
Sbjct: 353 SNTEDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVL 412

Query: 414 RPYMNNLAVI 423
           RPYM  L VI
Sbjct: 413 RPYMGGLEVI 422


>gi|227518019|ref|ZP_03948068.1| seryl-tRNA synthetase [Enterococcus faecalis TX0104]
 gi|307287079|ref|ZP_07567152.1| seryl-tRNA synthetase [Enterococcus faecalis TX0109]
 gi|227074541|gb|EEI12504.1| seryl-tRNA synthetase [Enterococcus faecalis TX0104]
 gi|306501858|gb|EFM71148.1| seryl-tRNA synthetase [Enterococcus faecalis TX0109]
 gi|315151232|gb|EFT95248.1| seryl-tRNA synthetase [Enterococcus faecalis TX0012]
 gi|315165765|gb|EFU09782.1| seryl-tRNA synthetase [Enterococcus faecalis TX1302]
          Length = 423

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 206/428 (48%), Positives = 283/428 (66%), Gaps = 11/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEY-ILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IRQN E +   LK R ++ +     L+LDE+ R L+ K+E+++  RN  S +I 
Sbjct: 1   MLDMKKIRQNVEVVQKKLKTRGVDEEVLLRFLALDEERRALLVKVEELKKHRNQVSGEIA 60

Query: 60  Q---AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIG 116
           Q   A  + +  L++        + EQ+ +L++E   +      +   +PN+P E VP+G
Sbjct: 61  QLKRAQKDASQQLLN-----MQEVSEQIKVLDQEVVHLQEQCTAIAERLPNLPHESVPVG 115

Query: 117 TSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLER 176
                N+ +R      +     + H+EIGEALG++DF+R  K+SG+RF    G  A LER
Sbjct: 116 ADEAANVEVRRWSTPKTFSFEPKPHWEIGEALGILDFERGAKVSGSRFLYYKGLGARLER 175

Query: 177 ALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVS 235
           A+  FM+D H +EHGYTEV  P LV  +AM+GTGQ PKF +D+F   +    LIPT+EV 
Sbjct: 176 AVYNFMLDQHVNEHGYTEVIPPYLVNSKAMFGTGQFPKFKEDVFQVAESDLTLIPTAEVP 235

Query: 236 LTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDS 295
           LTN Y++EI+E++ LP+ FT L+PSFRSEAGSAGRDTRG++R HQF K E+V  +  E S
Sbjct: 236 LTNYYNNEILEAQELPIYFTALSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFSDAEHS 295

Query: 296 FTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCST 355
           + E E+M + A +IL++L L YRV++L TGD+GFSA KTYDLEVW+  Q  YREISSCS 
Sbjct: 296 YEELEKMTNNAGDILEKLGLPYRVITLSTGDMGFSAAKTYDLEVWIPAQKTYREISSCSN 355

Query: 356 CGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
           C +FQ+RR   RYRD   + +++ HTLNGSG+AVGR + AILENY N DG+VTIP VLRP
Sbjct: 356 CEDFQARRALIRYRDKTGQ-VQYAHTLNGSGLAVGRTVAAILENYQNEDGTVTIPEVLRP 414

Query: 416 YMNNLAVI 423
           YM  L  I
Sbjct: 415 YMGGLTKI 422


>gi|329998190|ref|ZP_08303002.1| serine--tRNA ligase [Klebsiella sp. MS 92-3]
 gi|328538805|gb|EGF64880.1| serine--tRNA ligase [Klebsiella sp. MS 92-3]
          Length = 430

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/431 (47%), Positives = 272/431 (63%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRTEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVQTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L EQL   + E   + + ++ +   IPN+P ++VP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEQLDAAKSELETLLAEIRDIALAIPNIPHDDVPVGRDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE  G +DF  A KL+G+RF V+ G LA L RAL Q
Sbjct: 119 DNVEVSRWGTPRQFDFEVRDHVTLGEMHGGLDFAAAVKLTGSRFVVMKGQLARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T        +    LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII    LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIINEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR V+LCTGD+GFSACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKVALCTGDMGFSACKTYDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + IP V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVALMENYQQADGRIEIPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMRGLEYI 429


>gi|319941978|ref|ZP_08016299.1| seryl-tRNA synthetase [Sutterella wadsworthensis 3_1_45B]
 gi|319804631|gb|EFW01501.1| seryl-tRNA synthetase [Sutterella wadsworthensis 3_1_45B]
          Length = 432

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 202/426 (47%), Positives = 279/426 (65%), Gaps = 12/426 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD+  +R+N   +   LK R+ +   +    L+E+ + + KK E+++ARRNS S  IG 
Sbjct: 1   MLDVTMLRKNLPEVVARLKTRNFDFPVDAFNELEERRKSVQKKTEELQARRNSLSKDIG- 59

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            + + N      L  + + +  +L  LE E  E+   L  L+  +PN+P    PIG    
Sbjct: 60  -MMKKNGEDASELLAQAAAIPGELKALEDELEEIREKLHDLMLRVPNLPSPTTPIGKDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G   +     ++H ++G  LGL DFD A KLSGARF+ + G +AHL RAL Q
Sbjct: 119 ENVEVRRWGTPRTFDFPVKDHVDVGAPLGL-DFDTAAKLSGARFAFMRGEVAHLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG--------RWLIPTS 232
           FM+D+HT E GYTE   P +V    M GTGQ+PKF +D+F    G         +L+PT+
Sbjct: 178 FMLDVHTREQGYTECYTPYIVTASTMTGTGQLPKFEEDLFAAKKGGAYSDLEQMYLVPTA 237

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV+LTN  S +I+++  LP+  T   P FRSEAG+ GRDTRGM+RQHQF K E+V I R 
Sbjct: 238 EVTLTNSVSGQILKAADLPIFLTAHTPCFRSEAGAYGRDTRGMIRQHQFDKVEMVKIVRP 297

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E+S+ + E +   AE IL++L+L YRV++L TGD+GF +CKTYDLEVW+  QN YREISS
Sbjct: 298 EESYDQLESLTHDAEVILQKLNLPYRVMALSTGDIGFGSCKTYDLEVWIPAQNCYREISS 357

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS C +FQ+RRM++R++D N ++ ++ HTLNGSG+AVGR L+A+LENY NADGSVTIP  
Sbjct: 358 CSNCEDFQARRMSARFKDENGRT-RYVHTLNGSGLAVGRTLVAVLENYQNADGSVTIPEA 416

Query: 413 LRPYMN 418
           LRPYMN
Sbjct: 417 LRPYMN 422


>gi|319790114|ref|YP_004151747.1| seryl-tRNA synthetase [Thermovibrio ammonificans HB-1]
 gi|317114616|gb|ADU97106.1| seryl-tRNA synthetase [Thermovibrio ammonificans HB-1]
          Length = 427

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 200/425 (47%), Positives = 277/425 (65%), Gaps = 4/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRH--LEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQI 58
           M+DI+ +R+ PE     L +R        + +L++D + R LI + E+++ARRN  S +I
Sbjct: 1   MIDIKALRREPEKFKELLSRRDPLYASMVDELLAVDAERRALITEAENLKARRNKLSKEI 60

Query: 59  GQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTS 118
           G+   EG       LK E   + E+L  +E+E  EV     +LI  IPN P   VP+G  
Sbjct: 61  GKLFKEGRREEALKLKAEVEEISEKLVKVERELAEVEKKFNRLILSIPNPPHPSVPVGED 120

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
            N+N+++R  G+KP        H++I ++L ++DF+RATKL+G+RF V     A LERAL
Sbjct: 121 ENDNVVVRVWGEKPKFDFTPVPHWDIAKSLDILDFERATKLAGSRFVVYKKWGAKLERAL 180

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGRWLIPTSEVSLT 237
             FM+DLHT+EHGY E+  P LV  + M GTGQ+PKF +D++    +  WLIPT+EV LT
Sbjct: 181 INFMLDLHTTEHGYQEIIPPFLVNTKTMTGTGQLPKFEEDLYKIEGEDLWLIPTAEVPLT 240

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           NL+++EI+  K+LP+ +T   P FR EAG+ GRD RG++R HQF K ELV I   E S+ 
Sbjct: 241 NLHANEILPEKALPIYYTAYTPCFRKEAGAHGRDVRGIMRLHQFNKVELVKIVHPETSYD 300

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E E+++  AE++L+ L LHYRVV LCTGDLGFSA KTYD+EVW+  Q  YREISSCS C 
Sbjct: 301 ELEKLVKEAEKVLQLLGLHYRVVELCTGDLGFSAAKTYDIEVWIPSQERYREISSCSNCE 360

Query: 358 NFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +FQ+RR   R+RD   K+ +  HTLNGSG+AVGR +IAILE +   DGSV +P VL+ Y+
Sbjct: 361 DFQARRAKIRFRDKEGKT-QLVHTLNGSGLAVGRTVIAILEQFQQKDGSVKVPEVLQDYL 419

Query: 418 NNLAV 422
               +
Sbjct: 420 KTKVI 424


>gi|325567669|ref|ZP_08144336.1| serine--tRNA ligase [Enterococcus casseliflavus ATCC 12755]
 gi|325159102|gb|EGC71248.1| serine--tRNA ligase [Enterococcus casseliflavus ATCC 12755]
          Length = 425

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 202/427 (47%), Positives = 280/427 (65%), Gaps = 5/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IRQN   +   L  R ++ +  +  L+LDE+ R L+ + E+ +  RN  S +I 
Sbjct: 1   MLDVKMIRQNFAEVQSKLATRGVQKEVLDRFLTLDERRRELLVQTEERKKLRNEVSGEIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
            A+        D +  +   +  Q+  L++E  ++   +K++ + +PN+P + VP+G   
Sbjct: 61  -ALKRAKEDAADKIA-QMKEVGSQIKQLDEEIAQIDEDIKEIATTLPNLPNDSVPVGKDE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+ +R      +     + H+EI E LG++DF+R  K+SG+RF    G  A LERAL 
Sbjct: 119 DDNVEVRRWADPKTFAFEPKPHWEIAEDLGILDFERGAKVSGSRFVYYKGLGARLERALY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLTN 238
            FM+D H  EHGYTE+  P +V  +AM+GTGQ PKF +D+F   D    LIPT+EV LTN
Sbjct: 179 NFMLDQHVYEHGYTEMITPYIVNSQAMFGTGQFPKFKEDVFQLADTDLTLIPTAEVPLTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  EI+E + LP  FT L+PSFRSEAGSAGRDTRG++R HQF K E+V  +  E S+ E
Sbjct: 239 YYQGEILEQEQLPAYFTALSPSFRSEAGSAGRDTRGLIRLHQFNKVEMVKFSDAEHSYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M + AE+IL++L+L YRV+SLCTGD+GFSA KTYDLEVW+  Q +YREISSCS C +
Sbjct: 299 LEKMTANAEDILQKLNLPYRVLSLCTGDMGFSAAKTYDLEVWIPAQEMYREISSCSNCED 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   RYRD   K + + HTLNGSG+AVGR + A+LENY N DGSVT+P VL PYM 
Sbjct: 359 FQARRAMIRYRDQEGK-IHYMHTLNGSGLAVGRTVAAVLENYQNEDGSVTVPEVLVPYMG 417

Query: 419 NLAVIKK 425
            L  I+K
Sbjct: 418 GLTKIEK 424


>gi|257866231|ref|ZP_05645884.1| seryl-tRNA synthetase [Enterococcus casseliflavus EC30]
 gi|257873255|ref|ZP_05652908.1| seryl-tRNA synthetase [Enterococcus casseliflavus EC10]
 gi|257800189|gb|EEV29217.1| seryl-tRNA synthetase [Enterococcus casseliflavus EC30]
 gi|257807419|gb|EEV36241.1| seryl-tRNA synthetase [Enterococcus casseliflavus EC10]
          Length = 425

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 202/427 (47%), Positives = 281/427 (65%), Gaps = 5/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IRQN   +   L  R ++ +  +  L+LDE+ R L+ + E+ +  RN  S +I 
Sbjct: 1   MLDVKMIRQNFAEVQSKLATRGVQKEVLDRFLTLDERRRELLVQTEERKKLRNDVSGEIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
            A+        D +  +   +  Q+  L++E  ++   +K++ + +PN+P + VP+G   
Sbjct: 61  -ALKRAKEDAADKIA-QMKEVGSQIKQLDEEIAQIDEDIKQIATTLPNLPNDSVPVGKDE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+ IR   +  +     + H+EI E LG++DF+R  K+SG+RF    G  A LERAL 
Sbjct: 119 DDNVEIRRWAEPKAFAFEPKPHWEIAEELGILDFERGAKVSGSRFVYYKGLGARLERALY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLTN 238
            FM+D H  EHGYTE+  P +V  +AM+GTGQ PKF +D+F   D    LIPT+EV LTN
Sbjct: 179 NFMLDQHVYEHGYTEMITPYIVNSQAMFGTGQFPKFKEDVFQLADTDLTLIPTAEVPLTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  EI+E + LP  FT L+PSFRSEAGSAGRDTRG++R HQF K E+V  +  + S+ E
Sbjct: 239 YYQGEILEQEQLPAYFTALSPSFRSEAGSAGRDTRGLIRLHQFNKVEMVKFSDADHSYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M + AE+IL++L+L YRV+SLCTGD+GFSA KTYDLEVW+  Q +YREISSCS C +
Sbjct: 299 LEKMTANAEDILQKLNLPYRVLSLCTGDMGFSAAKTYDLEVWIPAQEMYREISSCSNCED 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   RYRD   K + + HTLNGSG+AVGR + A+LENY N DGSVT+P VL PYM 
Sbjct: 359 FQARRAMIRYRDQEGK-IHYMHTLNGSGLAVGRTVAAVLENYQNEDGSVTVPEVLVPYMG 417

Query: 419 NLAVIKK 425
            L  I+K
Sbjct: 418 GLTKIEK 424


>gi|325204646|gb|ADZ00100.1| seryl-tRNA synthetase [Neisseria meningitidis M01-240355]
          Length = 431

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 204/428 (47%), Positives = 273/428 (63%), Gaps = 9/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L  R  +  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLAARGYDFDTARFDALEERRKSVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A   + + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMVQVAQIKTDLEQTAADLEAVQKELDAWLLSIPNLPHESVPAGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTLQHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYETLEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLA 421
           +PYM  +A
Sbjct: 419 QPYMGGVA 426


>gi|302383732|ref|YP_003819555.1| seryl-tRNA synthetase [Brevundimonas subvibrioides ATCC 15264]
 gi|302194360|gb|ADL01932.1| seryl-tRNA synthetase [Brevundimonas subvibrioides ATCC 15264]
          Length = 471

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 214/466 (45%), Positives = 282/466 (60%), Gaps = 47/466 (10%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEY---ILSLDEKNRILIKKIEDIRARRNSNSAQ 57
           M DI+ IR+ P+        R +E        ILSLD   R      +D  ARRN+ S  
Sbjct: 1   MHDIRAIRETPDTFVAGWSARGVEDAKALVAEILSLDTALRAAQTAGQDALARRNATSKL 60

Query: 58  IGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGT 117
           IG A+ + +++  D LK E   LK ++   E  E +  ++L+ L++   N+  ++VP G 
Sbjct: 61  IGAAMGKKDMAEADRLKAEVEGLKAEIAAAEAVEADKGTALRDLLAAQKNLAADDVPDGE 120

Query: 118 SANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
               N+ + SV  +P     +++H ++GEALGL+DF+ A ++SGARF+VL G LA LERA
Sbjct: 121 DEAGNVEV-SVWGEPRRTGPAKDHADLGEALGLLDFEAAARMSGARFAVLKGGLARLERA 179

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF----------------- 220
           +GQFM+DL T+EHGY EV+ P LV+D+AM+GTGQ+PKF +D+F                 
Sbjct: 180 IGQFMLDLQTTEHGYLEVNPPYLVKDDAMFGTGQLPKFWEDLFQMPLEQRAEIERTLKAA 239

Query: 221 ----CTTDG----------------------RWLIPTSEVSLTNLYSHEIIESKSLPLRF 254
                  DG                      RWLIPT+EVSLTNL   +I     LPLR 
Sbjct: 240 FAAGVHLDGFETLSDAEFQEMGKRMTYFEGRRWLIPTAEVSLTNLVREQITAEDELPLRL 299

Query: 255 TTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLD 314
           T L P FR+EAGSAGRDTRG++RQHQF K ELVSIT  E S  EHERM +CAE +L+RL 
Sbjct: 300 TALTPCFRAEAGSAGRDTRGLIRQHQFHKVELVSITTPEASDDEHERMTTCAETVLQRLG 359

Query: 315 LHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSK 374
           L YR + LC GD+GFSA KT+DLEVWL  Q  YREISS S CG+FQ+RRM++R++     
Sbjct: 360 LPYRRMLLCKGDMGFSARKTFDLEVWLPSQGAYREISSVSNCGDFQARRMDARFKRAGGG 419

Query: 375 SLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
             +F HTLNGSG+AVGR L+AI+ENY +  G +  P  L PYM  L
Sbjct: 420 KPEFVHTLNGSGLAVGRTLVAIMENYQDEGGRIAAPEALVPYMGGL 465


>gi|256618437|ref|ZP_05475283.1| seryl-tRNA synthetase [Enterococcus faecalis ATCC 4200]
 gi|256761947|ref|ZP_05502527.1| seryl-tRNA synthetase [Enterococcus faecalis T3]
 gi|257084092|ref|ZP_05578453.1| seryl-tRNA synthetase [Enterococcus faecalis Fly1]
 gi|257088576|ref|ZP_05582937.1| seryl-tRNA synthetase [Enterococcus faecalis CH188]
 gi|300862206|ref|ZP_07108286.1| serine--tRNA ligase [Enterococcus faecalis TUSoD Ef11]
 gi|307276339|ref|ZP_07557465.1| seryl-tRNA synthetase [Enterococcus faecalis TX2134]
 gi|312903849|ref|ZP_07763021.1| seryl-tRNA synthetase [Enterococcus faecalis TX0635]
 gi|256597964|gb|EEU17140.1| seryl-tRNA synthetase [Enterococcus faecalis ATCC 4200]
 gi|256683198|gb|EEU22893.1| seryl-tRNA synthetase [Enterococcus faecalis T3]
 gi|256992122|gb|EEU79424.1| seryl-tRNA synthetase [Enterococcus faecalis Fly1]
 gi|256997388|gb|EEU83908.1| seryl-tRNA synthetase [Enterococcus faecalis CH188]
 gi|295112414|emb|CBL31051.1| seryl-tRNA synthetase [Enterococcus sp. 7L76]
 gi|300848731|gb|EFK76488.1| serine--tRNA ligase [Enterococcus faecalis TUSoD Ef11]
 gi|306507004|gb|EFM76148.1| seryl-tRNA synthetase [Enterococcus faecalis TX2134]
 gi|310632793|gb|EFQ16076.1| seryl-tRNA synthetase [Enterococcus faecalis TX0635]
 gi|315143211|gb|EFT87227.1| seryl-tRNA synthetase [Enterococcus faecalis TX2141]
 gi|315160827|gb|EFU04844.1| seryl-tRNA synthetase [Enterococcus faecalis TX0645]
 gi|315171391|gb|EFU15408.1| seryl-tRNA synthetase [Enterococcus faecalis TX1342]
 gi|315577010|gb|EFU89201.1| seryl-tRNA synthetase [Enterococcus faecalis TX0630]
          Length = 423

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 206/428 (48%), Positives = 283/428 (66%), Gaps = 11/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEY-ILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IRQN E +   LK R ++ +     L+LDE+ R L+ K+E+++  RN  S +I 
Sbjct: 1   MLDMKKIRQNVEVVQKKLKTRGVDEEVLLRFLALDEERRALLVKVEELKKHRNQVSGEIA 60

Query: 60  Q---AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIG 116
           Q   A  + +  L++        + EQ+ +L++E   +      +   +PN+P E VP+G
Sbjct: 61  QLKRAQKDASQQLLN-----MQEVSEQIKVLDQEVVHLQEQCTAIAERLPNLPHESVPVG 115

Query: 117 TSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLER 176
                N+ +R      +     + H+EIGEALG++DF+R  K+SG+RF    G  A LER
Sbjct: 116 ADEAANVEVRRWSTPKTFSFEPKPHWEIGEALGILDFERGAKVSGSRFLYYKGLGARLER 175

Query: 177 ALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVS 235
           A+  FM+D H +EHGYTEV  P LV  +AM+GTGQ PKF +D+F   +    LIPT+EV 
Sbjct: 176 AVYNFMLDQHVNEHGYTEVIPPYLVNSKAMFGTGQFPKFKEDVFQVAESDLTLIPTAEVP 235

Query: 236 LTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDS 295
           LTN Y++EI+E++ LP+ FT L+PSFRSEAGSAGRDTRG++R HQF K E+V  +  E S
Sbjct: 236 LTNYYNNEILEAQELPIYFTALSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFSDAEHS 295

Query: 296 FTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCST 355
           + E E+M + A +IL++L L YRV++L TGD+GFSA KTYDLEVW+  Q  YREISSCS 
Sbjct: 296 YEELEKMTNNAGDILEKLGLPYRVITLSTGDMGFSAAKTYDLEVWIPAQKTYREISSCSN 355

Query: 356 CGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
           C +FQ+RR   RYRD  +  +++ HTLNGSG+AVGR + AILENY N DG+VTIP VLRP
Sbjct: 356 CEDFQARRALIRYRD-KTGHVQYAHTLNGSGLAVGRTVAAILENYQNEDGTVTIPEVLRP 414

Query: 416 YMNNLAVI 423
           YM  L  I
Sbjct: 415 YMGGLTKI 422


>gi|146296476|ref|YP_001180247.1| seryl-tRNA synthetase [Caldicellulosiruptor saccharolyticus DSM
           8903]
 gi|166201242|sp|A4XJH1|SYS_CALS8 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|145410052|gb|ABP67056.1| seryl-tRNA synthetase [Caldicellulosiruptor saccharolyticus DSM
           8903]
          Length = 420

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 200/417 (47%), Positives = 279/417 (66%), Gaps = 3/417 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD+++IR NPE +   L KR+ +     IL LDEK R L+ ++E ++A +N  S +I +
Sbjct: 1   MLDLKFIRSNPEKVQEGLNKRNKDISIAPILELDEKRRKLLAEVEKMKAIQNQKSKEIPK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG  +    L NE   L +++  L+ +  EV   ++K++  IPN+P E VPIG    
Sbjct: 61  LKKEGKDTT--ELMNELKELSDKIKELDSQVKEVEDEIEKILLTIPNIPHESVPIGKDDT 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G+        + H+EIGE LG++DF+RA+K+SG+RF+   G  A LERAL  
Sbjct: 119 ENVEVRRWGEPRVPDFEIKPHWEIGEKLGILDFERASKVSGSRFTFYRGLGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLH  +HGY E+  P LV  ++M GTGQ+PKF +D F TTD  +LIPT+EV +TN +
Sbjct: 179 FMLDLHIEKHGYVELFPPFLVARKSMIGTGQLPKFEEDAFKTTDDYFLIPTAEVPVTNYH 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ + LP+++   +  FR+EAG+AG+DTRG++RQHQF K ELV   + EDS+ E E
Sbjct: 239 REEILKEEDLPIKYVAYSACFRAEAGAAGKDTRGLIRQHQFNKVELVKFAKPEDSYDELE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           ++ + AE++LK L L YRVV LC+GDLGFS+ KTYD+EVW+     Y EISSCS   +FQ
Sbjct: 299 KLTADAEDVLKHLGLPYRVVLLCSGDLGFSSAKTYDIEVWMPSYGRYVEISSCSNFESFQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +RR N R+R  + K L F HTLNGSG+AVGR + AILEN+   DGSV +P VLR YM
Sbjct: 359 ARRANIRFRRKDGK-LDFVHTLNGSGLAVGRTVAAILENFQQKDGSVVVPEVLRKYM 414


>gi|254428921|ref|ZP_05042628.1| seryl-tRNA synthetase [Alcanivorax sp. DG881]
 gi|196195090|gb|EDX90049.1| seryl-tRNA synthetase [Alcanivorax sp. DG881]
          Length = 429

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 207/434 (47%), Positives = 284/434 (65%), Gaps = 15/434 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+ +RQ+ E +  AL KR      +   +LD K +    + ++++A R   S Q+G+
Sbjct: 1   MLDIRALRQDGEAIKTALTKRGYTLDLDAFAALDAKRKQADIRSQELQADRKKASKQVGE 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKE-EHEVCSS------LKKLISCIPNVPLEEV 113
            I  G      A+++  S + E L  ++ E + EV S+      +++ +  IPNVP + V
Sbjct: 61  LIKSGM-----AVEDAKSQVAETLQTIDAELDREVASAKAIQEEIREFLMGIPNVPQDAV 115

Query: 114 PIGTSANENILIRSVGKKPSAIHLSREHFEIGEAL-GLMDFDRATKLSGARFSVLTGHLA 172
           P G   ++N+ +R  G   +     R+H ++GEAL G +DF+RA KLSGARFSV++G LA
Sbjct: 116 PAGNDEDDNVEVRQWGTPKTLPFEPRDHVDVGEALDGGLDFERAAKLSGARFSVMSGGLA 175

Query: 173 HLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGR--WLIP 230
            + RAL  FM+D+H+ EHGY EV  P LV  EA+ GTGQ+PKFA+D+F     R  +LIP
Sbjct: 176 RMHRALIDFMLDMHSDEHGYQEVYVPFLVGPEALRGTGQLPKFAEDLFKMEGERELYLIP 235

Query: 231 TSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT 290
           T+EV +TNL + EI+E+ ++P R+T   P FRSEAGS G+DTRGM+RQHQF K ELV + 
Sbjct: 236 TAEVPVTNLAADEILEADTMPRRYTCHTPCFRSEAGSHGKDTRGMIRQHQFEKVELVQMV 295

Query: 291 REEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREI 350
           R E+S    E +   AE +L++LDL YRVV LC GDLGFS+ KTYD+EVWL  Q  YREI
Sbjct: 296 RAEESDAALEALTGHAEAVLQKLDLPYRVVILCGGDLGFSSSKTYDIEVWLPSQQRYREI 355

Query: 351 SSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIP 410
           SSCS   ++QSRRM +R+R+P +   +  HTLNGS +AVGR L+AILENY N DGSVT+P
Sbjct: 356 SSCSNFQDYQSRRMQARWRNPETGKPELVHTLNGSALAVGRTLVAILENYQNEDGSVTVP 415

Query: 411 TVLRPYMNNLAVIK 424
             LR YM  L  +K
Sbjct: 416 EALRSYMRGLERLK 429


>gi|315640401|ref|ZP_07895513.1| serine--tRNA ligase [Enterococcus italicus DSM 15952]
 gi|315483839|gb|EFU74323.1| serine--tRNA ligase [Enterococcus italicus DSM 15952]
          Length = 426

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 209/430 (48%), Positives = 277/430 (64%), Gaps = 9/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHL-EPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IRQN E +   L  R + E +    + LDE+ R L+ + E+++  RN  SA+I 
Sbjct: 1   MLDIKVIRQNIEQVKEKLATRGVAEDKINEFVGLDEERRRLLVETEELKKHRNDVSAEIA 60

Query: 60  Q--AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGT 117
           Q     E     ++ +K     +KE    L+     +   L ++   +PN+P + VPIG 
Sbjct: 61  QLKRTKEDATEKIEEMKQVGQKIKE----LDGTLATIDEKLTQIAVTLPNIPDDSVPIGA 116

Query: 118 SANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
              +N+ +R   K        + H+E+ E LG++DF+R  K+SG+RF    G  A LERA
Sbjct: 117 DEEDNVEVRRWHKTREFDFEPKPHWEVAEDLGILDFERGAKVSGSRFVYYKGLGARLERA 176

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSL 236
           L  FM+DLH  E GYTE+  P +V  +AM+GTGQ PKF +D+F   +    LIPT+EV L
Sbjct: 177 LYNFMLDLHVYEQGYTEMITPYIVNSQAMFGTGQFPKFKEDVFQLENTDLTLIPTAEVPL 236

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN YS EI++ K LP+ FT L+PSFRSEAGSAGRDTRG++R HQF K E+V  +  + S+
Sbjct: 237 TNFYSQEILDEKDLPIYFTALSPSFRSEAGSAGRDTRGLIRLHQFNKVEMVKFSDADHSY 296

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            E E+M   AEEIL++L+L YRVV+L TGD+GFSA KTYDLEVW+  QN YREISSCS  
Sbjct: 297 EELEKMTQNAEEILQKLELPYRVVALSTGDMGFSAAKTYDLEVWIPAQNTYREISSCSNT 356

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
            +FQ+RR   RYRD N K +++ HTLNGSG+AVGR + A+LENY NADGSVTIP VL  Y
Sbjct: 357 EDFQARRAMIRYRDSNGK-IRYVHTLNGSGLAVGRTVAAVLENYQNADGSVTIPDVLVKY 415

Query: 417 MNNLAVIKKE 426
           M  L  I KE
Sbjct: 416 MGGLTKITKE 425


>gi|325686987|gb|EGD29011.1| serine--tRNA ligase [Streptococcus sanguinis SK72]
          Length = 425

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 204/430 (47%), Positives = 283/430 (65%), Gaps = 15/430 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IR + + +   L  R ++  +   + S+D++ R L+ K+E+++A RN+ SA+I 
Sbjct: 1   MLDLKRIRTDFDSVAKKLATRGVDAATLNQMKSIDKERRDLLVKVEELKAERNTVSAEIA 60

Query: 60  QAI-----AEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVP 114
           QA      A+  ++ +  L  E  TL   L  L+       + L +  + +PN+P + VP
Sbjct: 61  QAKRNKENADDKITAMQKLSAEVKTLDATLADLD-------AKLTEFTTTLPNIPHDSVP 113

Query: 115 IGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           +G   +EN+ +R  G        ++ H+++GE L ++D++R  K++GARF    G  A L
Sbjct: 114 VGADEDENVEVRRWGTPRQFDFEAKAHWDLGEDLDILDWERGAKVTGARFLFYKGLGARL 173

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSE 233
           ERA+  FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+E
Sbjct: 174 ERAIYNFMLDEHGKE-GYTEVITPYMVNHDSMFGTGQYPKFKEDTFELSDTNFVLIPTAE 232

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V LTN Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E
Sbjct: 233 VPLTNYYRDEILDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPE 292

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
           +S+ E E+M + AE IL++L+L YRVV+LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 293 ESYEELEKMTANAENILQKLNLPYRVVALCTGDMGFSAAKTYDLEVWIPAQNTYREISSC 352

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP VL
Sbjct: 353 SNTEDFQARRAQIRYRDETDGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVL 412

Query: 414 RPYMNNLAVI 423
           RPYM  L VI
Sbjct: 413 RPYMGGLEVI 422


>gi|222528873|ref|YP_002572755.1| seryl-tRNA synthetase [Caldicellulosiruptor bescii DSM 6725]
 gi|254783001|sp|B9MQM8|SYS_ANATD RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|222455720|gb|ACM59982.1| seryl-tRNA synthetase [Caldicellulosiruptor bescii DSM 6725]
          Length = 420

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 198/417 (47%), Positives = 280/417 (67%), Gaps = 3/417 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD+++IR NPE +   L KR+ +     IL LDE+ R L+ ++E ++A +N  S ++ +
Sbjct: 1   MLDLKYIRANPEKVQEGLSKRNKDVSIAPILELDERRRKLLAEVESLKALQNQKSKEVPK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG    V  L NE   L +++  L+ +  EV   ++K++  IPN+P E VP+G    
Sbjct: 61  LKKEGKD--VTDLMNELKDLSDKIKELDSKVKEVEDEIEKILLTIPNIPHESVPVGKDDT 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G+        + H+EIG  LG++DF+RA+K+SG+RF+   G  A LERAL  
Sbjct: 119 ENVEVRRWGEVREPDFEIKPHWEIGVNLGILDFERASKVSGSRFTFYRGLGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLH  +HGYTE+  P LV  ++M GTGQ+PKF +D F TTD  +LIPT+EV +TN +
Sbjct: 179 FMLDLHIEKHGYTELFPPFLVARKSMIGTGQLPKFEEDAFKTTDDYFLIPTAEVPVTNYH 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ + LP+++   +  FR+EAG+AG+DTRG++RQHQF K ELV  T+ EDS+ E E
Sbjct: 239 REEILKEEDLPIKYVAYSACFRAEAGAAGKDTRGLIRQHQFNKVELVKFTKPEDSYDELE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           ++ + AE++LK L L YRVV LC+GDLGFS+ KTYD+EVW+     Y EISSCS   N+Q
Sbjct: 299 KLTADAEDVLKELGLPYRVVLLCSGDLGFSSAKTYDIEVWMPSYGRYVEISSCSNFENYQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +RR N R+R  + K L + HTLNGSG+AVGR L AILEN+   DG+V +P VLR YM
Sbjct: 359 ARRANIRFRRKDGK-LDYVHTLNGSGLAVGRTLAAILENFQQKDGTVVVPEVLRKYM 414


>gi|324994145|gb|EGC26059.1| serine--tRNA ligase [Streptococcus sanguinis SK678]
          Length = 425

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 204/430 (47%), Positives = 283/430 (65%), Gaps = 15/430 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IR + + +   L  R ++  +   + ++D++ R L+ K+E+++A RN+ SA+I 
Sbjct: 1   MLDLKRIRTDFDSVAEKLATRGVDAATLNQMKTIDKERRDLLVKVEELKAERNTVSAEIA 60

Query: 60  QAI-----AEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVP 114
           QA      A+  ++ +  L  E  TL   L        E+ + L +  + +PN+P E VP
Sbjct: 61  QAKRNKENADDKIAAMQKLSAEVKTLDATLA-------ELDAKLTEFTTTLPNIPHESVP 113

Query: 115 IGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           +G   +EN+ +R  G        ++ H+++GE L ++D++R  K++GARF    G  A L
Sbjct: 114 VGADEDENVEVRRWGTPRQFDFEAKAHWDLGEELDILDWERGAKVTGARFLFYKGLGARL 173

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSE 233
           ERA+  FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+E
Sbjct: 174 ERAIYNFMLDEHGKE-GYTEVITPYMVNHDSMFGTGQYPKFKEDTFELSDTNFVLIPTAE 232

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V LTN Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E
Sbjct: 233 VPLTNYYRDEILDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPE 292

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
           +S+ E E+M + AE IL++L+L YRVV+LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 293 ESYEELEKMTANAENILQKLNLPYRVVALCTGDMGFSAAKTYDLEVWIPAQNTYREISSC 352

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP VL
Sbjct: 353 SNTEDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVL 412

Query: 414 RPYMNNLAVI 423
           RPYM  L VI
Sbjct: 413 RPYMGGLEVI 422


>gi|322377063|ref|ZP_08051555.1| serine--tRNA ligase [Streptococcus sp. M334]
 gi|321281776|gb|EFX58784.1| serine--tRNA ligase [Streptococcus sp. M334]
          Length = 424

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/426 (47%), Positives = 279/426 (65%), Gaps = 5/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IR + + +   L  R ++      +  +D K R ++ K+E ++A RN+ SA+I 
Sbjct: 1   MLDIKRIRTDFDAVAEKLATRGVDAAVLNEMKEIDAKRRDILVKVETLKAERNTVSAEIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA  + N    D    +   L  ++  L+ E  ++ + L +  + +PN+P + VP+G   
Sbjct: 61  QA--KRNKENADDKITDMQNLSSEVKALDAELADIDAKLTEFTTTLPNIPADSVPVGADE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+ +R  G         + H+++GE LG++D++R  K++GARF    G  A LERAL 
Sbjct: 119 DDNVEVRRWGTPREFDFEPKAHWDLGEDLGILDWERGGKVTGARFLFYKGLGARLERALY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLTN 238
            FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+EV LTN
Sbjct: 179 NFMLDEHGKE-GYTEVITPYMVNHDSMFGTGQYPKFKEDTFELSDSNYVLIPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E+S+ E
Sbjct: 238 YYRDEILDGKDLPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESYEE 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M + AE IL++L+L YRVV+L TGD+GFSA KTYDLEVW+  QN YREISSCS   +
Sbjct: 298 LEKMTANAENILQKLNLPYRVVALSTGDMGFSAAKTYDLEVWIPAQNTYREISSCSNTED 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY NADGSVTIP VLRPYM 
Sbjct: 358 FQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNADGSVTIPEVLRPYMG 417

Query: 419 NLAVIK 424
              VIK
Sbjct: 418 GAEVIK 423


>gi|213970055|ref|ZP_03398187.1| seryl-tRNA synthetase [Pseudomonas syringae pv. tomato T1]
 gi|301381411|ref|ZP_07229829.1| seryl-tRNA synthetase [Pseudomonas syringae pv. tomato Max13]
 gi|302058409|ref|ZP_07249950.1| seryl-tRNA synthetase [Pseudomonas syringae pv. tomato K40]
 gi|302130342|ref|ZP_07256332.1| seryl-tRNA synthetase [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|213925159|gb|EEB58722.1| seryl-tRNA synthetase [Pseudomonas syringae pv. tomato T1]
          Length = 426

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 204/433 (47%), Positives = 281/433 (64%), Gaps = 18/433 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R        I SL+ + +++  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRTQLQDVADRLASRGFTLDVARIESLEAQRKVVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A   G      ++ V+ + NE S  K +L  ++ E       L  L+  IPN+P E VP+
Sbjct: 61  AKQRGEDIAPLMADVERMGNELSEGKVELDAIQAE-------LDALVLSIPNLPHESVPV 113

Query: 116 GTSANENILIRSVGKKPSAIHLS-REHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           G     N+ +R  G  P+A     ++H  +GE  G +DF+ A KLSGARF++L G +A L
Sbjct: 114 GADEEGNVEVRRWGT-PTAFDFEVKDHVALGEKFGWLDFETAAKLSGARFALLRGPIARL 172

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIP 230
            RAL QFMI+LH +EHGY E   P LV+  A+ GTGQ+PKF +D+F  + +G    +LIP
Sbjct: 173 HRALAQFMINLHINEHGYEETYTPYLVQAPALQGTGQLPKFEEDLFKISREGEADLYLIP 232

Query: 231 TSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT 290
           T+EVSLTN+ S EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I 
Sbjct: 233 TAEVSLTNIVSGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIV 292

Query: 291 REEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREI 350
             +DS    E +   AE +L+ L+L YR ++LCTGD+GFSA KTYDLEVW+  Q+ YREI
Sbjct: 293 APDDSMAALESLTGNAERVLQLLELPYRTLALCTGDMGFSAVKTYDLEVWIPSQDKYREI 352

Query: 351 SSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIP 410
           SSCS CG+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P
Sbjct: 353 SSCSNCGDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVP 412

Query: 411 TVLRPYMNNLAVI 423
            VL+PYM  L VI
Sbjct: 413 EVLKPYMGGLEVI 425


>gi|257875866|ref|ZP_05655519.1| seryl-tRNA synthetase [Enterococcus casseliflavus EC20]
 gi|257810032|gb|EEV38852.1| seryl-tRNA synthetase [Enterococcus casseliflavus EC20]
          Length = 425

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 202/427 (47%), Positives = 282/427 (66%), Gaps = 5/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IRQN   +   L  R ++ +  +  L+LDE+ R L+ + E+ +  RN  S++I 
Sbjct: 1   MLDVKMIRQNFAEVQSKLATRGVQKEVLDRFLTLDERRRELLVQTEERKKLRNDVSSEIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
            A+        D +  +   +  Q+  L++E  ++   +K++ + +PN+P + VP+G   
Sbjct: 61  -ALKRAKEDAADKIA-QMKEVGSQIKQLDEEIAQIDEDIKEIATTLPNLPNDSVPVGKDE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+ IR   +  +     + H+EI E LG++DF+R  K+SG+RF    G  A LERAL 
Sbjct: 119 DDNVEIRRWAEPKTFDFEPKPHWEIAEDLGILDFERGAKVSGSRFVYYKGLGARLERALY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLTN 238
            FM+D H  EHGYTE+  P +V  +AM+GTGQ PKF +D+F   D    LIPT+EV LTN
Sbjct: 179 NFMLDQHVYEHGYTEMITPYIVNSQAMFGTGQFPKFKEDVFQLADTDLTLIPTAEVPLTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  EI+E + LP  FT L+PSFRSEAGSAGRDTRG++R HQF K E+V  +  + S+ E
Sbjct: 239 YYQGEILEQEQLPAYFTALSPSFRSEAGSAGRDTRGLIRLHQFNKVEMVKFSDADHSYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M + AE+IL++L+L YRV+SLCTGD+GFSA KTYDLEVW+  Q +YREISSCS C +
Sbjct: 299 LEKMTANAEDILQKLNLPYRVLSLCTGDMGFSAAKTYDLEVWIPAQEMYREISSCSNCED 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   RYRD   K + + HTLNGSG+AVGR + A+LENY N DGSVT+P VL PYM 
Sbjct: 359 FQARRAMIRYRDQEGK-IHYMHTLNGSGLAVGRTVAAVLENYQNEDGSVTVPEVLVPYMG 417

Query: 419 NLAVIKK 425
            L  I+K
Sbjct: 418 GLTKIEK 424


>gi|148270533|ref|YP_001244993.1| seryl-tRNA synthetase [Thermotoga petrophila RKU-1]
 gi|281412841|ref|YP_003346920.1| seryl-tRNA synthetase [Thermotoga naphthophila RKU-10]
 gi|166223306|sp|A5IMJ4|SYS_THEP1 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|147736077|gb|ABQ47417.1| seryl-tRNA synthetase [Thermotoga petrophila RKU-1]
 gi|281373944|gb|ADA67506.1| seryl-tRNA synthetase [Thermotoga naphthophila RKU-10]
          Length = 425

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 208/418 (49%), Positives = 282/418 (67%), Gaps = 2/418 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           M+DI+ IRQNP+ +  AL+KR  +P + + IL +D   R  I K  ++R+RRN  S  + 
Sbjct: 1   MIDIKLIRQNPDLVKEALRKRGEDPATIDEILKIDADWRTTITKTNELRSRRNEISKNVA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           +   EG  +  +AL  E   L E++  LE++E E+   L  L+  +PN+P E VP+G   
Sbjct: 61  RLKKEGKNTEAEALIEEGKRLGEEIKALEEKEKELQKQLNDLLLMVPNIPHESVPVGEDE 120

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+ +R  G+          H+++G A GLMDFDRATKLSG+RF+V+ G LA LERAL 
Sbjct: 121 SQNVEVRRWGEPREFDFTPLAHWDLGPAWGLMDFDRATKLSGSRFTVMYGKLARLERALI 180

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT-DGRWLIPTSEVSLTN 238
            FM+D+HT EHGYTEV  P LV+ E +  TGQ+PKF ++++    D  +LIPT+EV L  
Sbjct: 181 NFMLDVHTKEHGYTEVWVPHLVKRETITITGQLPKFEEELYLAERDDLFLIPTAEVPLAA 240

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L+S EI+E K LP ++    P +R EAGS G+D RGM+RQHQF K ELV +T  E SF +
Sbjct: 241 LHSGEILEEKELPKKYVAYTPCYRREAGSYGKDVRGMIRQHQFDKVELVWVTTPERSFED 300

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+++  AE IL++L+L YRVVSLCTGDLGF++ KTYD+EVWL   N Y+EISSCS   +
Sbjct: 301 LEQLVKDAETILQKLELPYRVVSLCTGDLGFTSAKTYDIEVWLPSYNAYKEISSCSNVTD 360

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           FQ+RR N RYR  +   L++ HTLNGSG+AVGR L+AILENY   DGSV +P VL PY
Sbjct: 361 FQARRGNMRYRRRSDGKLEYVHTLNGSGIAVGRALVAILENYQQPDGSVRVPEVLVPY 418


>gi|261856154|ref|YP_003263437.1| seryl-tRNA synthetase [Halothiobacillus neapolitanus c2]
 gi|261836623|gb|ACX96390.1| seryl-tRNA synthetase [Halothiobacillus neapolitanus c2]
          Length = 431

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/425 (47%), Positives = 274/425 (64%), Gaps = 6/425 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R +PE +   L +R          +L+ + + +    E ++A RNS S  IG+
Sbjct: 1   MLDPKLVRTDPEAVAAQLARRGFTFDVARFAALENERKQVQVDTEQMQAERNSRSKLIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
             A G    + +L  E   L ++L   ++   E+ S L  L S +PN+P E+VP G    
Sbjct: 61  MKAAGED--ISSLMAEIGGLGQKLDQAKQRLGEIQSELDALFSLVPNLPAEDVPFGEDEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            NI +R  G   +     ++H  +G ALG M+F++A KL+G+RF  L G LA L RAL Q
Sbjct: 119 GNIEVRRWGTPKTFDFNVQDHVALGAALG-MNFEQAVKLTGSRFVTLAGDLARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-TTDGRW-LIPTSEVSLTN 238
           FM+DLH+++HGYTE+  P +V D++++GTGQ+PKF +D+F    D  W LIPT+EV LTN
Sbjct: 178 FMLDLHSNQHGYTEMYVPYIVNDKSLFGTGQLPKFGEDLFALNGDADWYLIPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L   E++ +  LP R+    PSFR+EAG+AGRDTRGM+RQHQF K ELV I R EDS   
Sbjct: 238 LVRDELLSANDLPRRYVAHTPSFRAEAGAAGRDTRGMIRQHQFDKVELVQIVRAEDSAAA 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E + S AE +L+ L+L YRV+ LCTGD+GFSA KTYDLEVWL GQN YREISSCS C +
Sbjct: 298 LEALTSHAEAVLQALELPYRVMQLCTGDMGFSAAKTYDLEVWLPGQNTYREISSCSNCTD 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR+ +R RD  SK  +  HTLNGSG+AVGR L+A+LEN+  ADGS+ +P  LRPY  
Sbjct: 358 FQARRLQARVRDAESKP-QLVHTLNGSGLAVGRTLVALLENHQQADGSIALPLALRPYFQ 416

Query: 419 NLAVI 423
               I
Sbjct: 417 GRTAI 421


>gi|262041004|ref|ZP_06014225.1| serine-tRNA ligase [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|259041639|gb|EEW42689.1| serine-tRNA ligase [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
          Length = 430

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 202/431 (46%), Positives = 272/431 (63%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRTEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVQTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L EQL   + E   + + ++ +   IPN+P ++VP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEQLDAAKSELETLLAEIRDIALAIPNIPHDDVPVGRDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE  G +DF  A KL+G+RF V+ G LA L RAL Q
Sbjct: 119 DNVEVSRWGTPRQFDFEVRDHVTLGEMHGGLDFAAAVKLTGSRFVVMKGQLARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLH  +HGY+E   P LV  + +YGTGQ+PKFA D+F T        +    LIPT+
Sbjct: 179 FMLDLHIEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR V+LCTGD+GFSACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKVALCTGDMGFSACKTYDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + IP V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVALMENYQQADGRIEIPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMRGLEYI 429


>gi|331017250|gb|EGH97306.1| seryl-tRNA synthetase [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 426

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 204/433 (47%), Positives = 281/433 (64%), Gaps = 18/433 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R        I SL+ + +++  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRTQLQDVADRLASRGFTLDVARIESLEAQRKVVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A   G      ++ V+ + NE S  K +L  ++ E       L  L+  IPN+P E VP+
Sbjct: 61  AKQRGEDIAPLMADVERMGNELSEGKVELDAIQAE-------LDALVLSIPNLPHESVPV 113

Query: 116 GTSANENILIRSVGKKPSAIHLS-REHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           G     N+ +R  G  P+A     ++H  +GE  G +DF+ A KLSGARF++L G +A L
Sbjct: 114 GADEEGNVEVRRWGT-PTAFGFEVKDHVALGEKFGWLDFETAAKLSGARFALLRGPIARL 172

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIP 230
            RAL QFMI+LH +EHGY E   P LV+  A+ GTGQ+PKF +D+F  + +G    +LIP
Sbjct: 173 HRALAQFMINLHINEHGYEETYTPYLVQAPALQGTGQLPKFEEDLFKISREGEADLYLIP 232

Query: 231 TSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT 290
           T+EVSLTN+ S EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I 
Sbjct: 233 TAEVSLTNIVSGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIV 292

Query: 291 REEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREI 350
             +DS    E +   AE +L+ L+L YR ++LCTGD+GFSA KTYDLEVW+  Q+ YREI
Sbjct: 293 APDDSMAALESLTGNAERVLQLLELPYRTLALCTGDMGFSAVKTYDLEVWIPSQDKYREI 352

Query: 351 SSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIP 410
           SSCS CG+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P
Sbjct: 353 SSCSNCGDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVP 412

Query: 411 TVLRPYMNNLAVI 423
            VL+PYM  L VI
Sbjct: 413 EVLKPYMGGLEVI 425


>gi|293398677|ref|ZP_06642855.1| seryl-tRNA synthetase [Neisseria gonorrhoeae F62]
 gi|291611148|gb|EFF40245.1| seryl-tRNA synthetase [Neisseria gonorrhoeae F62]
          Length = 431

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/427 (47%), Positives = 274/427 (64%), Gaps = 9/427 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L +R  +  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLARRGYDFDTARFDALEERRKSVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPPGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTLQHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVAGSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYGALEEMVGHAENILKALELPYRVITLCTGDMGFSAAKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+ RM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQAHRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNL 420
           +PYM  +
Sbjct: 419 QPYMGGV 425


>gi|59801685|ref|YP_208397.1| seryl-tRNA synthetase [Neisseria gonorrhoeae FA 1090]
 gi|240014583|ref|ZP_04721496.1| seryl-tRNA synthetase [Neisseria gonorrhoeae DGI18]
 gi|240121105|ref|ZP_04734067.1| seryl-tRNA synthetase [Neisseria gonorrhoeae PID24-1]
 gi|240123934|ref|ZP_04736890.1| seryl-tRNA synthetase [Neisseria gonorrhoeae PID332]
 gi|254494125|ref|ZP_05107296.1| seryl-tRNA synthetase [Neisseria gonorrhoeae 1291]
 gi|268682559|ref|ZP_06149421.1| seryl-tRNA synthetase [Neisseria gonorrhoeae PID332]
 gi|67461600|sp|Q5F752|SYS_NEIG1 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|59718580|gb|AAW89985.1| putative seryl-tRNA synthetase [Neisseria gonorrhoeae FA 1090]
 gi|226513165|gb|EEH62510.1| seryl-tRNA synthetase [Neisseria gonorrhoeae 1291]
 gi|268622843|gb|EEZ55243.1| seryl-tRNA synthetase [Neisseria gonorrhoeae PID332]
          Length = 431

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/427 (47%), Positives = 274/427 (64%), Gaps = 9/427 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L +R  +  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLARRGYDFDTARFDALEERRKSVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPPGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D H  +HGYTE   P +V D  + GTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHMLQHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVAGSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYGALEEMVGHAENILKALELPYRVITLCTGDMGFSAAKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNL 420
           +PYM  +
Sbjct: 419 QPYMGGV 425


>gi|325921976|ref|ZP_08183781.1| seryl-tRNA synthetase [Xanthomonas gardneri ATCC 19865]
 gi|325547526|gb|EGD18575.1| seryl-tRNA synthetase [Xanthomonas gardneri ATCC 19865]
          Length = 449

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 213/452 (47%), Positives = 285/452 (63%), Gaps = 33/452 (7%)

Query: 1   MLDIQWIRQNPEHLDIALKK-RHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD   +RQ+P  L   L+  R     +  + SL+ + + +  + +++++ RNS S  IG
Sbjct: 1   MLDPALLRQHPADLAERLRSTRSFALDTAKLESLESERKRMQVRTQELQSLRNSKSKAIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEH--EVCSSLKKLISCIPNVPLEEVPIGT 117
           QA A+G    V AL  E +   ++L  L+ + H  ++   L+KL + IPN+P  +VP+G 
Sbjct: 61  QAKAKGED--VTALMAEVAGFADEL--LQSQVHLKDIQVKLEKLYAVIPNLPHADVPLGK 116

Query: 118 SANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
           S  +N+     GK        ++H E+G   G +D + A KLSGARF+VL G +A L RA
Sbjct: 117 SEADNVEQSRWGKPRQFDFAVKDHVELGAPNGWLDGETAAKLSGARFTVLRGPIARLHRA 176

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF--------CTTD----- 224
           L QFM+DLH  EHGY E + PLLV  E+M+GTGQ+PKF DD+F          TD     
Sbjct: 177 LAQFMLDLHVGEHGYEETNVPLLVNAESMHGTGQLPKFEDDLFRIYEDEYDSQTDEETGE 236

Query: 225 -------------GRWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRD 271
                          +LIPTSEV LTN+   EI++++ LPLR T  +  FR+EAGS GRD
Sbjct: 237 VAHWRTGQIDPEPAYYLIPTSEVPLTNIVRDEIVDAERLPLRMTAHSMCFRAEAGSGGRD 296

Query: 272 TRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSA 331
           TRGM+RQHQF K ELV+    EDS  EH+RM  CAE +L++L L YR V LCTGD+GF+A
Sbjct: 297 TRGMIRQHQFEKVELVTACAPEDSDAEHQRMTRCAEVVLEKLGLPYRKVLLCTGDMGFAA 356

Query: 332 CKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGR 391
            KTYDLEVWL  Q+ YREISSCS CG+FQ+RRM +R+R+P S   +  HTLNGSG AVGR
Sbjct: 357 IKTYDLEVWLPSQDTYREISSCSNCGDFQARRMQARWRNPTSGKPELMHTLNGSGTAVGR 416

Query: 392 CLIAILENYLNADGSVTIPTVLRPYMNNLAVI 423
            +IA++ENY NADGS+ +P VLRPYM  +  I
Sbjct: 417 AMIAVMENYQNADGSIDVPEVLRPYMGGIERI 448


>gi|306825809|ref|ZP_07459148.1| serine--tRNA ligase [Streptococcus sp. oral taxon 071 str. 73H25AP]
 gi|304432170|gb|EFM35147.1| serine--tRNA ligase [Streptococcus sp. oral taxon 071 str. 73H25AP]
          Length = 424

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 204/426 (47%), Positives = 277/426 (65%), Gaps = 5/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IR + + +   L  R ++      +  +D K R ++ K+E  +A RN+ SA+I 
Sbjct: 1   MLDIKRIRTDFDAVAEKLATRGVDAAILNEMKEIDAKRRDILVKVETFKAERNTVSAEIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA  + N    D       TL  ++  L+ E  E+ + L +  + +PN+P + VP+G   
Sbjct: 61  QA--KRNKENADDKIAAMQTLSAEVKALDAELAEIDAKLTEFTTTLPNIPADSVPVGADE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+ +R  G         + H+++GE LG++D++R  K++GARF    G  A LERA+ 
Sbjct: 119 DDNVEVRRWGTPREFDFEPKAHWDLGEDLGILDWERGAKVTGARFLFYKGLGARLERAIY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLTN 238
            FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F   D  + LIPT+EV LTN
Sbjct: 179 NFMLDEHGKE-GYTEVITPYMVNHDSMFGTGQYPKFKEDTFELKDTNYVLIPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E+S+ E
Sbjct: 238 YYRDEILDGKDLPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESYEE 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M + AE IL++L+L YRVV+L TGD+GFSA KTYDLEVW+  QN YREISSCS   +
Sbjct: 298 LEKMTANAENILQKLNLPYRVVALSTGDMGFSAAKTYDLEVWIPAQNTYREISSCSNTED 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY NADGSVTIP VLRPYM 
Sbjct: 358 FQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNADGSVTIPEVLRPYMG 417

Query: 419 NLAVIK 424
              VIK
Sbjct: 418 GAEVIK 423


>gi|229547035|ref|ZP_04435760.1| seryl-tRNA synthetase [Enterococcus faecalis TX1322]
 gi|256855074|ref|ZP_05560435.1| seryl-tRNA synthetase [Enterococcus faecalis T8]
 gi|307291565|ref|ZP_07571441.1| seryl-tRNA synthetase [Enterococcus faecalis TX0411]
 gi|229307963|gb|EEN73950.1| seryl-tRNA synthetase [Enterococcus faecalis TX1322]
 gi|256709587|gb|EEU24634.1| seryl-tRNA synthetase [Enterococcus faecalis T8]
 gi|306497326|gb|EFM66867.1| seryl-tRNA synthetase [Enterococcus faecalis TX0411]
 gi|315028722|gb|EFT40654.1| seryl-tRNA synthetase [Enterococcus faecalis TX4000]
          Length = 423

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 205/428 (47%), Positives = 284/428 (66%), Gaps = 11/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEY-ILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IRQN E +   LK R ++ +     L+LDE+ R L+ K+E+++  RN  S +I 
Sbjct: 1   MLDMKKIRQNVEVVQKKLKTRGVDEEVLLRFLALDEERRALLVKVEELKKHRNQVSGEIA 60

Query: 60  Q---AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIG 116
           Q   A  + +  L++        + EQ+ +L++E   +      +   +PN+P E VP+G
Sbjct: 61  QLKRAQKDASQQLLN-----MQEVSEQIKVLDQEVVHLQEQCTAIAERLPNLPHESVPVG 115

Query: 117 TSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLER 176
                N+ +R      +     + H+EIGEALG++DF+R  K+SG+RF    G  A LER
Sbjct: 116 ADEAANVEVRRWSTPKTFSFEPKPHWEIGEALGILDFERGAKVSGSRFLYYKGLGARLER 175

Query: 177 ALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVS 235
           A+  FM+D H +EHGYTEV  P LV  +AM+GTGQ PKF +D+F   +    LIPT+EV 
Sbjct: 176 AVYNFMLDQHVNEHGYTEVIPPYLVNSKAMFGTGQFPKFKEDVFQVAESDLTLIPTAEVP 235

Query: 236 LTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDS 295
           LTN Y++EI++++ LP+ FT L+PSFRSEAGSAGRDTRG++R HQF K E+V  +  E S
Sbjct: 236 LTNYYNNEILDAQELPIYFTALSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFSDAEHS 295

Query: 296 FTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCST 355
           + E E+M + A +IL++L L YRV++L TGD+GFSA KTYDLEVW+  Q  YREISSCS 
Sbjct: 296 YEELEKMTNNAGDILEKLGLPYRVITLSTGDMGFSAAKTYDLEVWIPAQKTYREISSCSN 355

Query: 356 CGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
           C +FQ+RR   RYRD  +  +++ HTLNGSG+AVGR + AILENY N DG+VTIP VLRP
Sbjct: 356 CEDFQARRALIRYRD-KTGHVQYAHTLNGSGLAVGRTVAAILENYQNEDGTVTIPEVLRP 414

Query: 416 YMNNLAVI 423
           YM+ L  I
Sbjct: 415 YMSGLTKI 422


>gi|327467137|gb|EGF12647.1| serine--tRNA ligase [Streptococcus sanguinis SK330]
          Length = 425

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 205/430 (47%), Positives = 283/430 (65%), Gaps = 15/430 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IR + + +   L  R ++  +   + ++D++ R L+ K+E+++A RN+ SA+I 
Sbjct: 1   MLDLKRIRTDFDSVAEKLATRGVDAATLNQMKTIDKERRDLLVKVEELKAERNTVSAEIA 60

Query: 60  QAI-----AEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVP 114
           QA      A+  ++ +  L  E   L   L        E+ + L +L + +PN+P E VP
Sbjct: 61  QAKRNKENADDKIAAMQKLSAEVKNLDATLA-------ELDAKLTELTTTLPNIPHESVP 113

Query: 115 IGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           +G   +ENI +R  G        ++ H+++GE L ++D++R  K++GARF    G  A L
Sbjct: 114 VGADEDENIEVRRWGTPRQFDFEAKAHWDLGEDLDILDWERGAKVTGARFLFYKGLGARL 173

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSE 233
           ERA+  FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+E
Sbjct: 174 ERAIYNFMLDEHGKE-GYTEVITPYMVNHDSMFGTGQYPKFKEDTFELSDTNFVLIPTAE 232

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V LTN Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E
Sbjct: 233 VPLTNYYRDEILDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPE 292

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
           +S+ E E+M + AE IL++L+L YRVV+LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 293 ESYQELEKMTANAENILQKLNLPYRVVALCTGDMGFSAAKTYDLEVWIPAQNTYREISSC 352

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP VL
Sbjct: 353 SNTEDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVL 412

Query: 414 RPYMNNLAVI 423
           RPYM  L VI
Sbjct: 413 RPYMGGLEVI 422


>gi|302185001|ref|ZP_07261674.1| seryl-tRNA synthetase [Pseudomonas syringae pv. syringae 642]
          Length = 426

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/432 (46%), Positives = 278/432 (64%), Gaps = 16/432 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R        I SL+ + +++  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRTQLQDVADRLASRGFTLDVARIESLEAQRKVVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A   G      ++ V+ + NE S  K +L  ++ E       L  L+  IPN+P E VPI
Sbjct: 61  AKQRGEDIAPLMADVERMGNELSEGKVELDAIQAE-------LDALVLSIPNLPHESVPI 113

Query: 116 GTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLE 175
           G     N+ +R  G         ++H  +GE  G +DF+ A KLSGARF++L G +A L 
Sbjct: 114 GADEEGNVEVRRWGTPAQFDFEVKDHVALGEKFGWLDFETAAKLSGARFALLRGPIARLH 173

Query: 176 RALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIPT 231
           RAL QFMI+LH +EHGY E   P LV+  A+ GTGQ+PKF +D+F  + +G    +LIPT
Sbjct: 174 RALAQFMINLHINEHGYEETYTPYLVQAPALQGTGQLPKFEEDLFKISREGEADLYLIPT 233

Query: 232 SEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITR 291
           +EVSLTN+ S EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I  
Sbjct: 234 AEVSLTNIVSGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVA 293

Query: 292 EEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREIS 351
            +DS    E +   AE +L+ L+L YR ++LCTGD+GFSA KTYDLEVW+  Q+ YREIS
Sbjct: 294 PDDSMAALESLTGNAERVLQLLELPYRTLALCTGDMGFSAVKTYDLEVWIPSQDKYREIS 353

Query: 352 SCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPT 411
           SCS CG+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P 
Sbjct: 354 SCSNCGDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPE 413

Query: 412 VLRPYMNNLAVI 423
           VL+PYM  L VI
Sbjct: 414 VLKPYMGGLEVI 425


>gi|296162244|ref|ZP_06845039.1| seryl-tRNA synthetase [Burkholderia sp. Ch1-1]
 gi|295887511|gb|EFG67334.1| seryl-tRNA synthetase [Burkholderia sp. Ch1-1]
          Length = 431

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/427 (47%), Positives = 275/427 (64%), Gaps = 11/427 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R    + E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDLDGVAKRLADRGYTLDVAAFTALEAERRDTQTRTEEMQARRNSLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G  +   A+  E S + +++        E+   L  ++  +PN+P E VP+G    
Sbjct: 61  LKGKGEDT--SAVMAEVSGIGDEMKASAARLDEIQKRLSDMLLGVPNLPHESVPLGKDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G         ++H ++G  LGL DF+   KLSGARF++L G +A L RAL Q
Sbjct: 119 ENVEVRRWGTPRQFEFEVKDHVDVGAPLGL-DFETGAKLSGARFTMLRGQIARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FMID HT  HGYTE+  P +V  E +YGTGQ+PKFADDMF    G       ++LI TSE
Sbjct: 178 FMIDTHTQHHGYTEIYTPYIVNPEILYGTGQLPKFADDMFRVERGGDENTVTQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     I+E+ +LP++ T  +P FRSEAGS GRDTRG++RQHQF K E+V I   E
Sbjct: 238 ISLTNTVRDSIVEADALPIKLTAHSPCFRSEAGSYGRDTRGLIRQHQFDKVEMVQIVAPE 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E+M+  AE IL++L+L YRV++LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 298 TSYDALEQMVGHAETILQKLELPYRVITLCTGDMGFSAAKTYDLEVWVPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RRM +RYR+   K  +  HTLNGSG+AVGR L+A+LEN+ NADGSVT+PT L
Sbjct: 358 SNTESFQARRMQARYRNAQGKP-ELVHTLNGSGLAVGRTLVAVLENFQNADGSVTVPTAL 416

Query: 414 RPYMNNL 420
           RPY+  L
Sbjct: 417 RPYLGGL 423


>gi|285018475|ref|YP_003376186.1| seryl-tRNA synthetase (serine--tRNA ligase) (serrs) protein
           [Xanthomonas albilineans GPE PC73]
 gi|283473693|emb|CBA16196.1| probable seryl-trna synthetase (serine--trna ligase) (serrs)
           protein [Xanthomonas albilineans]
          Length = 437

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 209/433 (48%), Positives = 283/433 (65%), Gaps = 18/433 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYIL---SLD----EKNRILIKKIEDIRARRNS 53
           MLD   +RQ P  L   L+ R       Y+L   +LD    ++ RI ++  +++++ RNS
Sbjct: 12  MLDPALLRQQPAVLAEQLRSRR-----GYVLDVLALDALEADRKRIQVR-TQELQSLRNS 65

Query: 54  NSAQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEV 113
            S  IGQA A+G    V AL  E +   ++L   E+   E+ + L+ L   IPN+P  +V
Sbjct: 66  RSKAIGQAKAKGED--VAALMAEVAGFGDELKASEQRLDEIRAQLETLALEIPNLPQADV 123

Query: 114 PIGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAH 173
           P G    +N+ ++  G   +     ++H E+G   G +D + A KLSGARF+VL G +A 
Sbjct: 124 PTGKDEVDNVEVQRWGTPRTFDFPVKDHVELGMQHGWLDGESAAKLSGARFTVLRGPIAR 183

Query: 174 LERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG---RWLIP 230
           L RAL QFM+DLHT  H Y E + P++V  +++YGTGQ+PKF +DMF T  G   R+LI 
Sbjct: 184 LHRALAQFMLDLHTGPHAYQETNVPVIVNADSLYGTGQLPKFEEDMFATALGEQKRYLIS 243

Query: 231 TSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT 290
           TSE+SLTNL   EI+E++ LPLR T  +  FRSEAGS GRDTRGM+RQHQF K ELVS+ 
Sbjct: 244 TSEISLTNLVRDEIVEAERLPLRMTAHSLCFRSEAGSGGRDTRGMIRQHQFEKVELVSVC 303

Query: 291 REEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREI 350
           R E+S  EHERM  CAE +L+ L L YR + LC+GD+GFSA KTYDLEVWL  Q  +REI
Sbjct: 304 RPEESAAEHERMTRCAEVVLETLGLPYRKMLLCSGDMGFSASKTYDLEVWLPSQQTFREI 363

Query: 351 SSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIP 410
           SSCS CG+FQ+RRM +R+R+P +   +  HTLNGSG AVGR +IA++ENY NADGS+++P
Sbjct: 364 SSCSNCGDFQARRMQARWRNPATGKPELLHTLNGSGTAVGRAMIAVMENYQNADGSISVP 423

Query: 411 TVLRPYMNNLAVI 423
             L+ YM  +  I
Sbjct: 424 QALQSYMGGVERI 436


>gi|297538756|ref|YP_003674525.1| seryl-tRNA synthetase [Methylotenera sp. 301]
 gi|297258103|gb|ADI29948.1| seryl-tRNA synthetase [Methylotenera sp. 301]
          Length = 426

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 207/423 (48%), Positives = 277/423 (65%), Gaps = 7/423 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R + + +   LK R  E  S    +L+ + + +  + ++++A+RN+ S QIG 
Sbjct: 1   MLDIQALRTDLDGVVSQLKARGFEFDSASFTTLENERKTVQTRTQELQAKRNNTSKQIGI 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A ++G    V A+  E +   +QL   E    E+ +SL+ L+  +PN+P   VP G S  
Sbjct: 61  AKSKG--EDVSAIMAEVAGFGDQLKADEARLIELQASLQNLLLNVPNLPHSSVPSGKSEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +NI +R VG   +     ++H ++G  LGL DFD  TKLSG RF+++ G +A + RAL Q
Sbjct: 119 DNIEVRKVGTPRTFDFEVKDHADVGTPLGL-DFDTGTKLSGTRFTLMRGQIAKMHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--TDGR-WLIPTSEVSLT 237
           FM++  T +HGY E   P LV  E + GTGQ+PKF +D+F     D + +LIPTSEV+LT
Sbjct: 178 FMLNTQTEQHGYEECYTPYLVNAETLTGTGQLPKFEEDLFSLQHNDSKLYLIPTSEVTLT 237

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           N    EI+  +SLP++ T   P FRSEAGS GRDT+GM+RQHQF K E+V I   + S+ 
Sbjct: 238 NTVRDEIVPLESLPIKLTAHTPCFRSEAGSYGRDTKGMIRQHQFDKVEMVQIVHPDTSYA 297

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
             E M+  AE ILK L L YRVVSLCTGD+GF A KTYDLEVWL  QN YREISS S C 
Sbjct: 298 ALEEMVGHAENILKALGLPYRVVSLCTGDMGFGAAKTYDLEVWLPAQNTYREISSVSNCE 357

Query: 358 NFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
            FQ+RR+ +R+R+ N K  +  HTLNGSG+AVGR L+A+LENY NADGSVT+P VLRPYM
Sbjct: 358 AFQARRLQARFRNENGKP-ELVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPEVLRPYM 416

Query: 418 NNL 420
           N L
Sbjct: 417 NGL 419


>gi|325688711|gb|EGD30720.1| serine--tRNA ligase [Streptococcus sanguinis SK115]
          Length = 425

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 204/430 (47%), Positives = 283/430 (65%), Gaps = 15/430 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IR + + +   L  R ++  +   + ++D++ R L+ K+E+++A RN+ SA+I 
Sbjct: 1   MLDLKRIRTDFDSVAEKLATRGVDAATLNQMKTIDKERRDLLVKVEELKAERNTVSAEIA 60

Query: 60  QAI-----AEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVP 114
           QA      A+  ++ +  L  E   L   L        E+ + L +  + +PN+P E VP
Sbjct: 61  QAKRNKENADDKIAAMQKLSAEVKNLDATLA-------ELDAKLTEFTTTLPNIPHESVP 113

Query: 115 IGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           +G   +EN+ +R  G        ++ H+++GE L ++D++R  K++GARF    G  A L
Sbjct: 114 VGADEDENVEVRRWGTPRQFDFEAKAHWDLGEDLDILDWERGAKVTGARFLFYKGLGARL 173

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSE 233
           ERA+  FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+E
Sbjct: 174 ERAIYNFMLDEHGKE-GYTEVITPYMVNHDSMFGTGQYPKFKEDTFELSDTNFVLIPTAE 232

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V LTN Y  EI++SK LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E
Sbjct: 233 VPLTNYYRDEILDSKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPE 292

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
           +S+ E E+M + AE IL++L+L YRVV+LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 293 ESYEELEKMTANAENILQKLNLPYRVVALCTGDMGFSAAKTYDLEVWIPAQNTYREISSC 352

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP VL
Sbjct: 353 SNTEDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVL 412

Query: 414 RPYMNNLAVI 423
           RPYM  L VI
Sbjct: 413 RPYMGGLEVI 422


>gi|66046404|ref|YP_236245.1| seryl-tRNA synthetase [Pseudomonas syringae pv. syringae B728a]
 gi|289679158|ref|ZP_06500048.1| seryl-tRNA synthetase [Pseudomonas syringae pv. syringae FF5]
 gi|81308101|sp|Q4ZRL5|SYS_PSEU2 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|63257111|gb|AAY38207.1| Seryl-tRNA synthetase, class IIa [Pseudomonas syringae pv. syringae
           B728a]
 gi|330900602|gb|EGH32021.1| seryl-tRNA synthetase [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330940282|gb|EGH43412.1| seryl-tRNA synthetase [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330981394|gb|EGH79497.1| seryl-tRNA synthetase [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 426

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/432 (46%), Positives = 279/432 (64%), Gaps = 16/432 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R        I SL+ + +++  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRTQLQDVADRLASRGFTLDVARIESLEAQRKVVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A   G      ++ V+ + NE S  K +L  ++ E       L  L+  IPN+P E VP+
Sbjct: 61  AKQRGEDIAPLMADVERMGNELSEGKVELDGIQAE-------LDALVLSIPNLPHESVPV 113

Query: 116 GTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLE 175
           G     N+ +R  G   S     ++H  +GE  G +DF+ A KLSGARF++L G +A L 
Sbjct: 114 GADEEGNVEVRRWGTPTSFDFEVKDHVALGEKFGWLDFETAAKLSGARFALLRGPIARLH 173

Query: 176 RALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIPT 231
           RAL QFMI+LH +EHGY E   P LV+  A+ GTGQ+PKF +D+F  + +G    +LIPT
Sbjct: 174 RALAQFMINLHINEHGYEETYTPYLVQAPALQGTGQLPKFEEDLFKISREGEADLYLIPT 233

Query: 232 SEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITR 291
           +EVSLTN+ S EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I  
Sbjct: 234 AEVSLTNIVSGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVA 293

Query: 292 EEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREIS 351
            +DS    E +   AE +L+ L+L YR ++LCTGD+GFSA KTYDLEVW+  Q+ YREIS
Sbjct: 294 PDDSMAALESLTGNAERVLQLLELPYRTLALCTGDMGFSAVKTYDLEVWIPSQDKYREIS 353

Query: 352 SCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPT 411
           SCS CG+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P 
Sbjct: 354 SCSNCGDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPE 413

Query: 412 VLRPYMNNLAVI 423
           VL+PYM  L VI
Sbjct: 414 VLKPYMGGLEVI 425


>gi|330972886|gb|EGH72952.1| seryl-tRNA synthetase [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 426

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/432 (46%), Positives = 279/432 (64%), Gaps = 16/432 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R        I SL+ + +++  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRTQLQDVADRLASRGFTLDVARIESLEAQRKVVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A   G      ++ V+ + NE S  K +L  ++ E       L  L+  IPN+P E VP+
Sbjct: 61  AKQRGEDIAPLMADVERMGNELSEGKVELDGIQAE-------LDALVLSIPNLPHESVPV 113

Query: 116 GTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLE 175
           G     N+ +R  G   S     ++H  +GE  G +DF+ A KLSGARF++L G +A L 
Sbjct: 114 GADEEGNVEVRRWGTPTSFDFEVKDHVALGEKFGWLDFETAAKLSGARFALLRGPIARLH 173

Query: 176 RALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIPT 231
           RAL QFMI+LH +EHGY E   P LV+  A+ GTGQ+PKF +D+F  + +G    +LIPT
Sbjct: 174 RALAQFMINLHINEHGYEETYTPYLVQAPALQGTGQLPKFEEDLFKISREGEADLYLIPT 233

Query: 232 SEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITR 291
           +EVSLTN+ S EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I  
Sbjct: 234 AEVSLTNIVSGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVA 293

Query: 292 EEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREIS 351
            +DS    E +   AE +L+ L+L YR ++LCTGD+GFSA KTYDLEVW+  Q+ YREIS
Sbjct: 294 PDDSMAALESLTGNAERVLQLLELPYRTLALCTGDMGFSAVKTYDLEVWIPSQDKYREIS 353

Query: 352 SCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPT 411
           SCS CG+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P 
Sbjct: 354 SCSNCGDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIGVPE 413

Query: 412 VLRPYMNNLAVI 423
           VL+PYM  L VI
Sbjct: 414 VLKPYMGGLEVI 425


>gi|322391441|ref|ZP_08064910.1| serine--tRNA ligase [Streptococcus peroris ATCC 700780]
 gi|321145524|gb|EFX40916.1| serine--tRNA ligase [Streptococcus peroris ATCC 700780]
          Length = 424

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 202/426 (47%), Positives = 278/426 (65%), Gaps = 5/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IR + + +   L  R +   +   +  +D K R ++ K+E +++ RN+ SA+I 
Sbjct: 1   MLDIKRIRTDFDTVAKKLATRGVAAATLNEMKEIDAKRRDILVKVETLKSERNTVSAEIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA  + N    D        L   +  L+ E  E+ + L +  + +PN+P + VP+G   
Sbjct: 61  QA--KRNKENADDKITAMQALSADIKSLDAELTEIDAKLTEFTTTLPNIPADSVPVGADE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           N+N+ +R  G         + H+++GEALG++D++R  K++GARF    G  A LERA+ 
Sbjct: 119 NDNVEVRRWGTPRDFSFDVKAHWDLGEALGILDWERGAKVTGARFLFYKGLGAKLERAIY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLTN 238
            FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+EV LTN
Sbjct: 179 NFMLDEHAKE-GYTEVIPPYMVNHDSMFGTGQYPKFKEDTFELSDTNYVLIPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E+S+ E
Sbjct: 238 YYRDEILDGKDLPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESYDE 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M+  AE IL++L+L YRVV+L TGD+GFSA KTYDLEVW+  QN YREISSCS   +
Sbjct: 298 LEKMVGNAENILQKLNLPYRVVALSTGDMGFSAAKTYDLEVWIPAQNTYREISSCSNTED 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP VLRPYM 
Sbjct: 358 FQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVLRPYMG 417

Query: 419 NLAVIK 424
            + VI+
Sbjct: 418 GVDVIR 423


>gi|323525163|ref|YP_004227316.1| seryl-tRNA synthetase [Burkholderia sp. CCGE1001]
 gi|323382165|gb|ADX54256.1| seryl-tRNA synthetase [Burkholderia sp. CCGE1001]
          Length = 431

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 202/427 (47%), Positives = 275/427 (64%), Gaps = 11/427 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R    + E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDLDGVAKRLADRGYTLDVAAFTALEAERRDTQTRTEELQARRNSLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G  +   AL  E   + +++     +  ++   L  L+  +PN+P + VP+G    
Sbjct: 61  MKGRGEDT--SALMAEVGGIGDEMKASAAKLDDIQKRLSDLLLGVPNLPHKSVPVGRDEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G         ++H ++G  LGL DF+   KLSGARF++L G +A L RAL Q
Sbjct: 119 DNVEVRRWGTPRQFDFEVKDHVDVGAPLGL-DFETGAKLSGARFTMLRGQIARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FMID HT +HGYTE+  P +V  E +YGTGQ+PKFADDMF    G       ++LI TSE
Sbjct: 178 FMIDTHTQQHGYTEIYTPYIVNPEILYGTGQLPKFADDMFRVEKGGGENTVTQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     I+E+ +LP++ T  +P FRSEAGS GRDTRGM+RQHQF K E+V I   E
Sbjct: 238 ISLTNTVRESIVEANALPIKLTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQIVAPE 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E+M+  AE IL++L+L YRV++LCTGD+GFSA KTYDLEVWL  QN YREISSC
Sbjct: 298 TSYDALEQMVGHAETILQKLELPYRVITLCTGDMGFSATKTYDLEVWLPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RRM +RYR+   K  +  HTLNGSG+AVGR L+A+LEN+ NADGSVT+P VL
Sbjct: 358 SNTESFQARRMQARYRNAQGKP-ELVHTLNGSGLAVGRTLVAVLENFQNADGSVTVPAVL 416

Query: 414 RPYMNNL 420
           RPY+  +
Sbjct: 417 RPYLGGV 423


>gi|270293326|ref|ZP_06199535.1| serine--tRNA ligase [Streptococcus sp. M143]
 gi|270278175|gb|EFA24023.1| serine--tRNA ligase [Streptococcus sp. M143]
          Length = 424

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/426 (47%), Positives = 280/426 (65%), Gaps = 5/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IR + + +   L  R ++      +  +D K R ++ K+E+++A RN+ SA+I 
Sbjct: 1   MLDIKRIRTDFDAVAEKLATRGVDATILNEMKEIDAKRRDILVKVENLKAERNTVSAEIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA  + N    D       TL  ++  L+ E  ++ + L +  + +PN+P + VP+G   
Sbjct: 61  QA--KRNKENADDKIAAMQTLSAEVKALDAELADIDAKLTEFTTTLPNIPADSVPVGADE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+ +R  G         + H+++GE LG++D++R  K++GARF    G  A LERA+ 
Sbjct: 119 DDNVEVRRWGTPREFDFEPKAHWDLGEDLGILDWERGGKVTGARFLFYKGLGARLERAIY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLTN 238
            FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+EV LTN
Sbjct: 179 NFMLDEHGKE-GYTEVITPYMVNHDSMFGTGQYPKFKEDTFELSDTNYVLIPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E+S+ E
Sbjct: 238 YYRDEILDGKDLPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESYEE 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M + AE IL++L+L YRVV+L TGD+GFSA KTYDLEVW+  QN YREISSCS   +
Sbjct: 298 LEKMTANAENILQKLNLPYRVVALSTGDMGFSAAKTYDLEVWIPAQNTYREISSCSNTED 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY NADGSVTIP VLRPYM 
Sbjct: 358 FQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNADGSVTIPEVLRPYMG 417

Query: 419 NLAVIK 424
              VIK
Sbjct: 418 GAEVIK 423


>gi|332366431|gb|EGJ44182.1| serine--tRNA ligase [Streptococcus sanguinis SK355]
          Length = 425

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 205/430 (47%), Positives = 281/430 (65%), Gaps = 15/430 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IR + + +   L  R ++  +   + S+DE+ R L+ K+E ++A RN+ SA+I 
Sbjct: 1   MLDLKRIRTDFDSVAEKLANRGVDAATLNQMKSIDEERRDLLVKVEALKAERNTVSAEIA 60

Query: 60  QAI-----AEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVP 114
           QA      A+  ++ +  L  E   L   L        E+ + L +  + +PN+P E VP
Sbjct: 61  QAKRNKENADDKIAAMQKLSAEVKNLDATLA-------ELDAKLTEFTTTLPNIPHESVP 113

Query: 115 IGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           +G   +EN+ +R  G        ++ H+++GE L ++D++R  K++GARF    G  A L
Sbjct: 114 VGADEDENVEVRRWGTPREFDFEAKAHWDLGEDLDILDWERGAKVTGARFLFYKGLGARL 173

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSE 233
           ERA+  FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+E
Sbjct: 174 ERAIYNFMLDEHGKE-GYTEVITPYMVNHDSMFGTGQYPKFKEDTFELSDTNFVLIPTAE 232

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V LTN Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E
Sbjct: 233 VPLTNYYRDEILDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPE 292

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
           +S+ E E+M + AE IL++L+L YRVV+LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 293 ESYQELEKMTANAENILQKLNLPYRVVALCTGDMGFSAAKTYDLEVWIPAQNTYREISSC 352

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP VL
Sbjct: 353 SNTEDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVL 412

Query: 414 RPYMNNLAVI 423
           RPYM  L VI
Sbjct: 413 RPYMGGLEVI 422


>gi|289168522|ref|YP_003446791.1| seryl-tRNA synthetase [Streptococcus mitis B6]
 gi|288908089|emb|CBJ22929.1| seryl-tRNA synthetase [Streptococcus mitis B6]
          Length = 424

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/426 (47%), Positives = 278/426 (65%), Gaps = 5/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IR + + +   L  R ++      +  +D K R ++ K+E ++A RN+ SA+I 
Sbjct: 1   MLDIKRIRTDFDAVAEKLATRGVDAAILNEMKEIDAKRRDILVKVETLKAERNTVSAEIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA  + N    D       TL  ++  L+ E  E+ + L +  + +PN+P + VP+G   
Sbjct: 61  QA--KRNKENADDKIAAMQTLSAEVKALDAELAEIDAKLTEFTTTLPNIPADSVPVGADE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+ +R  G         + H+++GE LG++D++R  K++GARF    G  A LERA+ 
Sbjct: 119 DDNVEVRRWGSPREFDFEPKAHWDLGEDLGILDWERGGKVTGARFLFYKGLGARLERAIY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLTN 238
            FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+EV LTN
Sbjct: 179 NFMLDEHGKE-GYTEVITPYMVNHDSMFGTGQYPKFKEDTFELSDSNYVLIPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E+S+ E
Sbjct: 238 YYRDEILDGKDLPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESYEE 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M + AE IL++L+L YRVV+L TGD+GFSA KTYDLEVW+  QN YREISSCS   +
Sbjct: 298 LEKMTANAENILQKLNLPYRVVALSTGDMGFSAAKTYDLEVWIPAQNTYREISSCSNTED 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY NADGSVTIP  LRPYM 
Sbjct: 358 FQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNADGSVTIPEALRPYMG 417

Query: 419 NLAVIK 424
              VIK
Sbjct: 418 GAEVIK 423


>gi|304386837|ref|ZP_07369101.1| serine--tRNA ligase [Neisseria meningitidis ATCC 13091]
 gi|304339091|gb|EFM05181.1| serine--tRNA ligase [Neisseria meningitidis ATCC 13091]
          Length = 431

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 202/431 (46%), Positives = 275/431 (63%), Gaps = 9/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L +R     +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLARRGYNFDTARFDALEERRKSVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPAGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTLKHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDESKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  I++   LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVAGSILDEGGLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIK 424
           +PYM  +A ++
Sbjct: 419 QPYMGGVAKLE 429


>gi|303232994|ref|ZP_07319674.1| serine--tRNA ligase [Atopobium vaginae PB189-T1-4]
 gi|302480921|gb|EFL44001.1| serine--tRNA ligase [Atopobium vaginae PB189-T1-4]
          Length = 429

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 201/425 (47%), Positives = 276/425 (64%), Gaps = 3/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKR-HLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+++R+NP+ +D A   R +     +   +LDE+ R  I ++E ++A RN+ S QIG
Sbjct: 1   MLDIKFVRENPDCVDKACASRQNAHWDRDAFFALDEQRRSTIVEVEKLQAHRNAVSKQIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           + +A G        K E +  KE++  LE+   E    L  L+S IPN+P   +P G   
Sbjct: 61  KLMAAGKTQEAQDAKQEVAHNKERIAELERTRTECEQKLHDLVSAIPNIPDASIPYGKDD 120

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +EN+ +R  G   S       H+++G A  ++DFDR  KL+G+RF VL G+ A +ERAL 
Sbjct: 121 SENVEVRRWGTPTSFDFEPSAHWDLGTANKMIDFDRGVKLAGSRFYVLGGYGAQMERALI 180

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNL 239
            F ID+H ++ G+ E   P+L   ++++GTGQ+PKF +D+F  +D  +LIPT+EV LTNL
Sbjct: 181 NFFIDMH-AKAGFKEWWPPVLTNYDSLFGTGQLPKFDEDLFHVSDNLYLIPTAEVMLTNL 239

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +  E++++  LPL +T   P FR EAGSAGRDTRG++R H+F K E+V     E+S  E 
Sbjct: 240 HRDEVLDAAQLPLLYTAFTPCFREEAGSAGRDTRGIIRVHEFDKVEMVKFATPENSMNEL 299

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E M+  AE  L+ L L YRVVSLCTGD+GFSACK YDLEVWL   N Y+EISSCS C +F
Sbjct: 300 ELMVGEAEACLQTLGLPYRVVSLCTGDIGFSACKCYDLEVWLPSYNNYKEISSCSNCWDF 359

Query: 360 QSRRMNSRYRDPNS-KSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           Q+RR N RYRD  S K  ++ HTLNGSG+AVGR + AI+ENY  ADGS+ +P  LRPYM 
Sbjct: 360 QARRANIRYRDAASFKGTRYVHTLNGSGLAVGRTMAAIMENYQQADGSIVVPEALRPYMR 419

Query: 419 NLAVI 423
            L VI
Sbjct: 420 GLEVI 424


>gi|332359167|gb|EGJ36988.1| serine--tRNA ligase [Streptococcus sanguinis SK49]
          Length = 425

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 204/430 (47%), Positives = 282/430 (65%), Gaps = 15/430 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IR + + +   L  R ++  +   + ++D++ R L+ K+E+++A RN+ SA+I 
Sbjct: 1   MLDLKRIRTDFDSVAEKLATRGVDAATLNQMKTIDKERRDLLVKVEELKAERNTVSAEIA 60

Query: 60  QAI-----AEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVP 114
           QA      A+  ++ +  L  E   L   L        E+ + L +  + +PN+P E VP
Sbjct: 61  QAKRNKENADDKIAAMQKLSAEVKNLDATLA-------ELDAKLTEFTTTLPNIPHESVP 113

Query: 115 IGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           +G   +EN+ +R  G        ++ H+++GE L ++D++R  K++GARF    G  A L
Sbjct: 114 VGADEDENVEVRRWGTPRQFDFEAKAHWDLGEDLDILDWERGAKVTGARFLFYKGLGARL 173

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSE 233
           ERA+  FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+E
Sbjct: 174 ERAIYNFMLDEHGKE-GYTEVITPYIVNHDSMFGTGQYPKFKEDTFELSDTNFVLIPTAE 232

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V LTN Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E
Sbjct: 233 VPLTNYYRDEILDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPE 292

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
           +S+ E E+M + AE ILK+L+L YRVV+LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 293 ESYQELEKMTANAENILKKLNLPYRVVALCTGDMGFSAAKTYDLEVWIPAQNTYREISSC 352

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP VL
Sbjct: 353 SNTEDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVL 412

Query: 414 RPYMNNLAVI 423
           RPYM  L VI
Sbjct: 413 RPYMGGLEVI 422


>gi|330875798|gb|EGH09947.1| seryl-tRNA synthetase [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
          Length = 426

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 204/433 (47%), Positives = 281/433 (64%), Gaps = 18/433 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R        I SL+ + +++  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRTQLQDVADRLASRGFTLDVARIESLEAQRKVVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A   G      ++ V+ + NE S  K +L  ++ E       L  L+  IPN+P E VP+
Sbjct: 61  AKQRGEDIAPLMADVERMGNELSEGKVELDAIQAE-------LDALVLNIPNLPHESVPV 113

Query: 116 GTSANENILIRSVGKKPSAIHLS-REHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           G     N+ +R  G  P+A     ++H  +GE  G +DF+ A KLSGARF++L G +A L
Sbjct: 114 GADEEGNVEVRRWGT-PTAFDFEVKDHVALGEKFGWLDFETAAKLSGARFALLRGPIARL 172

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIP 230
            RAL QFMI+LH +EHGY E   P LV+  A+ GTGQ+PKF +D+F  + +G    +LIP
Sbjct: 173 HRALAQFMINLHINEHGYEETYTPYLVQAPALQGTGQLPKFEEDLFKISREGEADLYLIP 232

Query: 231 TSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT 290
           T+EVSLTN+ S EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I 
Sbjct: 233 TAEVSLTNIVSGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIV 292

Query: 291 REEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREI 350
             +DS    E +   AE +L+ L+L YR ++LCTGD+GFSA KTYDLEVW+  Q+ YREI
Sbjct: 293 APDDSMAALESLTGNAERVLQLLELPYRTLALCTGDMGFSAVKTYDLEVWIPSQDKYREI 352

Query: 351 SSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIP 410
           SSCS CG+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P
Sbjct: 353 SSCSNCGDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVP 412

Query: 411 TVLRPYMNNLAVI 423
            VL+PYM  L VI
Sbjct: 413 EVLKPYMGGLEVI 425


>gi|78043693|ref|YP_361479.1| seryl-tRNA synthetase [Carboxydothermus hydrogenoformans Z-2901]
 gi|123770534|sp|Q3A8Q5|SYS_CARHZ RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|77995808|gb|ABB14707.1| seryl-tRNA synthetase [Carboxydothermus hydrogenoformans Z-2901]
          Length = 424

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 205/426 (48%), Positives = 278/426 (65%), Gaps = 3/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+ +RQNPE +  ALKKR      +  L LDE+ R L+  +E  + +RN+ S +IG+
Sbjct: 1   MLDIKKVRQNPEIVVEALKKRGANLNLDEFLRLDEERRKLLVDVEQKKYKRNTVSEEIGR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G  +  D L  E   L +++  L+ E  ++   L  ++  IPN+P E VP+G  ++
Sbjct: 61  LKKQGLPA--DDLILEMRALSDEIKKLDDEVAQIEEKLHAILLTIPNIPHESVPVGKDSS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G+        + H+EIGE L ++DF R +K++GARF+   G  A LERA+  
Sbjct: 119 ENVEVRRWGEPRKFTFTPKAHWEIGEELDILDFARGSKVTGARFTFYKGLGAMLERAVIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-GRWLIPTSEVSLTNL 239
           FM+DLHT EHGY EV  P +V  ++M GTGQ+PKFA+DMF       +LIPT+EV +TNL
Sbjct: 179 FMLDLHTREHGYVEVFPPFIVNADSMMGTGQLPKFAEDMFKLEGLNYYLIPTAEVPVTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y  EI++   LP+     +  FR+EAG+AGRDTRG++RQHQF K ELV   + E+S+ E 
Sbjct: 239 YREEILDGDKLPIYHCAYSACFRAEAGAAGRDTRGLIRQHQFNKVELVKFVKPENSYEEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++   AE +L+ L L YRVV LCTGDLGFSA KTYD+EVWL   N Y+EISSCS   +F
Sbjct: 299 EKLTRDAERVLQLLGLPYRVVVLCTGDLGFSAAKTYDIEVWLPSYNDYKEISSCSNFEDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR   RY++      +F HTLNGSG+AVGR + AILENY N DGSVT+P VLRPYM  
Sbjct: 359 QARRAKIRYKEHPKAKPEFVHTLNGSGLAVGRTVAAILENYQNEDGSVTVPEVLRPYMGV 418

Query: 420 LAVIKK 425
             + KK
Sbjct: 419 DRIYKK 424


>gi|15800756|ref|NP_286770.1| seryl-tRNA synthetase [Escherichia coli O157:H7 EDL933]
 gi|12514055|gb|AAG55380.1|AE005278_6 serine tRNA synthetase; also charges selenocystein tRNA with serine
           [Escherichia coli O157:H7 str. EDL933]
          Length = 430

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 201/431 (46%), Positives = 272/431 (63%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLHT +HGY+E   P LV  +A+YGTGQ+PKFA D+F T        T    LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDALYGTGQLPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|189183335|ref|YP_001937120.1| seryl-tRNA synthetase [Orientia tsutsugamushi str. Ikeda]
 gi|238692234|sp|B3CQX9|SYS_ORITI RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|189180106|dbj|BAG39886.1| seryl-tRNA synthetase [Orientia tsutsugamushi str. Ikeda]
          Length = 429

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/425 (47%), Positives = 286/425 (67%), Gaps = 6/425 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR NP+ LD +L KR ++  S+ I+ +D + R LI  I+ ++  R   S+ +  
Sbjct: 1   MLDIKWIRANPDKLDESLSKRGIDSVSKSIIHIDSEKRTLISLIQKLQHERKEKSSSVAH 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKE--EHEVCSSLKKLISCIPNVPLEEVPIGTS 118
            I + + +  + ++N+   + +++  LE     HE    L +++  +PN+  ++VP GT+
Sbjct: 61  -IYDKSSTDFEEIQNDVKLINQKITELETSLLHHE--KRLSEIMDNLPNLVADDVPYGTN 117

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
           ++ N +++  G   + I   + H+EIG+ LG+MDF+ ATK+SG+RF +L   LA LERAL
Sbjct: 118 SDMNKVLKECGTIQN-IKFPKHHYEIGKNLGMMDFNTATKMSGSRFVILKHDLAKLERAL 176

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTN 238
             FMID+HT+E  + EVS P LV+D AMY  GQ+PKFAD  F TT G  LIPT+EV LTN
Sbjct: 177 INFMIDVHTTEFNFFEVSPPCLVKDHAMYNVGQLPKFADASFETTTGYRLIPTAEVPLTN 236

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           ++++  +  + LP+R     P FRSE GSAG+D +GMLR HQF K EL +I   ++S  E
Sbjct: 237 IFANTTLLEEKLPIRLVAFTPCFRSEVGSAGKDVKGMLRMHQFGKVELFTIATPKESNRE 296

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E + + AE+IL++L L YRVV LC+GD+GF+A KTYDLEVWL  QN YREISSCS   +
Sbjct: 297 FEYLTAAAEKILEKLGLPYRVVLLCSGDIGFAAHKTYDLEVWLPAQNCYREISSCSHFSS 356

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR  S+YR+  SK + F HT+NGSG+AVGR +IAILENY N+DGSVTIP  LR YM 
Sbjct: 357 FQARRSLSKYRELCSKKVNFLHTINGSGLAVGRTIIAILENYQNSDGSVTIPEKLRNYMG 416

Query: 419 NLAVI 423
              +I
Sbjct: 417 GQKLI 421


>gi|147676348|ref|YP_001210563.1| seryl-tRNA synthetase [Pelotomaculum thermopropionicum SI]
 gi|189083576|sp|A5D6D5|SYS_PELTS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|146272445|dbj|BAF58194.1| seryl-tRNA synthetase [Pelotomaculum thermopropionicum SI]
          Length = 422

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 204/424 (48%), Positives = 280/424 (66%), Gaps = 4/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++++R NP  +  AL +R +    +    LDE+ R  +  +E ++ RRN  S +IG+
Sbjct: 1   MLDMKFVRNNPAAVRDALARRGVSVALDEFYKLDEERREKLFIVEQMKNRRNVVSEEIGR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G  +    L  E   L  Q+  +++E  E+   L+ ++  IPN+P E VP G  A 
Sbjct: 61  LKKSGKDAPEMVL--EMRDLSRQIKEIDEEIKELDGRLQDMLLNIPNIPHESVPEGAGAA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN ++R+ GK        R H+EIGE L ++DF+R  K++GARFS   G+ A LERA+  
Sbjct: 119 ENPVVRTWGKPRDFGFTPRPHWEIGEQLDIIDFERGGKVAGARFSFYKGYGARLERAVIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLTNL 239
           FM+DLHT+EHGY E+  P +V  ++M GTGQ+PKFA+DMF      + LIPT+EV +TNL
Sbjct: 179 FMLDLHTAEHGYVEIFPPFIVNRDSMVGTGQLPKFAEDMFKLEGAEYYLIPTAEVPVTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y +EI++ + LP+     +  FR+EAG+AGRDTRG++RQHQF K ELV   R EDS+ E 
Sbjct: 239 YRNEILDGEKLPILHCAYSACFRAEAGAAGRDTRGLIRQHQFNKVELVKFCRPEDSYDEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++ + AE++L++L L YRVV LCTGDLGFSA KTYDLEVWL     Y+EISSCS   +F
Sbjct: 299 EKLTADAEKVLQKLGLPYRVVVLCTGDLGFSAAKTYDLEVWLPSYQEYKEISSCSNFADF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR   R+R+   K+ +F HTLNGSG+AVGR + AILENY  ADGSVT+P  LRPYM  
Sbjct: 359 QARRAGIRFRNARGKT-EFVHTLNGSGLAVGRTVAAILENYQEADGSVTVPEALRPYMGG 417

Query: 420 LAVI 423
           L+ I
Sbjct: 418 LSRI 421


>gi|330889681|gb|EGH22342.1| seryl-tRNA synthetase [Pseudomonas syringae pv. mori str. 301020]
          Length = 426

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 205/433 (47%), Positives = 280/433 (64%), Gaps = 18/433 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R        I SL+ + +++  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRTQLQDVADRLASRGFTLDVARIESLEAQRKVVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A   G      ++ V+ + NE S  K +L  ++ E       L  L+  IPN+P E VP+
Sbjct: 61  AKQRGEDIAPLMADVERMGNELSEGKVELDGIQAE-------LDALVLSIPNLPHESVPV 113

Query: 116 GTSANENILIRSVGKKPSAIHLS-REHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           G     N+ +R  G  P+A     ++H  +GE  G +DF+ A KLSGARF++L G +A L
Sbjct: 114 GADEEGNVEVRRWGT-PTAFDFEVKDHVALGEKFGWLDFETAAKLSGARFALLRGPIARL 172

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIP 230
            RAL QFMI+LH +EHGY E   P LV+  A+ GTGQ+PKF +D+F  T +G    +LIP
Sbjct: 173 HRALAQFMINLHINEHGYEETYTPYLVQAPALQGTGQLPKFEEDLFKITREGEADLYLIP 232

Query: 231 TSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT 290
           T+EVSLTN+ S EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I 
Sbjct: 233 TAEVSLTNIVSGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIV 292

Query: 291 REEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREI 350
             EDS    E +   AE +L+ L+  YR ++LCTGD+GFSA KTYDLEVW+  Q+ YREI
Sbjct: 293 APEDSMAALESLTGNAERVLQLLEPPYRTLALCTGDMGFSAVKTYDLEVWIPSQDKYREI 352

Query: 351 SSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIP 410
           SSCS CG+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P
Sbjct: 353 SSCSNCGDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVP 412

Query: 411 TVLRPYMNNLAVI 423
            VL+PYM  L VI
Sbjct: 413 EVLKPYMGGLEVI 425


>gi|237748955|ref|ZP_04579435.1| seryl-tRNA synthetase [Oxalobacter formigenes OXCC13]
 gi|229380317|gb|EEO30408.1| seryl-tRNA synthetase [Oxalobacter formigenes OXCC13]
          Length = 436

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 205/428 (47%), Positives = 276/428 (64%), Gaps = 12/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M+DIQ +R++ + +   LK R  E        L+ + R L  + E+++ARRNS S QIG 
Sbjct: 1   MIDIQLLRKDIDAVAARLKTRKFELDVNAFNVLESERRQLQTQTEEMQARRNSLSKQIG- 59

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            I +G      A+  E S + +QL   E    E+ + L + +  IPNVP E VP+G   +
Sbjct: 60  -ILKGKKEDASAVMAEVSGIGDQLKANEVALAELQAKLSEFMLSIPNVPHESVPVGQDES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R VG         ++H ++G  LGL DF+ ATKL+GARF ++ G++A L RAL Q
Sbjct: 119 ANVEVRRVGTPREFDFEVKDHVDVGTPLGL-DFETATKLTGARFCLMRGNMARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGR--------WLIPTS 232
           FM+DL T+EHGYTE   P +   +++YGTGQ+PKFA+D+F    G         +LIPT+
Sbjct: 178 FMLDLQTTEHGYTECYTPYMANADSLYGTGQLPKFAEDLFAARKGGQEGEGENLYLIPTA 237

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV+LTN    EI+ ++ LP++ T   P FRSEAGS GRDTRGM+RQHQF K E+V +   
Sbjct: 238 EVTLTNTVRGEILSAEQLPVKLTAHTPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQVVHP 297

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E S+   E M+  A  +L++L L YRVVSL TGD+GFSA KTYDLEVWL  QN YREISS
Sbjct: 298 EKSYEALEEMVKNAGRVLEKLGLPYRVVSLSTGDMGFSAAKTYDLEVWLPAQNTYREISS 357

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
            S C  FQ+RRM +R+R+   +  +  HTLNGSG+AVGR L+A+LEN+  ADGSVTIPT 
Sbjct: 358 VSNCEAFQARRMQARFRNDKGRP-ELVHTLNGSGLAVGRTLVALLENFQQADGSVTIPTA 416

Query: 413 LRPYMNNL 420
           L+PYM  L
Sbjct: 417 LQPYMGGL 424


>gi|307710546|ref|ZP_07646982.1| seryl-tRNA synthetase [Streptococcus mitis SK564]
 gi|307618699|gb|EFN97839.1| seryl-tRNA synthetase [Streptococcus mitis SK564]
          Length = 424

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/426 (47%), Positives = 278/426 (65%), Gaps = 5/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IR + + +   L  R ++      +  +D K R ++ K+E ++A RN+ SA+I 
Sbjct: 1   MLDIKRIRTDFDAVAEKLATRGVDAAVLNEMKEIDAKRRDILVKVETLKAERNTVSAEIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA  + N    D       TL  ++  L+ E  E+ + L +  + +PN+P + VP+G   
Sbjct: 61  QA--KRNKENADDKIAAMQTLSAEVKSLDAELAEIDAKLTEFTTTLPNIPADSVPVGADE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+ +R  G         + H+++GE LG++D++R  K++GARF    G  A LERA+ 
Sbjct: 119 DDNVEVRRWGTPREFDFEPKAHWDLGEDLGILDWERGGKVTGARFLFYKGLGARLERAIY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLTN 238
            FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+EV LTN
Sbjct: 179 NFMLDEHGKE-GYTEVITPYMVNHDSMFGTGQYPKFKEDTFELSDSNYVLIPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E+S+ E
Sbjct: 238 YYRDEILDGKDLPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESYEE 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M + AE IL++L+L YRVV+L TGD+GFSA KTYDLEVW+  QN YREISSCS   +
Sbjct: 298 LEKMTANAENILQKLNLPYRVVALSTGDMGFSAAKTYDLEVWIPAQNTYREISSCSNTED 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY NADGSVTIP  LRPYM 
Sbjct: 358 FQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNADGSVTIPEALRPYMG 417

Query: 419 NLAVIK 424
              VIK
Sbjct: 418 GAEVIK 423


>gi|229550614|ref|ZP_04439339.1| seryl-tRNA synthetase [Enterococcus faecalis ATCC 29200]
 gi|255971641|ref|ZP_05422227.1| seryl-tRNA synthetase [Enterococcus faecalis T1]
 gi|255974606|ref|ZP_05425192.1| seryl-tRNA synthetase [Enterococcus faecalis T2]
 gi|256956923|ref|ZP_05561094.1| seryl-tRNA synthetase [Enterococcus faecalis DS5]
 gi|256960726|ref|ZP_05564897.1| seryl-tRNA synthetase [Enterococcus faecalis Merz96]
 gi|257078596|ref|ZP_05572957.1| seryl-tRNA synthetase [Enterococcus faecalis JH1]
 gi|257081438|ref|ZP_05575799.1| seryl-tRNA synthetase [Enterococcus faecalis E1Sol]
 gi|257421433|ref|ZP_05598423.1| seryl-tRNA synthetase [Enterococcus faecalis X98]
 gi|293384900|ref|ZP_06630738.1| serine--tRNA ligase [Enterococcus faecalis R712]
 gi|293388590|ref|ZP_06633091.1| serine--tRNA ligase [Enterococcus faecalis S613]
 gi|294781552|ref|ZP_06746890.1| serine--tRNA ligase [Enterococcus faecalis PC1.1]
 gi|307269018|ref|ZP_07550381.1| seryl-tRNA synthetase [Enterococcus faecalis TX4248]
 gi|307278221|ref|ZP_07559302.1| seryl-tRNA synthetase [Enterococcus faecalis TX0860]
 gi|312901191|ref|ZP_07760476.1| seryl-tRNA synthetase [Enterococcus faecalis TX0470]
 gi|312908712|ref|ZP_07767652.1| seryl-tRNA synthetase [Enterococcus faecalis DAPTO 512]
 gi|312979173|ref|ZP_07790879.1| seryl-tRNA synthetase [Enterococcus faecalis DAPTO 516]
 gi|229304333|gb|EEN70329.1| seryl-tRNA synthetase [Enterococcus faecalis ATCC 29200]
 gi|255962659|gb|EET95135.1| seryl-tRNA synthetase [Enterococcus faecalis T1]
 gi|255967478|gb|EET98100.1| seryl-tRNA synthetase [Enterococcus faecalis T2]
 gi|256947419|gb|EEU64051.1| seryl-tRNA synthetase [Enterococcus faecalis DS5]
 gi|256951222|gb|EEU67854.1| seryl-tRNA synthetase [Enterococcus faecalis Merz96]
 gi|256986626|gb|EEU73928.1| seryl-tRNA synthetase [Enterococcus faecalis JH1]
 gi|256989468|gb|EEU76770.1| seryl-tRNA synthetase [Enterococcus faecalis E1Sol]
 gi|257163257|gb|EEU93217.1| seryl-tRNA synthetase [Enterococcus faecalis X98]
 gi|291077818|gb|EFE15182.1| serine--tRNA ligase [Enterococcus faecalis R712]
 gi|291082048|gb|EFE19011.1| serine--tRNA ligase [Enterococcus faecalis S613]
 gi|294451409|gb|EFG19873.1| serine--tRNA ligase [Enterococcus faecalis PC1.1]
 gi|306505096|gb|EFM74285.1| seryl-tRNA synthetase [Enterococcus faecalis TX0860]
 gi|306514687|gb|EFM83239.1| seryl-tRNA synthetase [Enterococcus faecalis TX4248]
 gi|310625311|gb|EFQ08594.1| seryl-tRNA synthetase [Enterococcus faecalis DAPTO 512]
 gi|311288045|gb|EFQ66601.1| seryl-tRNA synthetase [Enterococcus faecalis DAPTO 516]
 gi|311291710|gb|EFQ70266.1| seryl-tRNA synthetase [Enterococcus faecalis TX0470]
 gi|315031222|gb|EFT43154.1| seryl-tRNA synthetase [Enterococcus faecalis TX0017]
 gi|315036450|gb|EFT48382.1| seryl-tRNA synthetase [Enterococcus faecalis TX0027]
 gi|315147058|gb|EFT91074.1| seryl-tRNA synthetase [Enterococcus faecalis TX4244]
 gi|315156336|gb|EFU00353.1| seryl-tRNA synthetase [Enterococcus faecalis TX0043]
 gi|315158469|gb|EFU02486.1| seryl-tRNA synthetase [Enterococcus faecalis TX0312]
 gi|315168211|gb|EFU12228.1| seryl-tRNA synthetase [Enterococcus faecalis TX1341]
 gi|323479332|gb|ADX78771.1| seryl-tRNA synthetase [Enterococcus faecalis 62]
 gi|327533948|gb|AEA92782.1| serine--tRNA ligase [Enterococcus faecalis OG1RF]
 gi|329577577|gb|EGG59011.1| serine--tRNA ligase [Enterococcus faecalis TX1467]
          Length = 423

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 205/428 (47%), Positives = 283/428 (66%), Gaps = 11/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEY-ILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IRQN E +   LK R ++ +     L+LDE+ R L+ K+E+++  RN  S +I 
Sbjct: 1   MLDMKKIRQNVEVVQKKLKTRGVDEEVLLRFLALDEERRALLVKVEELKKHRNQVSGEIA 60

Query: 60  Q---AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIG 116
           Q   A  + +  L++        + EQ+ +L++E   +      +   +PN+P E VP+G
Sbjct: 61  QLKRAQKDASQQLLN-----MQEVSEQIKVLDQEVVHLQEQCTAIAERLPNLPHESVPVG 115

Query: 117 TSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLER 176
                N+ +R      +     + H+EIGEALG++DF+R  K+SG+RF    G  A LER
Sbjct: 116 ADEAANVEVRRWSTPKTFSFEPKPHWEIGEALGILDFERGAKVSGSRFLYYKGLGARLER 175

Query: 177 ALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVS 235
           A+  FM+D H +EHGYTEV  P LV  +AM+GTGQ PKF +D+F   +    LIPT+EV 
Sbjct: 176 AVYNFMLDQHVNEHGYTEVIPPYLVNSKAMFGTGQFPKFKEDVFQVAESDLTLIPTAEVP 235

Query: 236 LTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDS 295
           LTN Y++EI++++ LP+ FT L+PSFRSEAGSAGRDTRG++R HQF K E+V  +  E S
Sbjct: 236 LTNYYNNEILDAQELPIYFTALSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFSDAEHS 295

Query: 296 FTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCST 355
           + E E+M + A +IL++L L YRV++L TGD+GFSA KTYDLEVW+  Q  YREISSCS 
Sbjct: 296 YEELEKMTNNAGDILEKLGLPYRVITLSTGDMGFSAAKTYDLEVWIPAQKTYREISSCSN 355

Query: 356 CGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
           C +FQ+RR   RYRD  +  +++ HTLNGSG+AVGR + AILENY N DG+VTIP VLRP
Sbjct: 356 CEDFQARRALIRYRD-KTGHVQYAHTLNGSGLAVGRTVAAILENYQNEDGTVTIPEVLRP 414

Query: 416 YMNNLAVI 423
           YM  L  I
Sbjct: 415 YMGGLTKI 422


>gi|322374872|ref|ZP_08049386.1| serine--tRNA ligase [Streptococcus sp. C300]
 gi|321280372|gb|EFX57411.1| serine--tRNA ligase [Streptococcus sp. C300]
          Length = 424

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/426 (47%), Positives = 279/426 (65%), Gaps = 5/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IR + + +   L  R ++      +  +D K R ++ K+E ++A RN+ SA+I 
Sbjct: 1   MLDIKRIRTDFDAVAEKLATRGVDAAILNEMKEIDAKRRDILVKVETLKAERNTVSAEIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA  + N    D       TL  ++ +L+ E  E+ + L +  + +PN+P + VP+G   
Sbjct: 61  QA--KRNKENADDKIAAMQTLSAEVKVLDAELGEIDAKLTEFTTTLPNIPADSVPVGADE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+ +R  G         + H+++GE LG++D++R  K++GARF    G  A LERA+ 
Sbjct: 119 DDNVEVRRWGTPREFDFEPKAHWDLGEDLGILDWERGGKVTGARFLFYKGLGARLERAIY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLTN 238
            FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+EV LTN
Sbjct: 179 NFMLDEHGKE-GYTEVITPYIVNHDSMFGTGQYPKFKEDTFELSDTNFVLIPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E+S+ E
Sbjct: 238 YYRDEILDGKDLPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESYEE 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M + AE IL++L+L YRVV+L TGD+GFSA KTYDLEVW+  QN YREISSCS   +
Sbjct: 298 LEKMTANAENILQKLNLPYRVVALSTGDMGFSAAKTYDLEVWIPAQNTYREISSCSNTED 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY NADGSVTIP  LRPYM 
Sbjct: 358 FQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNADGSVTIPEALRPYMG 417

Query: 419 NLAVIK 424
              VIK
Sbjct: 418 GAEVIK 423


>gi|257087920|ref|ZP_05582281.1| seryl-tRNA synthetase [Enterococcus faecalis D6]
 gi|256995950|gb|EEU83252.1| seryl-tRNA synthetase [Enterococcus faecalis D6]
          Length = 423

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 205/428 (47%), Positives = 283/428 (66%), Gaps = 11/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEY-ILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IRQN E +   LK R ++ +     L+LDE+ R L+ K+E+++  RN  S +I 
Sbjct: 1   MLDMKKIRQNVEVVQKKLKTRGVDEEVLLRFLALDEERRALLVKVEELKKHRNQVSGEIA 60

Query: 60  Q---AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIG 116
           Q   A  + +  L++        + EQ+ +L++E   +      +   +PN+P E VP+G
Sbjct: 61  QLKRAQKDASQQLLN-----MQEVSEQIKVLDQEVVHLQEQCTAIAERLPNLPHESVPVG 115

Query: 117 TSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLER 176
                N+ +R      +     + H+EIGEALG++DF+R  K+SG+RF    G  A LER
Sbjct: 116 ADEAANVEVRRWSTPKTFSFEPKPHWEIGEALGILDFERGAKVSGSRFLYYKGLGARLER 175

Query: 177 ALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVS 235
           A+  FM+D H +EHGYTEV  P LV  +AM+GTGQ PKF +D+F   +    LIPT+EV 
Sbjct: 176 AVYNFMLDQHVNEHGYTEVIPPYLVNSKAMFGTGQFPKFKEDVFQVAESDLTLIPTAEVP 235

Query: 236 LTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDS 295
           LTN Y++EI++++ LP+ FT L+PSFRSEAGSAGRDTRG++R HQF K E+V  +  E S
Sbjct: 236 LTNYYNNEILDAQELPIYFTALSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVRFSDAEHS 295

Query: 296 FTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCST 355
           + E E+M + A +IL++L L YRV++L TGD+GFSA KTYDLEVW+  Q  YREISSCS 
Sbjct: 296 YEELEKMTNNAGDILEKLGLPYRVITLSTGDMGFSAAKTYDLEVWIPAQKTYREISSCSN 355

Query: 356 CGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
           C +FQ+RR   RYRD  +  +++ HTLNGSG+AVGR + AILENY N DG+VTIP VLRP
Sbjct: 356 CEDFQARRALIRYRD-KTGHVQYAHTLNGSGLAVGRTVAAILENYQNEDGTVTIPEVLRP 414

Query: 416 YMNNLAVI 423
           YM  L  I
Sbjct: 415 YMGGLTKI 422


>gi|28870509|ref|NP_793128.1| seryl-tRNA synthetase [Pseudomonas syringae pv. tomato str. DC3000]
 gi|38258311|sp|Q87ZS9|SYS_PSESM RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|28853757|gb|AAO56823.1| seryl-tRNA synthetase [Pseudomonas syringae pv. tomato str. DC3000]
          Length = 426

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 204/433 (47%), Positives = 281/433 (64%), Gaps = 18/433 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R        I SL+ + +++  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRTQLQDVADRLASRGFTLDVARIESLEAQRKVVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A   G      ++ V+ + NE S  K +L  ++ E       L  L+  IPN+P E VP+
Sbjct: 61  AKQRGEDIAPLMADVERMGNELSEGKVELDAIQAE-------LDALVLNIPNLPHESVPV 113

Query: 116 GTSANENILIRSVGKKPSAIHLS-REHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           G     N+ +R  G  P+A     ++H  +GE  G +DF+ A KLSGARF++L G +A L
Sbjct: 114 GADEEGNVEVRRWGT-PTAFGFEVKDHVALGEKFGWLDFETAAKLSGARFALLRGPIARL 172

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIP 230
            RAL QFMI+LH +EHGY E   P LV+  A+ GTGQ+PKF +D+F  + +G    +LIP
Sbjct: 173 HRALAQFMINLHINEHGYEETYTPYLVQAPALQGTGQLPKFEEDLFKISREGEADLYLIP 232

Query: 231 TSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT 290
           T+EVSLTN+ S EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I 
Sbjct: 233 TAEVSLTNIVSGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIV 292

Query: 291 REEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREI 350
             +DS    E +   AE +L+ L+L YR ++LCTGD+GFSA KTYDLEVW+  Q+ YREI
Sbjct: 293 APDDSMAALESLTGNAERVLQLLELPYRTLALCTGDMGFSAVKTYDLEVWIPSQDKYREI 352

Query: 351 SSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIP 410
           SSCS CG+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P
Sbjct: 353 SSCSNCGDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVP 412

Query: 411 TVLRPYMNNLAVI 423
            VL+PYM  L VI
Sbjct: 413 EVLKPYMGGLEVI 425


>gi|307728953|ref|YP_003906177.1| seryl-tRNA synthetase [Burkholderia sp. CCGE1003]
 gi|307583488|gb|ADN56886.1| seryl-tRNA synthetase [Burkholderia sp. CCGE1003]
          Length = 431

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 202/427 (47%), Positives = 273/427 (63%), Gaps = 11/427 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R    + E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDLDGVAKRLADRGYALDVAAFTALEAERRDTQTRTEELQARRNSLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G  +   AL  E   + +++     +  ++   L  L+  +PN+P E VP+G    
Sbjct: 61  MKGRGEDT--SALMAEVGGIGDEMKASAAKLDDIQKRLSDLLLGVPNLPHESVPVGRDEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G         ++H ++G  LGL DF+   KLSGARF++L G +A L RAL Q
Sbjct: 119 DNVEVRRWGTPRQFDFEVKDHVDVGAPLGL-DFETGAKLSGARFTMLRGQIARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FMID HT +HGYTE+  P +V  E +YGTGQ+PKFADDMF    G       ++LI TSE
Sbjct: 178 FMIDTHTQQHGYTEIYTPYIVNPEILYGTGQLPKFADDMFRVEKGGGENTVTQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     I+E  +LP++ T  +P FRSEAGS GRDTRGM+RQHQF K E+V I   E
Sbjct: 238 ISLTNTVRESIVEGNALPIKLTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQIVAPE 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E+M+  AE IL++L+L YRV++LCTGD+GFSA KTYDLEVWL  QN YREISSC
Sbjct: 298 TSYDALEQMVGHAETILQKLELPYRVITLCTGDMGFSATKTYDLEVWLPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RRM +RYR+   K  +  HTLNGSG+AVGR L+A+LEN+ NADGSVT+P  L
Sbjct: 358 SNTESFQARRMQARYRNAQGKP-ELVHTLNGSGLAVGRTLVAVLENFQNADGSVTVPAAL 416

Query: 414 RPYMNNL 420
           RPY+  +
Sbjct: 417 RPYLGGV 423


>gi|170722569|ref|YP_001750257.1| seryl-tRNA synthetase [Pseudomonas putida W619]
 gi|229890231|sp|B1JBE0|SYS_PSEPW RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|169760572|gb|ACA73888.1| seryl-tRNA synthetase [Pseudomonas putida W619]
          Length = 426

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 204/434 (47%), Positives = 284/434 (65%), Gaps = 18/434 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R        I SL+E+ + +  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRGQLQEVADRLASRGFSLDVARIESLEERRKAVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A A+G      ++ V+ + NE +  K +L  ++ E       L  ++  IPN+P   VP+
Sbjct: 61  AKAKGEDIAPLMADVERMANELAAGKVELDGIQAE-------LDGIVLTIPNLPDASVPV 113

Query: 116 GTSANENILIRSVGKKPSAIHLS-REHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           G S ++N+ +R  G  P A   + ++H  +GE  G +DF+ A KLSGARF+VL G +A L
Sbjct: 114 GASEDDNVEVRRWGT-PRAFDFAIKDHVALGEISGGLDFEAAAKLSGARFAVLRGPIARL 172

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIP 230
            RAL QFMI+LHT EHGY E   P LV+  A+ GTGQ+PKF +D+F  T +G    +LIP
Sbjct: 173 HRALAQFMINLHTGEHGYEEHYTPYLVQAPALQGTGQLPKFEEDLFKITREGEADFYLIP 232

Query: 231 TSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT 290
           T+EVSLTNL + EII++K LPL+     P FRSEAG++GRDTRGM+RQHQF K E+V + 
Sbjct: 233 TAEVSLTNLVAGEIIDAKQLPLKLVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQVV 292

Query: 291 REEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREI 350
               S    E + + AE +L+ L+L YRV++LCTGD+GF A KTYDLEVW+  Q+ YREI
Sbjct: 293 EPSKSMEALEGLTANAERVLQLLELPYRVLALCTGDMGFGAVKTYDLEVWVPSQDKYREI 352

Query: 351 SSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIP 410
           SSCS CG+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P
Sbjct: 353 SSCSNCGDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVP 412

Query: 411 TVLRPYMNNLAVIK 424
            VL+PYM  + VI+
Sbjct: 413 EVLKPYMGGVEVIR 426


>gi|163781886|ref|ZP_02176886.1| seryl-tRNA synthetase [Hydrogenivirga sp. 128-5-R1-1]
 gi|159883106|gb|EDP76610.1| seryl-tRNA synthetase [Hydrogenivirga sp. 128-5-R1-1]
          Length = 424

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 208/427 (48%), Positives = 287/427 (67%), Gaps = 9/427 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS--EYILSLDEKNRILIKKIEDIRARRNSNSAQI 58
           M+DI+ IR+ P+++   LK R  E     + +L LD + R L+ +IE +RA RN+ S +I
Sbjct: 1   MIDIELIRRKPDYVKERLKTRDPELPGLIDQVLELDSRRRSLLTEIEALRAERNARSKEI 60

Query: 59  GQAIAEG-NLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGT 117
           G+   EG + + +++L  E   LK ++  L++E  EV   L++L+  IPN+P E VP+G 
Sbjct: 61  GKLRLEGKDTTQIESLVRE---LKAKIDKLDEELKEVQRELRELMLRIPNLPHESVPVGE 117

Query: 118 SANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
             +EN+ +R  G+        + H+E+GE LG++DF+R  +LSG+RF+VL G  A LERA
Sbjct: 118 DESENVEVRRWGEPKEFTFQPKPHWELGEKLGILDFERGARLSGSRFTVLKGWGARLERA 177

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGRWLIPTSEVSL 236
           L  FM+DLH ++ GY EV  P LVR E + GTGQ+PKF +D++ C  D  +LIPT+EV L
Sbjct: 178 LINFMLDLHRTK-GYEEVLPPHLVRPEVLEGTGQLPKFEEDLYKCERDELYLIPTAEVPL 236

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TNL+  EI++ + LP+  T   P +R EAGS G+D RG++RQHQF K ELV I   + S+
Sbjct: 237 TNLFRGEILKEEELPIYLTAHTPCYRREAGSHGKDIRGIIRQHQFNKVELVKIVHPDTSY 296

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            E E++ + AEE+LK L L YRVV LCTGDLGFSA KTYDLEVW   Q  YREISSCS C
Sbjct: 297 DELEKLAADAEEVLKLLGLPYRVVELCTGDLGFSAAKTYDLEVWFPSQGKYREISSCSNC 356

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
            +FQ+RRMN+R++D   K+ +F HTLNGSG+AVGR L AILENY   DGSV +P  LR Y
Sbjct: 357 EDFQARRMNTRFKDERGKN-RFVHTLNGSGLAVGRTLAAILENYQREDGSVEVPEALRDY 415

Query: 417 MNNLAVI 423
           +    ++
Sbjct: 416 LKADIIV 422


>gi|257417514|ref|ZP_05594508.1| seryl-tRNA synthetase [Enterococcus faecalis AR01/DG]
 gi|257159342|gb|EEU89302.1| seryl-tRNA synthetase [Enterococcus faecalis ARO1/DG]
          Length = 423

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 206/428 (48%), Positives = 283/428 (66%), Gaps = 11/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEY-ILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IRQN E +   LK R ++ +     L+LDE+ R L+ K+E+++  RN  S +I 
Sbjct: 1   MLDMKKIRQNVEVVQKKLKTRGVDEEVLLRFLALDEERRALLVKVEELKKHRNQVSGEIA 60

Query: 60  Q---AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIG 116
           Q   A  + +  L++        + EQ+ +L++E   +      +   +PN+P E VP+G
Sbjct: 61  QLKRAQKDASQQLLN-----MQEVSEQIKVLDQEVVHLQEQCTAIAERLPNLPHESVPVG 115

Query: 117 TSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLER 176
                N+ +R      +     + H+EIGEALG++DF+R  K+SG+RF    G  A LER
Sbjct: 116 ADEAANVEVRRWSTPKTFSFEPKPHWEIGEALGILDFERGAKVSGSRFLYYKGLGACLER 175

Query: 177 ALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVS 235
           A+  FM+D H +EHGYTEV  P LV  +AM+GTGQ PKF +D+F   +    LIPT+EV 
Sbjct: 176 AVYNFMLDQHVNEHGYTEVIPPYLVNSKAMFGTGQFPKFKEDVFQVAESDLTLIPTAEVP 235

Query: 236 LTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDS 295
           LTN Y++EI+E++ LP+ FT L+PSFRSEAGSAGRDTRG++R HQF K E+V  +  E S
Sbjct: 236 LTNYYNNEILEAQELPIYFTALSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFSDAEHS 295

Query: 296 FTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCST 355
           + E E+M + A +IL++L L YRV++L TGD+GFSA KTYDLEVW+  Q  YREISSCS 
Sbjct: 296 YEELEKMTNNAGDILEKLGLPYRVITLSTGDMGFSAAKTYDLEVWIPAQKTYREISSCSN 355

Query: 356 CGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
           C +FQ+RR   RYRD  +  +++ HTLNGSG+AVGR + AILENY N DG+VTIP VLRP
Sbjct: 356 CEDFQARRALIRYRD-KTGHVQYAHTLNGSGLAVGRTVAAILENYQNEDGTVTIPEVLRP 414

Query: 416 YMNNLAVI 423
           YM  L  I
Sbjct: 415 YMGGLTKI 422


>gi|322387197|ref|ZP_08060807.1| serine--tRNA ligase [Streptococcus infantis ATCC 700779]
 gi|321141726|gb|EFX37221.1| serine--tRNA ligase [Streptococcus infantis ATCC 700779]
          Length = 424

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 205/426 (48%), Positives = 277/426 (65%), Gaps = 5/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IR + + +   L  R ++      +  +D K R ++ K+E ++A RN+ SA+I 
Sbjct: 1   MLDIKRIRTDFDAVAEKLATRGVDAAILNEMKEIDAKRRDILVKVETLKAERNTVSAEIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA  + N    D       TL  ++  L+ E  E+ + L +  + +PN+P + VPIG   
Sbjct: 61  QA--KRNKENADDKIAAMQTLSAEVKALDAELAEIDARLTEFTTTLPNIPADSVPIGADE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+ +R  G         + H+++GE LG++D++R  K++GARF    G  A LERA+ 
Sbjct: 119 DDNVEVRRWGTPREFDFEPKAHWDLGEDLGILDWERGGKVTGARFLFYKGLGARLERAIY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLTN 238
            FM+D H  E GYTEV  P +V  ++M+GTG  PKF DD F  +D  + LIPT+EV LTN
Sbjct: 179 NFMLDEHGKE-GYTEVITPYMVNHDSMFGTGNYPKFKDDTFEISDTNYVLIPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  EII+ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E+S+ E
Sbjct: 238 YYRDEIIDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESYEE 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M + AE IL++L+L YRVV+L TGD+GFSA KTYDLEVW+  QN YREISSCS   +
Sbjct: 298 LEKMTANAENILQKLNLPYRVVALSTGDMGFSAAKTYDLEVWIPAQNTYREISSCSNTED 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP VLRPYM 
Sbjct: 358 FQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVLRPYMG 417

Query: 419 NLAVIK 424
              VIK
Sbjct: 418 GAEVIK 423


>gi|157151414|ref|YP_001450960.1| seryl-tRNA synthetase [Streptococcus gordonii str. Challis substr.
           CH1]
 gi|189083593|sp|A8AYV0|SYS_STRGC RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|157076208|gb|ABV10891.1| seryl-tRNA synthetase [Streptococcus gordonii str. Challis substr.
           CH1]
          Length = 425

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/430 (47%), Positives = 282/430 (65%), Gaps = 15/430 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IR + + +   L  R ++  +   + ++D++ R L+ K+E+++A RN+ SA+I 
Sbjct: 1   MLDLKRIRTDFDTVAAKLATRGVDAATLNQMKTIDKERRDLLVKVEELKAERNTVSAEIA 60

Query: 60  QAI-----AEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVP 114
           QA      A+  ++ +  L  E   L   L        E+ + L +  + +PN+P E VP
Sbjct: 61  QAKRNKENADDKIAAMQKLSAEVKNLDATLA-------ELDAKLTEFTTTLPNIPHESVP 113

Query: 115 IGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           +G   +EN+ +R  G        ++ H+++GE L ++D++R  K++GARF    G  A L
Sbjct: 114 VGADEDENVEVRRWGTPRQFDFEAKAHWDLGEDLDILDWERGAKVTGARFLFYKGLGARL 173

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSE 233
           ERA+  FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+E
Sbjct: 174 ERAIYNFMLDEHGKE-GYTEVITPYMVNHDSMFGTGQYPKFKEDTFELSDTNFVLIPTAE 232

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V LTN Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E
Sbjct: 233 VPLTNYYRDEILDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPE 292

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
           +S+ E E+M + AE IL++L+L YRVV+LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 293 ESYEELEKMTANAENILQKLNLPYRVVALCTGDMGFSAAKTYDLEVWIPAQNTYREISSC 352

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP VL
Sbjct: 353 SNTEDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVL 412

Query: 414 RPYMNNLAVI 423
           RPYM  L VI
Sbjct: 413 RPYMGGLEVI 422


>gi|325695149|gb|EGD37050.1| serine--tRNA ligase [Streptococcus sanguinis SK150]
          Length = 425

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/430 (47%), Positives = 282/430 (65%), Gaps = 15/430 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IR + + +   L  R ++  +   + ++D++ R L+ K+E+++A RN+ SA+I 
Sbjct: 1   MLDLKRIRTDFDSVAEKLATRGVDAATLNQMKTIDKERRDLLVKVEELKAERNTVSAEIA 60

Query: 60  QAI-----AEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVP 114
           QA      A+  ++ +  L  E   L   L        E+ + L +  + +PN+P E VP
Sbjct: 61  QAKRNKENADDKIAAMQKLSAEVKNLDANLA-------ELDAKLTEFTTTLPNIPHESVP 113

Query: 115 IGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           +G   +EN+ +R  G        ++ H+++GE L ++D++R  K++GARF    G  A L
Sbjct: 114 VGADEDENVEVRRWGTPRQFDFEAKAHWDLGEDLNILDWERGAKVTGARFLFYKGLGARL 173

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSE 233
           ERA+  FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+E
Sbjct: 174 ERAIYNFMLDEHGKE-GYTEVITPYMVNHDSMFGTGQYPKFKEDTFELSDTNFVLIPTAE 232

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V LTN Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E
Sbjct: 233 VPLTNYYRDEILDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPE 292

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
           +S+ E E+M + AE IL++L+L YRVV+LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 293 ESYQELEKMTANAENILQKLNLPYRVVALCTGDMGFSAAKTYDLEVWIPAQNTYREISSC 352

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP VL
Sbjct: 353 SNTEDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVL 412

Query: 414 RPYMNNLAVI 423
           RPYM  L VI
Sbjct: 413 RPYMGGLEVI 422


>gi|298530167|ref|ZP_07017569.1| seryl-tRNA synthetase [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509541|gb|EFI33445.1| seryl-tRNA synthetase [Desulfonatronospira thiodismutans ASO3-1]
          Length = 425

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 196/431 (45%), Positives = 282/431 (65%), Gaps = 13/431 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+++R+NP+ +  ++K R      +  L L+++ R L ++++D++ RRN  S ++  
Sbjct: 1   MLDIKFVRKNPDLVAKSIKDRGAAQDLDDFLKLEQQRRELTQRVQDLKTRRNQASQEVAL 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A  EG      +  +  L ++   L  +L  L+++ HE   S       +PN+P  +VP+
Sbjct: 61  AKREGRDAAQAMEGLSELSDKIKELDGELKGLDRQVHEWLLS-------VPNIPAGDVPV 113

Query: 116 GTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLE 175
           G+  ++N ++R+ G+KP      REH+++G  LG +DF+ A K++G+RF +  G  A LE
Sbjct: 114 GSDEDDNQVVRTWGEKPVMDFQPREHWDLGVELGGLDFEHAAKMTGSRFVMYVGWGARLE 173

Query: 176 RALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEV 234
           RAL  FM+D+ T EHGY E   P++V  ++M  TGQ+PKFADD+F   +  + LIPT+EV
Sbjct: 174 RALINFMLDVQTGEHGYMETMPPMIVNRDSMTATGQLPKFADDLFKLENWEYYLIPTAEV 233

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            LTN++  E+++   LPL +T     FRSEAGS G+DTRG++RQHQF K ELV     +D
Sbjct: 234 PLTNIHRGEVLQEDQLPLAYTAFTGCFRSEAGSHGKDTRGIIRQHQFNKVELVRFAHPDD 293

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCS 354
           SF + E +L  AEEILKRL LHYRVV+LCTGDLGF A KTYD+EVWL GQ  YREISSCS
Sbjct: 294 SFKQLELLLGHAEEILKRLGLHYRVVNLCTGDLGFGAAKTYDIEVWLPGQGKYREISSCS 353

Query: 355 TCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR 414
              +FQ+RR + R++    K  +  HTLNGSG+AVGR L+AI+EN    DGS+ IP VLR
Sbjct: 354 NFTDFQARRGDIRFKPAQEKKSRLVHTLNGSGLAVGRALVAIMENCQQKDGSIVIPEVLR 413

Query: 415 PYMNNLAVIKK 425
           PY   + +I+K
Sbjct: 414 PYTGGMDIIRK 424


>gi|187730384|ref|YP_001880909.1| seryl-tRNA synthetase [Shigella boydii CDC 3083-94]
 gi|238691690|sp|B2TUI5|SYS_SHIB3 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|187427376|gb|ACD06650.1| seryl-tRNA synthetase [Shigella boydii CDC 3083-94]
          Length = 430

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/431 (46%), Positives = 272/431 (63%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    +++L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIESLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T        T    LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|29374751|ref|NP_813903.1| seryl-tRNA synthetase [Enterococcus faecalis V583]
 gi|227555780|ref|ZP_03985827.1| seryl-tRNA synthetase [Enterococcus faecalis HH22]
 gi|257418758|ref|ZP_05595752.1| seryl-tRNA synthetase [Enterococcus faecalis T11]
 gi|46577438|sp|Q839Q8|SYS1_ENTFA RecName: Full=Seryl-tRNA synthetase 1; AltName: Full=Serine--tRNA
           ligase 1; Short=SerRS 1; AltName:
           Full=Seryl-tRNA(Ser/Sec) synthetase 1
 gi|29342209|gb|AAO79975.1| seryl-tRNA synthetase [Enterococcus faecalis V583]
 gi|227175076|gb|EEI56048.1| seryl-tRNA synthetase [Enterococcus faecalis HH22]
 gi|257160586|gb|EEU90546.1| seryl-tRNA synthetase [Enterococcus faecalis T11]
          Length = 423

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 205/428 (47%), Positives = 282/428 (65%), Gaps = 11/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEY-ILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IRQN E +   LK R ++ +     L+LDE  R L+ K+E+++  RN  S +I 
Sbjct: 1   MLDMKKIRQNVEVVQKKLKTRGVDEEVLLRFLALDEGRRALLVKVEELKKHRNQVSGEIA 60

Query: 60  Q---AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIG 116
           Q   A  + +  L++        + EQ+ +L++E   +      +   +PN+P E VP+G
Sbjct: 61  QLKRAQKDASQQLLN-----MQEVSEQIKVLDQEVVHLQEQCTAIAERLPNLPHESVPVG 115

Query: 117 TSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLER 176
                N+ +R      +     + H+EIGEALG++DF+R  K+SG+RF    G  A LER
Sbjct: 116 ADEAANVEVRRWSTPKTFSFEPKPHWEIGEALGILDFERGAKVSGSRFLYYKGLGARLER 175

Query: 177 ALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVS 235
           A+  FM+D H +EHGYTEV  P LV  +AM+GTGQ PKF +D+F   +    LIPT+EV 
Sbjct: 176 AVYNFMLDQHVNEHGYTEVIPPYLVNSKAMFGTGQFPKFKEDVFQVAESDLTLIPTAEVP 235

Query: 236 LTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDS 295
           LTN Y++EI++++ LP+ FT L+PSFRSEAGSAGRDTRG++R HQF K E+V  +  E S
Sbjct: 236 LTNYYNNEILDAQELPIYFTALSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFSDAEHS 295

Query: 296 FTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCST 355
           + E E+M + A +IL++L L YRV++L TGD+GFSA KTYDLEVW+  Q  YREISSCS 
Sbjct: 296 YEELEKMTNNAGDILEKLGLPYRVITLSTGDMGFSAAKTYDLEVWIPAQKTYREISSCSN 355

Query: 356 CGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
           C +FQ+RR   RYRD  +  +++ HTLNGSG+AVGR + AILENY N DG+VTIP VLRP
Sbjct: 356 CEDFQARRALIRYRD-KTGHVQYAHTLNGSGLAVGRTVAAILENYQNEDGTVTIPEVLRP 414

Query: 416 YMNNLAVI 423
           YM  L  I
Sbjct: 415 YMGGLTKI 422


>gi|312865429|ref|ZP_07725656.1| serine--tRNA ligase [Streptococcus downei F0415]
 gi|311098947|gb|EFQ57164.1| serine--tRNA ligase [Streptococcus downei F0415]
          Length = 425

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/433 (46%), Positives = 280/433 (64%), Gaps = 15/433 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IRQN + +   L  R ++ ++ + +  LD K R L+ K E+++A RN  S  I 
Sbjct: 1   MLDLKRIRQNFDEVAKNLANRGVKAETLDQLKELDVKRRDLLVKSEELKAHRNVASTAIA 60

Query: 60  QAI-----AEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVP 114
           QA      A   ++ +  +  E  +L  QL        EV   L  ++  +PN+P  +VP
Sbjct: 61  QAKRNKEDASDQIAQMQKVSAEIKSLDSQLA-------EVDQKLNDIVVTLPNMPHADVP 113

Query: 115 IGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           +G   +EN+ +R  G        ++ H+++GE L ++D++R  K++G+RF    G  A L
Sbjct: 114 VGADEDENVEVRRWGTPRDFDFEAKAHWDLGEDLDILDWERGAKVTGSRFLFYKGLGARL 173

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSE 233
           ERA+  FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F   D  + LIPT+E
Sbjct: 174 ERAIYNFMLDEHAKE-GYTEVIPPYMVNHDSMFGTGQYPKFKEDTFELADSDYVLIPTAE 232

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V LTN Y  EI++ K +P+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E
Sbjct: 233 VPLTNYYRGEILDGKEMPVYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPE 292

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+ E E+M + AE IL++L+L YRV++LCTGD+GFSA KTYD+EVW+  QN YREISSC
Sbjct: 293 TSYEELEKMTANAENILQKLNLPYRVITLCTGDMGFSAAKTYDVEVWIPAQNTYREISSC 352

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP VL
Sbjct: 353 SNCEDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVL 412

Query: 414 RPYMNNLAVIKKE 426
           RPYM  + VIK +
Sbjct: 413 RPYMGGVEVIKAD 425


>gi|120603778|ref|YP_968178.1| seryl-tRNA synthetase [Desulfovibrio vulgaris DP4]
 gi|166221435|sp|A1VH35|SYS_DESVV RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|120564007|gb|ABM29751.1| seryl-tRNA synthetase [Desulfovibrio vulgaris DP4]
          Length = 424

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/424 (47%), Positives = 273/424 (64%), Gaps = 3/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++ +++NPE +  AL  RH +       +LD + R L+ ++E +++ RN  SA++ +
Sbjct: 1   MLDLKLLQKNPEVVAKALAMRHSDIDIATFTTLDTRRRALLTEVESLKSERNKASAEVAK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G  +   AL      + E++  L+ E   V S     +  IPN+P E VP G   N
Sbjct: 61  AKRAGEDA--SALIERLGGVSERIKALDLEAEAVKSEQNDWMLTIPNIPHESVPEGRDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G   +     REH++IG ALG +DF+RA KL+G+RF+V     A LERAL  
Sbjct: 119 DNVEVLRWGTPRAFSFTPREHWDIGVALGGLDFERAGKLAGSRFTVYWKWAARLERALAN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGRWLIPTSEVSLTNL 239
           + +D H S +GYTEV  P +V  + M GTGQ+PKF +D+F   +   +LIPT+EV LTNL
Sbjct: 179 YFLDTHISANGYTEVLPPFMVNRKTMTGTGQLPKFEEDLFRLESWDYFLIPTAEVPLTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           ++ EI+E   LPL +T   P FRSEAGS G+DTRG++RQHQF K E+V     E SF E 
Sbjct: 239 HADEILEEGDLPLGYTAQTPCFRSEAGSYGKDTRGLIRQHQFTKVEMVRFAHPERSFEEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           ERM   AE +L+ L L YRV++LC+GD+GFSA KTYDLEVWL GQ+ YREISSCS CG+F
Sbjct: 299 ERMRGHAEALLQNLGLPYRVITLCSGDMGFSATKTYDLEVWLPGQDKYREISSCSNCGDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N R+R       +F HTLNGSG+AVGR L+A+LENY   DGSV +P VLRPYM  
Sbjct: 359 QARRANIRFRPAGGGKPEFVHTLNGSGLAVGRTLVAVLENYQQEDGSVIVPEVLRPYMGG 418

Query: 420 LAVI 423
           L  I
Sbjct: 419 LERI 422


>gi|46578654|ref|YP_009462.1| seryl-tRNA synthetase [Desulfovibrio vulgaris str. Hildenborough]
 gi|67461806|sp|Q72FH6|SYS_DESVH RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|46448065|gb|AAS94721.1| seryl-tRNA synthetase [Desulfovibrio vulgaris str. Hildenborough]
 gi|311232527|gb|ADP85381.1| seryl-tRNA synthetase [Desulfovibrio vulgaris RCH1]
          Length = 424

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/424 (47%), Positives = 273/424 (64%), Gaps = 3/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++ +++NPE +  AL  RH +       +LD + R L+ ++E +++ RN  SA++ +
Sbjct: 1   MLDLKLLQKNPEVVAKALAMRHSDIDIATFTTLDTRRRALLTEVESLKSERNKASAEVAK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G  +   AL      + E++  L+ E   V S     +  IPN+P E VP G   N
Sbjct: 61  AKRAGEDA--SALIERLGGVSERIKALDLEAEAVKSEQNDWMLTIPNIPHESVPEGRDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G   +     REH++IG ALG +DF+RA KL+G+RF+V     A LERAL  
Sbjct: 119 DNVEVLRWGTPRAFSFTPREHWDIGVALGGLDFERAGKLAGSRFTVYWKWAARLERALAN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGRWLIPTSEVSLTNL 239
           + +D H S +GYTEV  P +V  + M GTGQ+PKF +D+F   +   +LIPT+EV LTNL
Sbjct: 179 YFLDTHISANGYTEVLPPFMVNRKTMTGTGQLPKFEEDLFRLESWDYFLIPTAEVPLTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           ++ EI+E   LPL +T   P FRSEAGS G+DTRG++RQHQF K E+V     E SF E 
Sbjct: 239 HADEILEEGDLPLGYTAQTPCFRSEAGSYGKDTRGLIRQHQFTKVEMVRFAHPERSFDEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           ERM   AE +L+ L L YRV++LC+GD+GFSA KTYDLEVWL GQ+ YREISSCS CG+F
Sbjct: 299 ERMRGHAEALLQNLGLPYRVITLCSGDMGFSATKTYDLEVWLPGQDKYREISSCSNCGDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N R+R       +F HTLNGSG+AVGR L+A+LENY   DGSV +P VLRPYM  
Sbjct: 359 QARRANIRFRPAGGGKPEFVHTLNGSGLAVGRTLVAVLENYQQEDGSVIVPEVLRPYMGG 418

Query: 420 LAVI 423
           L  I
Sbjct: 419 LERI 422


>gi|70731235|ref|YP_260976.1| seryl-tRNA synthetase [Pseudomonas fluorescens Pf-5]
 gi|123654458|sp|Q4K9V7|SYS_PSEF5 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|68345534|gb|AAY93140.1| seryl-tRNA synthetase [Pseudomonas fluorescens Pf-5]
          Length = 426

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/433 (46%), Positives = 282/433 (65%), Gaps = 18/433 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R N + +   L  R        I +L+E+ + +  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRSNLQDVADRLASRGFALDVARIEALEEQRKTVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A   G      ++ V+ + NE S+ K +L         + S L  ++  IPN+P E VP+
Sbjct: 61  AKQRGEDIAPLMADVERMGNELSSGKAEL-------ENIQSELDSILFGIPNLPHESVPV 113

Query: 116 GTSANENILIRSVGKKPSAIHLS-REHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           G   + N+ +R  G  P+A     ++H  +GE  G +DF+ A KLSGARF++L G +A L
Sbjct: 114 GEDEDGNVEVRRWGT-PTAFDFPIKDHVALGETHGWLDFETAAKLSGARFALLRGPIARL 172

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIP 230
            RAL QFMI+LHT EHGY E   P LV+  A+ GT Q+PKF +D+F  T +G    +LIP
Sbjct: 173 HRALAQFMINLHTGEHGYEEAYTPYLVQAPALVGTSQLPKFEEDLFKITREGEADLYLIP 232

Query: 231 TSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT 290
           T+EVSLTN+ + EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V + 
Sbjct: 233 TAEVSLTNIVAGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQVV 292

Query: 291 REEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREI 350
               S    E + + AE++L+ L L YRV++LCTGD+GFSA KTYDLEVW+  Q+ YREI
Sbjct: 293 EPSTSMEALEGLTANAEKVLQLLQLPYRVLALCTGDMGFSAVKTYDLEVWVPSQDKYREI 352

Query: 351 SSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIP 410
           SSCS CG+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P
Sbjct: 353 SSCSNCGDFQARRMQARFRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVP 412

Query: 411 TVLRPYMNNLAVI 423
            VL+PYM  L VI
Sbjct: 413 DVLKPYMGGLEVI 425


>gi|295112155|emb|CBL28905.1| seryl-tRNA synthetase [Synergistetes bacterium SGP1]
          Length = 425

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 201/427 (47%), Positives = 275/427 (64%), Gaps = 3/427 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++W+  + E ++  LK R  +   + + +LDEK R +I + ED++ARRN  S ++G 
Sbjct: 1   MLDLRWMLAHREEVESFLKNRRHDFDMDALEALDEKRRHIIMETEDLKARRNEGSRKVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G    VDAL  E   + +++  L++      S L   +  +PN   E  P+G   +
Sbjct: 61  AKKTGEN--VDALMQEIRLMGDRIKELDEGLSRTESELNDCLMRLPNRLSETTPVGEDED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N ++R+ G         + H++I EALG+MDF+R   L+ +RF+VL G  A +ERAL  
Sbjct: 119 DNPVVRTWGTPREFSFEPKPHWDIAEALGIMDFERGVLLAQSRFTVLKGMGARMERALIA 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-GRWLIPTSEVSLTNL 239
           FM+DLHT + GY EV  P +VR   + GTGQ+PKFA+D++   D   WLIPT+EV LTNL
Sbjct: 179 FMLDLHTQKQGYLEVEPPFMVRSAILEGTGQLPKFAEDLYRIADEDLWLIPTAEVPLTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +   I+E   LPL +T   P FR EAGSAGRD RGMLRQHQF K E+V +   E S+ E 
Sbjct: 239 HRESILEESDLPLYYTAYTPCFRREAGSAGRDVRGMLRQHQFDKVEMVKLCTPETSYDEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++ + AE +L+ L+L YRVVSLC+GD+GF + KTYDLEVWL  Q  YREISSCS C +F
Sbjct: 299 EKLTADAESVLQALELPYRVVSLCSGDIGFGSTKTYDLEVWLPSQKRYREISSCSNCEDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RRMN RYR  +    +F HTLNGSG+AVGR LIAI+EN+   DG+V +P  L PYMN 
Sbjct: 359 QARRMNCRYRPASGGKPRFVHTLNGSGIAVGRTLIAIIENFQREDGTVVVPRALVPYMNG 418

Query: 420 LAVIKKE 426
            + I K+
Sbjct: 419 TSAIGKD 425


>gi|91782396|ref|YP_557602.1| seryl-tRNA synthetase [Burkholderia xenovorans LB400]
 gi|123168824|sp|Q143D9|SYS_BURXL RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|91686350|gb|ABE29550.1| seryl-tRNA synthetase [Burkholderia xenovorans LB400]
          Length = 431

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/427 (47%), Positives = 274/427 (64%), Gaps = 11/427 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R    + E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDLDGVAKRLADRGYTLDVAAFTALEAERRDTQTRTEEMQARRNSLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G  +   A+  E S + +++        E+   L  L+  +PN+P E VP+G    
Sbjct: 61  LKGKGEDT--SAVMAEVSGIGDEMKASAARLDEIQKRLSDLLLGVPNLPHESVPLGKDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G         ++H ++G  LGL DF+   KLSGARF++L G +A L RAL Q
Sbjct: 119 ENVEVRRWGTPRQFEFEVKDHVDVGAPLGL-DFETGAKLSGARFTMLRGQIARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FMID HT  HGYTE+  P +V  E +YGTGQ+PKFADDMF    G       ++LI TSE
Sbjct: 178 FMIDTHTQHHGYTEIYTPYIVNPEILYGTGQLPKFADDMFRVEKGGDENTVTQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     I+E+ +LP++ T  +P FRSEAGS GRDTRG++RQHQF K E+V I   E
Sbjct: 238 ISLTNTVRDSILEADALPIKLTAHSPCFRSEAGSYGRDTRGLIRQHQFDKVEMVQIVAPE 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E+M+  AE IL++L+L YRV++LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 298 TSYDALEQMVGHAETILQKLELPYRVITLCTGDMGFSAAKTYDLEVWVPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RRM +RYR+   K  +  HTLNGSG+AVGR L+A+LEN+ NADGSVT+P  L
Sbjct: 358 SNTESFQARRMQARYRNAQGKP-ELVHTLNGSGLAVGRTLVAVLENFQNADGSVTVPVAL 416

Query: 414 RPYMNNL 420
           RPY+  L
Sbjct: 417 RPYLGGL 423


>gi|311280197|ref|YP_003942428.1| seryl-tRNA synthetase [Enterobacter cloacae SCF1]
 gi|308749392|gb|ADO49144.1| seryl-tRNA synthetase [Enterobacter cloacae SCF1]
          Length = 430

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 199/431 (46%), Positives = 274/431 (63%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVQTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P + VP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDQAKAELDVLQAEIRDIALAIPNIPDDSVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ ++  G         R+H  +GE    +DF  A KL+G+RF V+ G +AHL RAL Q
Sbjct: 119 DNVEVKRWGTPREFDFDVRDHVTLGEMHAGLDFAAAVKLTGSRFVVMKGQIAHLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T        +    LIPT+
Sbjct: 179 FMLDLHTEQHGYSETYVPYLVNHDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI++   LP++ T  +P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEILDEDDLPIKLTAHSPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M S AE++L+ L L YR V+LCTGD+GF ACKT+DLEVW+  QN YREISS
Sbjct: 299 EDSMDALEEMTSHAEKVLELLGLPYRRVALCTGDMGFGACKTFDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + IP V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIAIPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMKGLEFI 429


>gi|262283251|ref|ZP_06061018.1| seryl-tRNA synthetase [Streptococcus sp. 2_1_36FAA]
 gi|262261503|gb|EEY80202.1| seryl-tRNA synthetase [Streptococcus sp. 2_1_36FAA]
          Length = 425

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/430 (47%), Positives = 282/430 (65%), Gaps = 15/430 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IR + + +   L  R ++  +   + ++D++ R L+ K+E+++A RN+ SA+I 
Sbjct: 1   MLDLKRIRTDFDTVAEKLATRGVDAATLNQMKTIDKERRDLLVKVEELKAERNTVSAEIA 60

Query: 60  QAI-----AEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVP 114
           QA      A+  ++ +  L  E   L   L        E+ + L +  + +PN+P E VP
Sbjct: 61  QAKRNKENADDKIAAMQKLSAEVKNLDATLA-------ELDAKLTEFTTTLPNIPHESVP 113

Query: 115 IGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           +G   +EN+ +R  G        ++ H+++GE L ++D++R  K++GARF    G  A L
Sbjct: 114 VGADEDENVEVRRWGTPRQFDFEAKAHWDLGEDLDILDWERGAKVTGARFLFYKGLGARL 173

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSE 233
           ERA+  FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+E
Sbjct: 174 ERAIYNFMLDEHGKE-GYTEVITPYMVNHDSMFGTGQYPKFKEDTFELSDTNFVLIPTAE 232

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V LTN Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E
Sbjct: 233 VPLTNYYRDEILDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPE 292

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
           +S+ E E+M + AE IL++L+L YRVV+LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 293 ESYQELEKMTANAENILQKLNLPYRVVALCTGDMGFSAAKTYDLEVWIPAQNTYREISSC 352

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP VL
Sbjct: 353 SNTEDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVL 412

Query: 414 RPYMNNLAVI 423
           RPYM  L VI
Sbjct: 413 RPYMGGLEVI 422


>gi|159044412|ref|YP_001533206.1| seryl-tRNA synthetase [Dinoroseobacter shibae DFL 12]
 gi|157912172|gb|ABV93605.1| seryl-tRNA synthetase [Dinoroseobacter shibae DFL 12]
          Length = 431

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 205/420 (48%), Positives = 273/420 (65%), Gaps = 1/420 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKR-HLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           M DI+ IR+ PE  D AL +R  + P S  IL+LD   R  I   E  +A +N+ S Q+G
Sbjct: 1   MHDIRLIRETPEAFDAALTRRPGVAPVSGEILALDAARREKILAAETAQAEQNAASKQVG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
            A A G+ +  + L+      K ++  L+    E  ++L   +  IPN+P ++ P G   
Sbjct: 61  AAKAAGDEAEFERLRALVGAKKAEVAALKAAAAEDDAALSARLMEIPNLPFDDTPEGADE 120

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            +N+ I+  G         +EH+ +   +  MDF+ A KLSG+RF VL+G +A + RAL 
Sbjct: 121 ADNVEIKRWGTPRDLGFAPKEHYALPSVVPGMDFEAAAKLSGSRFVVLSGAVARVHRALA 180

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNL 239
           QFM+D H  ++G TE   P+LVR+E M GTGQ+PKF +D + T +G WL+PT+EVSLTNL
Sbjct: 181 QFMVDTHVEQNGLTETWTPVLVREEMMLGTGQLPKFGEDSYQTREGWWLVPTAEVSLTNL 240

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
            + EI+E+ SLP R+      FRSEAGSAGRDT GMLRQHQF K E+VS+TR EDS  E 
Sbjct: 241 VAGEIVEAASLPRRYVAHTQCFRSEAGSAGRDTAGMLRQHQFEKVEMVSVTRPEDSRAEL 300

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           +RM  CAE IL+ L L YR + LCTGD+GF A +T+D+EVWL GQ+ YREISS S CG+F
Sbjct: 301 DRMTGCAEGILEALGLPYRTIVLCTGDMGFGARRTHDIEVWLPGQDAYREISSVSVCGDF 360

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RRMN+R+R       +F HTLNGSG+AVGRCLIA+LEN   ADGSV +P VL  Y+  
Sbjct: 361 QARRMNARFRPEGGGKPEFVHTLNGSGLAVGRCLIAVLENGQQADGSVVLPEVLHGYLRG 420


>gi|218548415|ref|YP_002382206.1| seryl-tRNA synthetase [Escherichia fergusonii ATCC 35469]
 gi|226701416|sp|B7LN61|SYS_ESCF3 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|218355956|emb|CAQ88572.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia fergusonii ATCC 35469]
 gi|324113810|gb|EGC07785.1| seryl-tRNA synthetase [Escherichia fergusonii B253]
 gi|325496838|gb|EGC94697.1| seryl-tRNA synthetase [Escherichia fergusonii ECD227]
          Length = 430

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/431 (46%), Positives = 271/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T        T    LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|296840775|ref|ZP_06863421.2| serine--tRNA ligase [Neisseria polysaccharea ATCC 43768]
 gi|296839997|gb|EFH23935.1| serine--tRNA ligase [Neisseria polysaccharea ATCC 43768]
          Length = 441

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 201/431 (46%), Positives = 275/431 (63%), Gaps = 9/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L +R  +  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 11  MLDIQLLRSNTAAVAERLARRGYDFDTARFDALEERRKSVQVKTEELQASRNSISKQIGA 70

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +       A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 71  LKGQSKHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPAGKDET 130

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 131 ENVEVRKVGTPRKFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMRGQIARLHRALAQ 189

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 190 FMLDTHTLKHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDESKTTQYLIPTAE 249

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  I++   LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 250 VTLTNTVADSILDEGGLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 309

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 310 KSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGAAKTYDLEVWVPAQNTYREISSC 369

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 370 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 428

Query: 414 RPYMNNLAVIK 424
           +PYM  +A ++
Sbjct: 429 QPYMGGVAKLE 439


>gi|168490677|ref|ZP_02714820.1| seryl-tRNA synthetase [Streptococcus pneumoniae CDC0288-04]
 gi|183575046|gb|EDT95574.1| seryl-tRNA synthetase [Streptococcus pneumoniae CDC0288-04]
          Length = 424

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 205/428 (47%), Positives = 280/428 (65%), Gaps = 9/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IR + E +   L  R +E      +  +D K R ++ K+E ++A RN+ SA+I 
Sbjct: 1   MLDIKRIRTDFEAVAEKLATRGVEAAVLNEMKEIDAKRRNILVKVETLKAERNTVSAEIA 60

Query: 60  QAI--AEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGT 117
           QA    E     + A++N    L  ++  L+ E  E+ + L +  + +PN+P + VP+GT
Sbjct: 61  QAKRNKENTDDKIAAMQN----LSAEVKALDAELAEIDAKLTEFTTTLPNIPADSVPVGT 116

Query: 118 SANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
             ++N+ +R  G         + H+++GE LG++D++R  K++GARF    G  A LERA
Sbjct: 117 DEDDNVEVRRWGTPREFDFEPKAHWDLGEDLGILDWERGGKVTGARFLFYKGLGARLERA 176

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSL 236
           +  FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+EV L
Sbjct: 177 IYNFMLDEHGKE-GYTEVITPYIVNHDSMFGTGQYPKFKEDTFELSDTNFVLIPTAEVPL 235

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E+S+
Sbjct: 236 TNYYRDEILDGKDLPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESY 295

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            E E+M + AE IL++L+L YRVV+L TGD+GFSA KTYDLEVW+  QN YREISSCS  
Sbjct: 296 EELEKMTANAENILQKLNLPYRVVALSTGDMGFSAAKTYDLEVWIPAQNNYREISSCSNT 355

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
            +FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP  LRPY
Sbjct: 356 EDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEALRPY 415

Query: 417 MNNLAVIK 424
           M    VIK
Sbjct: 416 MGGAEVIK 423


>gi|328944998|gb|EGG39155.1| serine--tRNA ligase [Streptococcus sanguinis SK1087]
          Length = 425

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/430 (46%), Positives = 282/430 (65%), Gaps = 15/430 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IR + + +   L  R ++  +   + ++D++ R L+ K+E+++A RN+ SA+I 
Sbjct: 1   MLDLKRIRTDFDSVAKKLATRGVDAATLNQMKTIDKERRDLLVKVEELKAERNTVSAEIA 60

Query: 60  QAI-----AEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVP 114
           QA      A+  ++ +  L  E   L   L        E+ + L +  + +PN+P E VP
Sbjct: 61  QAKRNKENADDKIAAMQKLSAEVKNLDATLA-------ELDAKLTEFTTTLPNIPHESVP 113

Query: 115 IGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           +G   +EN+ +R  G        ++ H+++GE L ++D++R  K++GARF    G  A L
Sbjct: 114 VGADEDENVEVRRWGTPRQFDFEAKAHWDLGEDLDILDWERGAKVTGARFLFYKGLGARL 173

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSE 233
           ERA+  FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+E
Sbjct: 174 ERAIYNFMLDEHGKE-GYTEVITPYMVNHDSMFGTGQYPKFKEDTFELSDTNFVLIPTAE 232

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V LTN Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E
Sbjct: 233 VPLTNYYRDEILDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPE 292

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
           +S+ E E+M + AE IL++L+L YRVV+LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 293 ESYEELEKMTANAENILQKLNLPYRVVALCTGDMGFSAAKTYDLEVWIPAQNTYREISSC 352

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP VL
Sbjct: 353 SNTEDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVL 412

Query: 414 RPYMNNLAVI 423
           RPYM  L +I
Sbjct: 413 RPYMGGLEII 422


>gi|320106187|ref|YP_004181777.1| seryl-tRNA synthetase [Terriglobus saanensis SP1PR4]
 gi|319924708|gb|ADV81783.1| seryl-tRNA synthetase [Terriglobus saanensis SP1PR4]
          Length = 440

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 205/440 (46%), Positives = 284/440 (64%), Gaps = 16/440 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEY--ILSLDEKNRILIKKIEDIRARRNSNSAQI 58
           MLD+ ++R N   ++  L+ R+++P +      S+D + R  I ++E ++A+RN  + ++
Sbjct: 1   MLDLAYVRANLAAVEEKLRSRNMDPAAVLGDFASIDTERREAITRLESLKAQRNRIAEEV 60

Query: 59  GQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTS 118
           G+    G  +   AL ++T  LK++   LE    +    L+ ++  IPN+P + VPIG  
Sbjct: 61  GKKKRAGEDAT--ALMDQTRALKDEAESLEAAAAQADLRLQTILHAIPNLPHDSVPIGKD 118

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
            ++NI+ +S G  P+     + H+EIGEALG++DF+RA K+SG+RF V  G  A LERAL
Sbjct: 119 EHDNIVEKSWGAIPTFDFAPKSHWEIGEALGILDFNRAAKISGSRFVVHFGAGARLERAL 178

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD------------GR 226
             FM+DLHT  HGYTEV  P +V  +++YGTGQ+PKFA+D+F + D              
Sbjct: 179 ANFMLDLHTRLHGYTEVLPPFMVNSKSLYGTGQLPKFAEDLFHSDDKGSYVPGELQDNDH 238

Query: 227 WLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCEL 286
           WLIPT+EV +TNL   E I+   LP+ +    P FRSEAGS G+D RGM+RQHQF K EL
Sbjct: 239 WLIPTAEVPVTNLLRDETIDEVKLPISYCAWTPCFRSEAGSYGKDVRGMIRQHQFQKVEL 298

Query: 287 VSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNL 346
           V      DS  EHE++   AE +L+ L L YR + LCTGD+GFS+ KTYDLEVWL GQNL
Sbjct: 299 VKFATPADSEFEHEKLTRHAETVLELLKLPYRRMLLCTGDMGFSSAKTYDLEVWLPGQNL 358

Query: 347 YREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGS 406
           YREISSCS   +FQ+RR N R+R P +K  ++ HT+NGSG+AVGR  +A+LENY  ADG+
Sbjct: 359 YREISSCSNFLDFQARRANIRFRSPAAKKSEYLHTINGSGLAVGRTYLAVLENYQQADGT 418

Query: 407 VTIPTVLRPYMNNLAVIKKE 426
           V IP VL PYM+   VI  E
Sbjct: 419 VRIPEVLVPYMHGDTVITPE 438


>gi|256830391|ref|YP_003159119.1| seryl-tRNA synthetase [Desulfomicrobium baculatum DSM 4028]
 gi|256579567|gb|ACU90703.1| seryl-tRNA synthetase [Desulfomicrobium baculatum DSM 4028]
          Length = 427

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 197/425 (46%), Positives = 279/425 (65%), Gaps = 3/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI++IR NP+ +   L+KR  +   E  L++D+K R L+ ++ED++ARRN  S ++ +
Sbjct: 1   MLDIKFIRSNPDEVKDGLRKRRSKLDLEQFLAIDQKRRDLLLEVEDLKARRNQASGEMAR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G  +  DAL  E   +  ++  L++E  ++       +  IPNVP   VP G    
Sbjct: 61  MKKAGENA--DALLLELGGMSTRIKALDEELKDIDQQTADWVMSIPNVPHSSVPEGVDEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N  +RS G+KP+     +EH+E+G AL  +DF+ A K++G+RF +L G  A +ERAL  
Sbjct: 119 DNREVRSWGEKPAMPFSPKEHWELGTALNGLDFETAAKITGSRFVILKGWAAKMERALIS 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGRWLIPTSEVSLTNL 239
           FM+D+ T ++GY EV  P++V  E++ GTGQ+PKF +D+F       +LIPT+EV +TN+
Sbjct: 179 FMLDVQTMQNGYDEVMPPVIVNRESLMGTGQLPKFEEDLFHLENTNYYLIPTAEVPVTNI 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y    +   +LP+        FRSEAGS G+DT+GM+RQHQF K ELV     + S+ E 
Sbjct: 239 YRDTTLAQSALPIAHCAYTACFRSEAGSYGKDTKGMIRQHQFDKVELVRFVHPDTSYDEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++L  AE IL++L LHYRVV+LC GDLGFS+ KTYD+EVWL GQ+ YREISSCS   +F
Sbjct: 299 EKLLGHAESILQKLGLHYRVVTLCAGDLGFSSAKTYDIEVWLPGQDKYREISSCSNFEDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR   R++  +SK  +  HTLNGSG+AVGR ++AILENY  ADGSV +P VLRPYMN 
Sbjct: 359 QARRAGIRFKPTDSKKSRLVHTLNGSGLAVGRTMVAILENYQQADGSVIVPEVLRPYMNG 418

Query: 420 LAVIK 424
           L  I+
Sbjct: 419 LDKIE 423


>gi|298369230|ref|ZP_06980548.1| serine--tRNA ligase [Neisseria sp. oral taxon 014 str. F0314]
 gi|298283233|gb|EFI24720.1| serine--tRNA ligase [Neisseria sp. oral taxon 014 str. F0314]
          Length = 431

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/428 (46%), Positives = 272/428 (63%), Gaps = 9/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R +   +   L +R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQQLRSHTAAVAERLAQRGYEFDTARFNALEEQRKAVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPAGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMKGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTLKHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDESKKTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  I+    LPL+ T  +P FRSEAG+ G+D RG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIVAGSDLPLKLTAHSPCFRSEAGAYGKDVRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLA 421
           +PYM  +A
Sbjct: 419 QPYMGGVA 426


>gi|254420826|ref|ZP_05034550.1| seryl-tRNA synthetase [Brevundimonas sp. BAL3]
 gi|196187003|gb|EDX81979.1| seryl-tRNA synthetase [Brevundimonas sp. BAL3]
          Length = 482

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 214/478 (44%), Positives = 285/478 (59%), Gaps = 59/478 (12%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEY---ILSLDEKNRILIKKIEDIRARRNSNSAQ 57
           M DI+ IR+NP+        R ++        IL LD + R      +D  A+RN+ S  
Sbjct: 1   MHDIRAIRENPQVYVAGWSSRGVDEADGLVADILRLDAELRHAQTTGQDALAKRNAASKL 60

Query: 58  IGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGT 117
           IG A+ + +++  D LK E   LK  +    + E  V   L+ L++   N+  E+VP G 
Sbjct: 61  IGAAMGKKDMAEADRLKAEVEALKGDIAAAAEVEARVGKELRDLLAAQKNLAAEDVPDGE 120

Query: 118 SANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
               N+ +   G  P     +++H ++GEALG++DF+ A ++SGARF+VL G LA LERA
Sbjct: 121 DEAGNLEVSRWGT-PREGGPAKDHADLGEALGMLDFEAAARMSGARFAVLKGQLARLERA 179

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT-------------- 223
           +GQFM+DL T +HGY EV+ PLLVRDEAM+GTGQ+PKF +D+F  +              
Sbjct: 180 VGQFMLDLQTDQHGYLEVNPPLLVRDEAMFGTGQLPKFEEDLFKASHVDFDDYQIAHMNL 239

Query: 224 -------------DG--------------------------RWLIPTSEVSLTNLYSHEI 244
                        DG                           +LIPT+EVSLTNL    I
Sbjct: 240 INTAWLESSWEFSDGWTNPPEDLVKRLGEVAGEAWRAVETRHFLIPTAEVSLTNLIRETI 299

Query: 245 IESKSL--PLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERM 302
           +    L  P+R T L P FR+EAGSAGRDTRG++RQHQF K E+VSI R EDS  EHERM
Sbjct: 300 LSEDDLATPMRMTALTPCFRAEAGSAGRDTRGLIRQHQFSKVEMVSIARPEDSDAEHERM 359

Query: 303 LSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSR 362
            +CAE +LK L+L +R + LC GD+GFSA KT+DLEVWL  QN YREISSCS CG+FQ+R
Sbjct: 360 TACAEAVLKALELPFRRMLLCKGDMGFSAQKTFDLEVWLPSQNTYREISSCSNCGDFQAR 419

Query: 363 RMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           RM++R++    K  +F HTLNGSG+AVGR L+AI+ENY   DG + +P VL+PYM  L
Sbjct: 420 RMDARFKRAGEKKTEFVHTLNGSGLAVGRTLVAIMENYQQEDGRIAVPKVLQPYMGGL 477


>gi|297616225|ref|YP_003701384.1| seryl-tRNA synthetase [Syntrophothermus lipocalidus DSM 12680]
 gi|297144062|gb|ADI00819.1| seryl-tRNA synthetase [Syntrophothermus lipocalidus DSM 12680]
          Length = 423

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/427 (47%), Positives = 283/427 (66%), Gaps = 7/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R NPE ++ AL  R ++   +  L LD++ R    + ++++  RN  S ++G+
Sbjct: 1   MLDPRLVRANPEMVEKALSARGIQGGLDQFLKLDKERRACQVRADELKNFRNQASVEVGR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG  +  + L+     + +++  L+    E+   L +++  IPN+P E VP+G    
Sbjct: 61  LKKEGKDT--NELQARIREVGQEIKGLDDRMREIDEQLTEILLNIPNLPHESVPLGAGDA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G+        + H++IG AL ++DF+RA KLSGARF+V  G  A LERAL  
Sbjct: 119 DNVEVRRWGEPRKFDFEPQAHWDIGVALDILDFERAAKLSGARFTVYKGLGARLERALIS 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGR--WLIPTSEVSLTN 238
           FM+DLH  +HGY EV  P +V  + M GTGQ+PKFA+DMF   +GR  +++PT+EV LTN
Sbjct: 179 FMLDLHVDKHGYREVFPPFMVTADCMVGTGQLPKFAEDMF-KVEGRELYMVPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           LY  EI+ ++ LP+  T     FR+EAGS GRDTRG++RQHQF K ELV IT  E S+ E
Sbjct: 238 LYREEILAAEQLPMYLTAYTACFRAEAGSHGRDTRGIIRQHQFNKVELVKITSPETSYEE 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++   AEE+L+ L L YRV+ LCTGD+GFS+ KTYDLEVWL     Y+EISSCS CG+
Sbjct: 298 LEKLTRDAEEVLQLLGLPYRVMLLCTGDMGFSSAKTYDLEVWLPSYGEYKEISSCSNCGD 357

Query: 359 FQSRRMNSRYR-DPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           FQ+RR N RYR +PN++  +F HTLNGSGVAVGR + AILENY  AD SV +P +LRPYM
Sbjct: 358 FQARRANIRYRPEPNARP-QFVHTLNGSGVAVGRTVAAILENYQQADSSVVVPEILRPYM 416

Query: 418 NNLAVIK 424
             +AVI+
Sbjct: 417 GGIAVIR 423


>gi|260914213|ref|ZP_05920686.1| serine-tRNA ligase [Pasteurella dagmatis ATCC 43325]
 gi|260631846|gb|EEX50024.1| serine-tRNA ligase [Pasteurella dagmatis ATCC 43325]
          Length = 429

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 210/436 (48%), Positives = 275/436 (63%), Gaps = 18/436 (4%)

Query: 1   MLDIQWIRQNPEHLDIALK-KRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           M+D   +R N   +   LK KR+ +     +  L+E+ + L  K E ++A RN+ S  IG
Sbjct: 1   MIDPNILRSNLVEVAEKLKVKRNFDLDVALLSELEEQRKSLQVKTETLQAERNARSKNIG 60

Query: 60  QAIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVP 114
           +A A G      L+ VD +  E ST K +L        +V + + ++   IPN+P +EVP
Sbjct: 61  KAKASGEDISSLLAEVDDMGIELSTTKAKL-------DDVLAEINQIALSIPNLPADEVP 113

Query: 115 IGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           +G   +EN+ +   G         ++H  +GE L  +DF    KLSG+RF+V+ G +A L
Sbjct: 114 LGKDDSENLEVSRWGTPKKFDFEVKDHVTLGENLQGLDFSAGAKLSGSRFAVMKGQIAKL 173

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT--DGRW---LI 229
            RAL QFM+DLHT EHGYTE   P LV    +YGTGQ+PKF +D+F T   +G     LI
Sbjct: 174 HRALSQFMLDLHTQEHGYTEAYVPYLVNHATLYGTGQLPKFGEDLFHTNALEGEQPYALI 233

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV +TNL   EI++   LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I
Sbjct: 234 PTAEVPVTNLVRDEILDESELPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQI 293

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
              E S    E +   AE++L+ L+L YR V LCTGD+GF +CKTYDLEVWL  QN YRE
Sbjct: 294 VAPETSMEALEELTGQAEKVLQLLELPYRKVLLCTGDMGFGSCKTYDLEVWLPAQNTYRE 353

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS   +FQ+RRM +RYR+   K  +  HTLNGSG+AVGR L+A+LENY NADGSVT+
Sbjct: 354 ISSCSNMWDFQARRMQARYRNKGDKKPRLVHTLNGSGLAVGRTLVAVLENYQNADGSVTV 413

Query: 410 PTVLRPYMNNLAVIKK 425
           PTVLRPYMN + VI K
Sbjct: 414 PTVLRPYMNGIEVIGK 429


>gi|125718717|ref|YP_001035850.1| seryl-tRNA synthetase [Streptococcus sanguinis SK36]
 gi|166223300|sp|A3CQ45|SYS_STRSV RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|125498634|gb|ABN45300.1| Seryl-tRNA synthetase, putative [Streptococcus sanguinis SK36]
          Length = 425

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/425 (47%), Positives = 281/425 (66%), Gaps = 5/425 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IR + + +   L  R ++  +   + ++D++ R L+ K+E+++A RN+ SA+I 
Sbjct: 1   MLDLKRIRTDFDSVAEKLATRGVDAATLSQMKTIDKERRDLLVKVEELKAERNTVSAEIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA  + N    D        L  ++  L+    E+ + L +  + +PN+P + VP+G   
Sbjct: 61  QA--KRNKENTDDKIAAMQKLSAEVKNLDASLAELDAKLTEFTTTLPNIPHDSVPVGADE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           NEN+ +R  G        ++ H+++GE L ++D++R  K++GARF    G  A LERA+ 
Sbjct: 119 NENVEVRRWGTPHQFDFEAKAHWDLGEDLDILDWERGAKVTGARFLFYKGLGARLERAIY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLTN 238
            FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+EV LTN
Sbjct: 179 NFMLDEHGKE-GYTEVITPYMVNHDSMFGTGQYPKFKEDTFELSDTNFVLIPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E+S+ E
Sbjct: 238 YYRDEILDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESYEE 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M + AE IL++L+L YRVV+LCTGD+GFSA KTYDLEVW+  QN YREISSCS   +
Sbjct: 298 LEKMTANAENILQKLNLPYRVVALCTGDMGFSAAKTYDLEVWIPAQNTYREISSCSNTED 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP VLRPYM 
Sbjct: 358 FQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVLRPYMG 417

Query: 419 NLAVI 423
            L VI
Sbjct: 418 GLEVI 422


>gi|333008793|gb|EGK28253.1| seryl-tRNA synthetase [Shigella flexneri K-272]
 gi|333020323|gb|EGK39589.1| seryl-tRNA synthetase [Shigella flexneri K-227]
          Length = 430

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/431 (46%), Positives = 271/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T        T    LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLAEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|170691961|ref|ZP_02883125.1| seryl-tRNA synthetase [Burkholderia graminis C4D1M]
 gi|170143245|gb|EDT11409.1| seryl-tRNA synthetase [Burkholderia graminis C4D1M]
          Length = 431

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 201/427 (47%), Positives = 273/427 (63%), Gaps = 11/427 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R    + E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDLDGVAKRLADRGYSLDVAAFTALEAERRDTQTRTEEMQARRNSLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G  +   A+  E   + +++     +  ++   L  L+  +PN+P E VP+G    
Sbjct: 61  MKGRGEDT--SAVMAEVGGIGDEMKASAAKLDDIQKRLSDLLLGVPNLPHESVPVGRDEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G         ++H ++G  LGL DF+   KLSGARF++L G +A L RAL Q
Sbjct: 119 DNVEVRRWGTPRQFDFEVKDHVDVGAPLGL-DFETGAKLSGARFTMLRGQIARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FMID HT +HGYTE+  P +V  E +YGTGQ+PKFADDMF    G       ++LI TSE
Sbjct: 178 FMIDTHTQQHGYTEIYTPYIVNPEILYGTGQLPKFADDMFRVEKGGGENTVTQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     I+E  +LP++ T  +P FRSEAGS GRDTRGM+RQHQF K E+V I   E
Sbjct: 238 ISLTNTVRDSIVEGNALPIKLTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQIVAPE 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E+M+  AE IL++L+L YRV++LCTGD+GFSA KTYDLEVWL  QN YREISSC
Sbjct: 298 TSYDALEQMVGHAETILQKLELPYRVITLCTGDMGFSATKTYDLEVWLPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RRM +RYR+   K  +  HTLNGSG+AVGR L+A+LEN+ NADGSVT+P  L
Sbjct: 358 SNTESFQARRMQARYRNAQGKP-ELVHTLNGSGLAVGRTLVAVLENFQNADGSVTVPAAL 416

Query: 414 RPYMNNL 420
           RPY+  +
Sbjct: 417 RPYLGGV 423


>gi|28199204|ref|NP_779518.1| seryl-tRNA synthetase [Xylella fastidiosa Temecula1]
 gi|182681934|ref|YP_001830094.1| seryl-tRNA synthetase [Xylella fastidiosa M23]
 gi|32130164|sp|Q87BX8|SYS_XYLFT RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|238691047|sp|B2I631|SYS_XYLF2 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|28057310|gb|AAO29167.1| seryl-tRNA synthetase [Xylella fastidiosa Temecula1]
 gi|182632044|gb|ACB92820.1| seryl-tRNA synthetase [Xylella fastidiosa M23]
 gi|307578190|gb|ADN62159.1| seryl-tRNA synthetase [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 426

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/392 (51%), Positives = 269/392 (68%), Gaps = 6/392 (1%)

Query: 35  EKNRILIKKIEDIRARRNSNSAQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEV 94
           E+ RI +   +++++ RNS S  IGQA ++G    V AL  E +   + L   E    E+
Sbjct: 37  ERKRIQVH-TQELQSLRNSKSKAIGQARSKGED--VSALMAEVAAFSDDLKASEIALEEI 93

Query: 95  CSSLKKLISCIPNVPLEEVPIGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFD 154
            + L+K+   IPN+P ++VP+G    +N+     G   +     ++H E+G   G +D +
Sbjct: 94  RTELEKVALDIPNLPQQDVPLGADERDNVEQARWGVPRTFDFAIKDHVELGACHGWLDAE 153

Query: 155 RATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPK 214
            A KLSGARF+VL G +A L RAL Q M+DLH S+HGY EV+ P++V  ++++GTGQ+PK
Sbjct: 154 SAAKLSGARFTVLRGPIARLHRALAQCMLDLHVSQHGYEEVNVPIIVNADSLHGTGQLPK 213

Query: 215 FADDMFCTTDG---RWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRD 271
           F +DMF T  G   R+LI TSE+SLTNL  +EIIE+  LPLR    +  FRSEAGS GRD
Sbjct: 214 FEEDMFSTQLGEHRRYLISTSEISLTNLVRNEIIEADRLPLRMVAHSLCFRSEAGSGGRD 273

Query: 272 TRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSA 331
           TRGM+RQHQF K ELVS+ + +DS  EH RM  CAE +L+ L L YR + LCTGD+GF+A
Sbjct: 274 TRGMIRQHQFEKVELVSVCKPQDSEGEHHRMTRCAETVLEMLGLPYRKILLCTGDMGFAA 333

Query: 332 CKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGR 391
            KTYDLEVWL  Q +YREISSCS CG+FQ+RRM +R+R+  +   +  HTLNGSGVAVGR
Sbjct: 334 TKTYDLEVWLPSQGMYREISSCSNCGDFQARRMQARWRNSVTGKPELVHTLNGSGVAVGR 393

Query: 392 CLIAILENYLNADGSVTIPTVLRPYMNNLAVI 423
            +IA++ENY NADGS+T+P VLRPYM+ L+ I
Sbjct: 394 AMIAVMENYQNADGSITVPEVLRPYMDGLSRI 425


>gi|161544988|ref|YP_153958.2| seryl-tRNA synthetase [Anaplasma marginale str. St. Maries]
 gi|146345524|sp|Q5PAH7|SYS_ANAMM RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
          Length = 429

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 209/436 (47%), Positives = 277/436 (63%), Gaps = 15/436 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ I+++PE  D A+  R    Q+E I+ LD K R  +  +  +R +RN+ + ++  
Sbjct: 1   MHDIELIKKDPELFDRAMISRGFGEQAEKIIELDLKKRGELSTLYSLREQRNAVTREVAL 60

Query: 61  AIAEG-----NLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
               G      +     L  E +TL+  +    KE+    + L  L+  +PNVP   VP+
Sbjct: 61  LKRSGIECTPQIEASKKLAEEIATLEHSI----KED----TKLSNLLESLPNVPDPIVPV 112

Query: 116 GTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLE 175
           G   + N+ +RS G++       R H+E+GE L L+DF RA  LSGARFS+L G LA LE
Sbjct: 113 GKDESHNVEVRSHGQRRDFAFGIRPHYELGEMLNLLDFKRAAVLSGARFSILKGQLAELE 172

Query: 176 RALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVS 235
           RAL  FM+D+HT E GYTE+S P+LV +  MY  GQ+PKF DD F TT+   L PTSEV+
Sbjct: 173 RALASFMLDMHTKEFGYTEISHPVLVNERTMYNVGQLPKFHDDSFRTTNNFRLAPTSEVA 232

Query: 236 LTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDS 295
           L NL S   +   SLP+RFT  +  FR+EAGSAG DTRGM+RQHQF K ELVSIT  + S
Sbjct: 233 LANLVSGTTLPRDSLPMRFTAYSQCFRAEAGSAGLDTRGMMRQHQFGKVELVSITTSDAS 292

Query: 296 FTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCST 355
             E ERM S AEE+LKRL+L YRV+ LC+GD+GFSA  +YDLEVW+  Q+ YREISSCS 
Sbjct: 293 NAELERMTSIAEEVLKRLELPYRVMLLCSGDMGFSASISYDLEVWMPAQDKYREISSCSN 352

Query: 356 CGNFQSRRMNSRY--RDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           C +FQ+RRM ++Y   +   K     HTLNGS +A+GR + AI+ENY N DGS+TIP VL
Sbjct: 353 CRDFQARRMGAKYFFFENKKKHSTLVHTLNGSALAIGRTIAAIMENYQNEDGSITIPDVL 412

Query: 414 RPYMNNLAVIKKEHIL 429
           R Y    A+++ E  L
Sbjct: 413 RKYTGASAIMRAEDAL 428


>gi|327472776|gb|EGF18203.1| serine--tRNA ligase [Streptococcus sanguinis SK408]
          Length = 425

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 204/430 (47%), Positives = 279/430 (64%), Gaps = 15/430 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IR + + +   L  R ++  +   + S+D++ R L+ K+E+++A RN+ SA+I 
Sbjct: 1   MLDLKRIRTDFDSVAKKLATRGVDAATLNQMKSIDKERRDLLVKVEELKAERNTVSAEIA 60

Query: 60  QAI-----AEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVP 114
           QA      A+  +  +  L  E   L   L        E+ + L +  + +PN+P E VP
Sbjct: 61  QAKRNKENADDKIVAMQKLSAEVKNLDATLA-------ELDAKLTEFTTTLPNIPHESVP 113

Query: 115 IGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           +G    EN+ +R  G        ++ H+++GE L ++D++R  K++GARF    G  A L
Sbjct: 114 VGADEEENVEVRRWGTPRQFDFEAKAHWDLGEDLDILDWERGAKVTGARFLFYKGLGARL 173

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSE 233
           ERA+  FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F   D  + LIPT+E
Sbjct: 174 ERAIYNFMLDEHGKE-GYTEVITPYMVNHDSMFGTGQYPKFKEDTFELADTNFVLIPTAE 232

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V LTN Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E
Sbjct: 233 VPLTNYYRDEILDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPE 292

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
           +S+ E E+M + AE IL++L+L YRVV+LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 293 ESYEELEKMTANAENILQKLNLPYRVVALCTGDMGFSAAKTYDLEVWIPAQNTYREISSC 352

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP VL
Sbjct: 353 SNTEDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNKDGSVTIPEVL 412

Query: 414 RPYMNNLAVI 423
           RPYM  L VI
Sbjct: 413 RPYMGGLEVI 422


>gi|193070743|ref|ZP_03051678.1| seryl-tRNA synthetase [Escherichia coli E110019]
 gi|192955936|gb|EDV86404.1| seryl-tRNA synthetase [Escherichia coli E110019]
          Length = 430

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/431 (46%), Positives = 271/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDALQTEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T        T    LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|332357990|gb|EGJ35823.1| serine--tRNA ligase [Streptococcus sanguinis SK1056]
          Length = 425

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 204/430 (47%), Positives = 281/430 (65%), Gaps = 15/430 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IR + + +   L  R ++  +   + ++D++ R L+ K+E+++A RN+ SA+I 
Sbjct: 1   MLDLKRIRTDFDTVAEKLATRGVDTATLNQMKTIDKERRDLLVKVEELKAERNTVSAEIA 60

Query: 60  QAI-----AEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVP 114
           QA      A+  ++ +  L  E   L   L        E+ + L +  + +PN+P E VP
Sbjct: 61  QAKRNKENADDKIAAMQKLSAEVKNLDATLA-------ELDTKLTEFTTTLPNIPHESVP 113

Query: 115 IGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           +G   +ENI +R  G        ++ H+++GE L ++D++R  K++GARF    G  A L
Sbjct: 114 VGADEDENIEVRRWGTPRQFDFEAKAHWDLGEDLDILDWERGAKVTGARFLFYKGLGARL 173

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSE 233
           ERA+  FM+D H  E GYTEV  P +V   +M+GTGQ PKF +D F  +D  + LIPT+E
Sbjct: 174 ERAIYNFMLDEHGKE-GYTEVITPYMVNHNSMFGTGQYPKFKEDTFELSDTNFVLIPTAE 232

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V LTN Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E
Sbjct: 233 VPLTNYYRDEILDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPE 292

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
           +S+ E E+M + AE IL++L+L YRVV+LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 293 ESYEELEKMTANAENILQKLNLPYRVVALCTGDMGFSAAKTYDLEVWIPAQNTYREISSC 352

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP VL
Sbjct: 353 SNTEDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVL 412

Query: 414 RPYMNNLAVI 423
           RPYM  L VI
Sbjct: 413 RPYMGGLEVI 422


>gi|306828941|ref|ZP_07462133.1| serine--tRNA ligase [Streptococcus mitis ATCC 6249]
 gi|304429119|gb|EFM32207.1| serine--tRNA ligase [Streptococcus mitis ATCC 6249]
          Length = 424

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/426 (47%), Positives = 277/426 (65%), Gaps = 5/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IR + + +   L  R ++      +  +D K R ++ K+E ++A RN+ SA+I 
Sbjct: 1   MLDIKRIRTDFDAVAEKLATRGVDAAVLNEMKEIDAKRRDILVKVETLKAERNTVSAEIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA  + N    D       TL  ++  L+ E  ++ + L +  + +PN+P + VPIG   
Sbjct: 61  QA--KRNKENADDKIAAMQTLSAEVKALDAELADIDAKLTEFTTTLPNIPADSVPIGADE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+ +R  G         + H+++GE LG++D++R  K++GARF    G  A LERA+ 
Sbjct: 119 DDNVEVRRWGTPREFDFEPKAHWDLGEDLGILDWERGGKVTGARFLFYKGLGARLERAIY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLTN 238
            FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F   D  + LIPT+EV LTN
Sbjct: 179 NFMLDEHGKE-GYTEVITPYIVNHDSMFGTGQYPKFKEDTFELKDTNYVLIPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E+S+ E
Sbjct: 238 YYRDEILDGKDLPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESYEE 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M + AE IL++L+L YRVV+L TGD+GFSA KTYDLEVW+  QN YREISSCS   +
Sbjct: 298 LEKMTANAENILQKLNLPYRVVALSTGDMGFSAAKTYDLEVWIPAQNTYREISSCSNTED 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY NADGSVTIP  LRPYM 
Sbjct: 358 FQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNADGSVTIPEALRPYMG 417

Query: 419 NLAVIK 424
              VIK
Sbjct: 418 GAEVIK 423


>gi|15830232|ref|NP_309005.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. Sakai]
 gi|16128860|ref|NP_415413.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli str. K-12 substr. MG1655]
 gi|24112268|ref|NP_706778.1| seryl-tRNA synthetase [Shigella flexneri 2a str. 301]
 gi|26246919|ref|NP_752959.1| seryl-tRNA synthetase [Escherichia coli CFT073]
 gi|30062380|ref|NP_836551.1| seryl-tRNA synthetase [Shigella flexneri 2a str. 2457T]
 gi|74311451|ref|YP_309870.1| seryl-tRNA synthetase [Shigella sonnei Ss046]
 gi|82543379|ref|YP_407326.1| seryl-tRNA synthetase [Shigella boydii Sb227]
 gi|89107743|ref|AP_001523.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli str. K-12 substr. W3110]
 gi|91209938|ref|YP_539924.1| seryl-tRNA synthetase [Escherichia coli UTI89]
 gi|110641093|ref|YP_668823.1| seryl-tRNA synthetase [Escherichia coli 536]
 gi|110804894|ref|YP_688414.1| seryl-tRNA synthetase [Shigella flexneri 5 str. 8401]
 gi|117623077|ref|YP_851990.1| seryl-tRNA synthetase [Escherichia coli APEC O1]
 gi|157157556|ref|YP_001462091.1| seryl-tRNA synthetase [Escherichia coli E24377A]
 gi|157160416|ref|YP_001457734.1| seryl-tRNA synthetase [Escherichia coli HS]
 gi|168752125|ref|ZP_02777147.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4113]
 gi|168756984|ref|ZP_02781991.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4401]
 gi|168762973|ref|ZP_02787980.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4501]
 gi|168769886|ref|ZP_02794893.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4486]
 gi|168776256|ref|ZP_02801263.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4196]
 gi|168783803|ref|ZP_02808810.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4076]
 gi|168787321|ref|ZP_02812328.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC869]
 gi|168801425|ref|ZP_02826432.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC508]
 gi|170020705|ref|YP_001725659.1| seryl-tRNA synthetase [Escherichia coli ATCC 8739]
 gi|170080551|ref|YP_001729871.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli str. K-12 substr. DH10B]
 gi|170683015|ref|YP_001744277.1| seryl-tRNA synthetase [Escherichia coli SMS-3-5]
 gi|188492608|ref|ZP_02999878.1| seryl-tRNA synthetase [Escherichia coli 53638]
 gi|191167614|ref|ZP_03029425.1| seryl-tRNA synthetase [Escherichia coli B7A]
 gi|191172133|ref|ZP_03033677.1| seryl-tRNA synthetase [Escherichia coli F11]
 gi|193064674|ref|ZP_03045753.1| seryl-tRNA synthetase [Escherichia coli E22]
 gi|194428395|ref|ZP_03060936.1| seryl-tRNA synthetase [Escherichia coli B171]
 gi|194438706|ref|ZP_03070793.1| seryl-tRNA synthetase [Escherichia coli 101-1]
 gi|195939556|ref|ZP_03084938.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4024]
 gi|208808989|ref|ZP_03251326.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4206]
 gi|208815536|ref|ZP_03256715.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4045]
 gi|208822033|ref|ZP_03262352.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4042]
 gi|209396596|ref|YP_002269566.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4115]
 gi|209918142|ref|YP_002292226.1| seryl-tRNA synthetase [Escherichia coli SE11]
 gi|215486023|ref|YP_002328454.1| seryl-tRNA synthetase [Escherichia coli O127:H6 str. E2348/69]
 gi|217326397|ref|ZP_03442481.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. TW14588]
 gi|218553479|ref|YP_002386392.1| seryl-tRNA synthetase [Escherichia coli IAI1]
 gi|218557801|ref|YP_002390714.1| seryl-tRNA synthetase [Escherichia coli S88]
 gi|218688681|ref|YP_002396893.1| seryl-tRNA synthetase [Escherichia coli ED1a]
 gi|218694366|ref|YP_002402033.1| seryl-tRNA synthetase [Escherichia coli 55989]
 gi|218700589|ref|YP_002408218.1| seryl-tRNA synthetase [Escherichia coli IAI39]
 gi|218704322|ref|YP_002411841.1| seryl-tRNA synthetase [Escherichia coli UMN026]
 gi|227884140|ref|ZP_04001945.1| seryl-tRNA synthetase [Escherichia coli 83972]
 gi|237707117|ref|ZP_04537598.1| seryl-tRNA synthetase [Escherichia sp. 3_2_53FAA]
 gi|238900151|ref|YP_002925947.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli BW2952]
 gi|253774078|ref|YP_003036909.1| seryl-tRNA synthetase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254161007|ref|YP_003044115.1| seryl-tRNA synthetase [Escherichia coli B str. REL606]
 gi|254792093|ref|YP_003076930.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. TW14359]
 gi|256020979|ref|ZP_05434844.1| seryl-tRNA synthetase [Shigella sp. D9]
 gi|256023406|ref|ZP_05437271.1| seryl-tRNA synthetase [Escherichia sp. 4_1_40B]
 gi|260843143|ref|YP_003220921.1| seryl-tRNA synthetase [Escherichia coli O103:H2 str. 12009]
 gi|260854184|ref|YP_003228075.1| seryl-tRNA synthetase [Escherichia coli O26:H11 str. 11368]
 gi|260867065|ref|YP_003233467.1| seryl-tRNA synthetase [Escherichia coli O111:H- str. 11128]
 gi|261227398|ref|ZP_05941679.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli O157:H7 str. FRIK2000]
 gi|261256179|ref|ZP_05948712.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. FRIK966]
 gi|291281896|ref|YP_003498714.1| Seryl-tRNA synthetase [Escherichia coli O55:H7 str. CB9615]
 gi|293404200|ref|ZP_06648194.1| seryl-tRNA synthetase [Escherichia coli FVEC1412]
 gi|293409271|ref|ZP_06652847.1| seryl-tRNA synthetase [Escherichia coli B354]
 gi|293414175|ref|ZP_06656824.1| seryl-tRNA synthetase [Escherichia coli B185]
 gi|293433190|ref|ZP_06661618.1| seryl-tRNA synthetase [Escherichia coli B088]
 gi|297518813|ref|ZP_06937199.1| seryl-tRNA synthetase [Escherichia coli OP50]
 gi|298379981|ref|ZP_06989586.1| seryl-tRNA synthetase [Escherichia coli FVEC1302]
 gi|300817005|ref|ZP_07097224.1| seryl-tRNA synthetase [Escherichia coli MS 107-1]
 gi|300823632|ref|ZP_07103759.1| seryl-tRNA synthetase [Escherichia coli MS 119-7]
 gi|300896500|ref|ZP_07115024.1| seryl-tRNA synthetase [Escherichia coli MS 198-1]
 gi|300902950|ref|ZP_07120894.1| seryl-tRNA synthetase [Escherichia coli MS 84-1]
 gi|300921073|ref|ZP_07137457.1| seryl-tRNA synthetase [Escherichia coli MS 115-1]
 gi|300926531|ref|ZP_07142320.1| seryl-tRNA synthetase [Escherichia coli MS 182-1]
 gi|300929586|ref|ZP_07145049.1| seryl-tRNA synthetase [Escherichia coli MS 187-1]
 gi|300937613|ref|ZP_07152422.1| seryl-tRNA synthetase [Escherichia coli MS 21-1]
 gi|300949747|ref|ZP_07163724.1| seryl-tRNA synthetase [Escherichia coli MS 116-1]
 gi|300954716|ref|ZP_07167151.1| seryl-tRNA synthetase [Escherichia coli MS 175-1]
 gi|300978543|ref|ZP_07174296.1| seryl-tRNA synthetase [Escherichia coli MS 45-1]
 gi|300983196|ref|ZP_07176475.1| seryl-tRNA synthetase [Escherichia coli MS 200-1]
 gi|301022878|ref|ZP_07186711.1| seryl-tRNA synthetase [Escherichia coli MS 69-1]
 gi|301024412|ref|ZP_07188097.1| seryl-tRNA synthetase [Escherichia coli MS 196-1]
 gi|301047849|ref|ZP_07194899.1| seryl-tRNA synthetase [Escherichia coli MS 185-1]
 gi|301302500|ref|ZP_07208631.1| seryl-tRNA synthetase [Escherichia coli MS 124-1]
 gi|301325784|ref|ZP_07219232.1| seryl-tRNA synthetase [Escherichia coli MS 78-1]
 gi|301646338|ref|ZP_07246226.1| seryl-tRNA synthetase [Escherichia coli MS 146-1]
 gi|306812651|ref|ZP_07446844.1| seryl-tRNA synthetase [Escherichia coli NC101]
 gi|307137521|ref|ZP_07496877.1| seryl-tRNA synthetase [Escherichia coli H736]
 gi|307311720|ref|ZP_07591360.1| seryl-tRNA synthetase [Escherichia coli W]
 gi|309795298|ref|ZP_07689716.1| seryl-tRNA synthetase [Escherichia coli MS 145-7]
 gi|312969039|ref|ZP_07783246.1| seryl-tRNA synthetase [Escherichia coli 2362-75]
 gi|312971020|ref|ZP_07785199.1| seryl-tRNA synthetase [Escherichia coli 1827-70]
 gi|331641414|ref|ZP_08342549.1| serine--tRNA ligase [Escherichia coli H736]
 gi|331646160|ref|ZP_08347263.1| serine--tRNA ligase [Escherichia coli M605]
 gi|331651912|ref|ZP_08352931.1| serine--tRNA ligase [Escherichia coli M718]
 gi|331656965|ref|ZP_08357927.1| serine--tRNA ligase [Escherichia coli TA206]
 gi|331662308|ref|ZP_08363231.1| serine--tRNA ligase [Escherichia coli TA143]
 gi|331667267|ref|ZP_08368132.1| serine--tRNA ligase [Escherichia coli TA271]
 gi|331672434|ref|ZP_08373224.1| serine--tRNA ligase [Escherichia coli TA280]
 gi|331676680|ref|ZP_08377376.1| serine--tRNA ligase [Escherichia coli H591]
 gi|331682402|ref|ZP_08383021.1| serine--tRNA ligase [Escherichia coli H299]
 gi|332282204|ref|ZP_08394617.1| seryl-tRNA synthetase [Shigella sp. D9]
 gi|67473027|sp|P0A8L1|SYS_ECOLI RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|67473028|sp|P0A8L2|SYS_ECOL6 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|67473029|sp|P0A8L3|SYS_ECO57 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|67473030|sp|P0A8L4|SYS_SHIFL RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|122424423|sp|Q1RE21|SYS_ECOUT RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|122957696|sp|Q0T8M9|SYS_SHIF8 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|123049332|sp|Q0TJF7|SYS_ECOL5 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|123617600|sp|Q3Z3M7|SYS_SHISS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|123755624|sp|Q323L0|SYS_SHIBS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|166221437|sp|A1A9D6|SYS_ECOK1 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|166987311|sp|A7ZJW2|SYS_ECO24 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|166987312|sp|A7ZYJ7|SYS_ECOHS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|189083568|sp|B1IWN0|SYS_ECOLC RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|226701391|sp|B7MHK5|SYS_ECO45 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|226701392|sp|B7NM82|SYS_ECO7I RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|226701393|sp|B7M821|SYS_ECO8A RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|226701394|sp|B7NAP4|SYS_ECOLU RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|226701395|sp|B1LJX0|SYS_ECOSM RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|229559900|sp|B1X833|SYS_ECODH RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|238065099|sp|B5YT28|SYS_ECO5E RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|238065100|sp|B6I8W4|SYS_ECOSE RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|254783025|sp|B7UMY4|SYS_ECO27 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|254783026|sp|B7LD85|SYS_ECO55 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|254783027|sp|B7MRV6|SYS_ECO81 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|259511667|sp|C4ZQ19|SYS_ECOBW RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|26107319|gb|AAN79502.1|AE016758_106 Seryl-tRNA synthetase [Escherichia coli CFT073]
 gi|42950|emb|CAA28673.1| unnamed protein product [Escherichia coli]
 gi|1651420|dbj|BAA35625.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli str. K12 substr. W3110]
 gi|1787120|gb|AAC73979.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli str. K-12 substr. MG1655]
 gi|13360437|dbj|BAB34401.1| serine tRNA synthetase [Escherichia coli O157:H7 str. Sakai]
 gi|24051120|gb|AAN42485.1| serine tRNA synthetase [Shigella flexneri 2a str. 301]
 gi|30040626|gb|AAP16357.1| serine tRNA synthetase [Shigella flexneri 2a str. 2457T]
 gi|73854928|gb|AAZ87635.1| serine tRNA synthetase [Shigella sonnei Ss046]
 gi|81244790|gb|ABB65498.1| serine tRNA synthetase [Shigella boydii Sb227]
 gi|91071512|gb|ABE06393.1| seryl-tRNA synthetase [Escherichia coli UTI89]
 gi|110342685|gb|ABG68922.1| seryl-tRNA synthetase [Escherichia coli 536]
 gi|110614442|gb|ABF03109.1| serine tRNA synthetase [Shigella flexneri 5 str. 8401]
 gi|115512201|gb|ABJ00276.1| seryl-tRNA synthetase [Escherichia coli APEC O1]
 gi|157066096|gb|ABV05351.1| seryl-tRNA synthetase [Escherichia coli HS]
 gi|157079586|gb|ABV19294.1| seryl-tRNA synthetase [Escherichia coli E24377A]
 gi|169755633|gb|ACA78332.1| seryl-tRNA synthetase [Escherichia coli ATCC 8739]
 gi|169888386|gb|ACB02093.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli str. K-12 substr. DH10B]
 gi|170520733|gb|ACB18911.1| seryl-tRNA synthetase [Escherichia coli SMS-3-5]
 gi|187768390|gb|EDU32234.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4196]
 gi|188013954|gb|EDU52076.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4113]
 gi|188487807|gb|EDU62910.1| seryl-tRNA synthetase [Escherichia coli 53638]
 gi|188998912|gb|EDU67898.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4076]
 gi|189355936|gb|EDU74355.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4401]
 gi|189361156|gb|EDU79575.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4486]
 gi|189366796|gb|EDU85212.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4501]
 gi|189372720|gb|EDU91136.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC869]
 gi|189376450|gb|EDU94866.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC508]
 gi|190902375|gb|EDV62113.1| seryl-tRNA synthetase [Escherichia coli B7A]
 gi|190907660|gb|EDV67255.1| seryl-tRNA synthetase [Escherichia coli F11]
 gi|192927731|gb|EDV82346.1| seryl-tRNA synthetase [Escherichia coli E22]
 gi|194413610|gb|EDX29891.1| seryl-tRNA synthetase [Escherichia coli B171]
 gi|194422338|gb|EDX38338.1| seryl-tRNA synthetase [Escherichia coli 101-1]
 gi|208728790|gb|EDZ78391.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4206]
 gi|208732184|gb|EDZ80872.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4045]
 gi|208737518|gb|EDZ85201.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4042]
 gi|209157996|gb|ACI35429.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4115]
 gi|209775018|gb|ACI85821.1| serine tRNA synthetase [Escherichia coli]
 gi|209775020|gb|ACI85822.1| serine tRNA synthetase [Escherichia coli]
 gi|209775022|gb|ACI85823.1| serine tRNA synthetase [Escherichia coli]
 gi|209775024|gb|ACI85824.1| serine tRNA synthetase [Escherichia coli]
 gi|209775026|gb|ACI85825.1| serine tRNA synthetase [Escherichia coli]
 gi|209911401|dbj|BAG76475.1| seryl-tRNA synthase [Escherichia coli SE11]
 gi|215264095|emb|CAS08437.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli O127:H6 str. E2348/69]
 gi|217322618|gb|EEC31042.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. TW14588]
 gi|218351098|emb|CAU96802.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli 55989]
 gi|218360247|emb|CAQ97797.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli IAI1]
 gi|218364570|emb|CAR02256.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli S88]
 gi|218370575|emb|CAR18382.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli IAI39]
 gi|218426245|emb|CAR07070.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli ED1a]
 gi|218431419|emb|CAR12297.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli UMN026]
 gi|222032627|emb|CAP75366.1| Seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli LF82]
 gi|226898327|gb|EEH84586.1| seryl-tRNA synthetase [Escherichia sp. 3_2_53FAA]
 gi|227838892|gb|EEJ49358.1| seryl-tRNA synthetase [Escherichia coli 83972]
 gi|238863546|gb|ACR65544.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli BW2952]
 gi|242376708|emb|CAQ31421.1| seryl-tRNA synthetase [Escherichia coli BL21(DE3)]
 gi|253325122|gb|ACT29724.1| seryl-tRNA synthetase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253972908|gb|ACT38579.1| seryl-tRNA synthetase [Escherichia coli B str. REL606]
 gi|253977122|gb|ACT42792.1| seryl-tRNA synthetase [Escherichia coli BL21(DE3)]
 gi|254591493|gb|ACT70854.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli O157:H7 str. TW14359]
 gi|257752833|dbj|BAI24335.1| seryl-tRNA synthetase [Escherichia coli O26:H11 str. 11368]
 gi|257758290|dbj|BAI29787.1| seryl-tRNA synthetase [Escherichia coli O103:H2 str. 12009]
 gi|257763421|dbj|BAI34916.1| seryl-tRNA synthetase [Escherichia coli O111:H- str. 11128]
 gi|260449961|gb|ACX40383.1| seryl-tRNA synthetase [Escherichia coli DH1]
 gi|281178027|dbj|BAI54357.1| seryl-tRNA synthetase [Escherichia coli SE15]
 gi|281600221|gb|ADA73205.1| Seryl-tRNA synthetase [Shigella flexneri 2002017]
 gi|284920746|emb|CBG33809.1| seryl-tRNA synthetase [Escherichia coli 042]
 gi|290761769|gb|ADD55730.1| Seryl-tRNA synthetase [Escherichia coli O55:H7 str. CB9615]
 gi|291324009|gb|EFE63431.1| seryl-tRNA synthetase [Escherichia coli B088]
 gi|291428786|gb|EFF01811.1| seryl-tRNA synthetase [Escherichia coli FVEC1412]
 gi|291434233|gb|EFF07206.1| seryl-tRNA synthetase [Escherichia coli B185]
 gi|291469739|gb|EFF12223.1| seryl-tRNA synthetase [Escherichia coli B354]
 gi|294493263|gb|ADE92019.1| seryl-tRNA synthetase [Escherichia coli IHE3034]
 gi|298279679|gb|EFI21187.1| seryl-tRNA synthetase [Escherichia coli FVEC1302]
 gi|299880384|gb|EFI88595.1| seryl-tRNA synthetase [Escherichia coli MS 196-1]
 gi|300300277|gb|EFJ56662.1| seryl-tRNA synthetase [Escherichia coli MS 185-1]
 gi|300306960|gb|EFJ61480.1| seryl-tRNA synthetase [Escherichia coli MS 200-1]
 gi|300318327|gb|EFJ68111.1| seryl-tRNA synthetase [Escherichia coli MS 175-1]
 gi|300359649|gb|EFJ75519.1| seryl-tRNA synthetase [Escherichia coli MS 198-1]
 gi|300397340|gb|EFJ80878.1| seryl-tRNA synthetase [Escherichia coli MS 69-1]
 gi|300405011|gb|EFJ88549.1| seryl-tRNA synthetase [Escherichia coli MS 84-1]
 gi|300409622|gb|EFJ93160.1| seryl-tRNA synthetase [Escherichia coli MS 45-1]
 gi|300411924|gb|EFJ95234.1| seryl-tRNA synthetase [Escherichia coli MS 115-1]
 gi|300417448|gb|EFK00759.1| seryl-tRNA synthetase [Escherichia coli MS 182-1]
 gi|300450861|gb|EFK14481.1| seryl-tRNA synthetase [Escherichia coli MS 116-1]
 gi|300457343|gb|EFK20836.1| seryl-tRNA synthetase [Escherichia coli MS 21-1]
 gi|300462474|gb|EFK25967.1| seryl-tRNA synthetase [Escherichia coli MS 187-1]
 gi|300523832|gb|EFK44901.1| seryl-tRNA synthetase [Escherichia coli MS 119-7]
 gi|300530357|gb|EFK51419.1| seryl-tRNA synthetase [Escherichia coli MS 107-1]
 gi|300842339|gb|EFK70099.1| seryl-tRNA synthetase [Escherichia coli MS 124-1]
 gi|300847427|gb|EFK75187.1| seryl-tRNA synthetase [Escherichia coli MS 78-1]
 gi|301075441|gb|EFK90247.1| seryl-tRNA synthetase [Escherichia coli MS 146-1]
 gi|305853414|gb|EFM53853.1| seryl-tRNA synthetase [Escherichia coli NC101]
 gi|306908275|gb|EFN38774.1| seryl-tRNA synthetase [Escherichia coli W]
 gi|307552735|gb|ADN45510.1| serine tRNA synthetase [Escherichia coli ABU 83972]
 gi|307627677|gb|ADN71981.1| seryl-tRNA synthetase [Escherichia coli UM146]
 gi|308120948|gb|EFO58210.1| seryl-tRNA synthetase [Escherichia coli MS 145-7]
 gi|309701169|emb|CBJ00469.1| seryl-tRNA synthetase [Escherichia coli ETEC H10407]
 gi|310336781|gb|EFQ01948.1| seryl-tRNA synthetase [Escherichia coli 1827-70]
 gi|312286441|gb|EFR14354.1| seryl-tRNA synthetase [Escherichia coli 2362-75]
 gi|312945416|gb|ADR26243.1| seryl-tRNA synthetase [Escherichia coli O83:H1 str. NRG 857C]
 gi|313650195|gb|EFS14607.1| seryl-tRNA synthetase [Shigella flexneri 2a str. 2457T]
 gi|315060178|gb|ADT74505.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli W]
 gi|315135541|dbj|BAJ42700.1| seryl-tRNA synthetase [Escherichia coli DH1]
 gi|315257933|gb|EFU37901.1| seryl-tRNA synthetase [Escherichia coli MS 85-1]
 gi|315287520|gb|EFU46931.1| seryl-tRNA synthetase [Escherichia coli MS 110-3]
 gi|315291252|gb|EFU50612.1| seryl-tRNA synthetase [Escherichia coli MS 153-1]
 gi|315296139|gb|EFU55448.1| seryl-tRNA synthetase [Escherichia coli MS 16-3]
 gi|315619205|gb|EFU99784.1| seryl-tRNA synthetase [Escherichia coli 3431]
 gi|320180610|gb|EFW55539.1| Seryl-tRNA synthetase [Shigella boydii ATCC 9905]
 gi|320183168|gb|EFW58026.1| Seryl-tRNA synthetase [Shigella flexneri CDC 796-83]
 gi|320192620|gb|EFW67261.1| Seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC1212]
 gi|320196611|gb|EFW71234.1| Seryl-tRNA synthetase [Escherichia coli WV_060327]
 gi|320202288|gb|EFW76859.1| Seryl-tRNA synthetase [Escherichia coli EC4100B]
 gi|320637763|gb|EFX07555.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. G5101]
 gi|320642887|gb|EFX12088.1| seryl-tRNA synthetase [Escherichia coli O157:H- str. 493-89]
 gi|320648344|gb|EFX16999.1| seryl-tRNA synthetase [Escherichia coli O157:H- str. H 2687]
 gi|320654182|gb|EFX22250.1| seryl-tRNA synthetase [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320659806|gb|EFX27362.1| seryl-tRNA synthetase [Escherichia coli O55:H7 str. USDA 5905]
 gi|320664275|gb|EFX31426.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. LSU-61]
 gi|323157221|gb|EFZ43344.1| seryl-tRNA synthetase [Escherichia coli EPECa14]
 gi|323159518|gb|EFZ45498.1| seryl-tRNA synthetase [Escherichia coli E128010]
 gi|323165354|gb|EFZ51141.1| seryl-tRNA synthetase [Shigella sonnei 53G]
 gi|323172135|gb|EFZ57773.1| seryl-tRNA synthetase [Escherichia coli LT-68]
 gi|323175485|gb|EFZ61080.1| seryl-tRNA synthetase [Escherichia coli 1180]
 gi|323185142|gb|EFZ70507.1| seryl-tRNA synthetase [Escherichia coli 1357]
 gi|323190715|gb|EFZ75984.1| seryl-tRNA synthetase [Escherichia coli RN587/1]
 gi|323379265|gb|ADX51533.1| seryl-tRNA synthetase [Escherichia coli KO11]
 gi|323937999|gb|EGB34261.1| seryl-tRNA synthetase [Escherichia coli E1520]
 gi|323942809|gb|EGB38974.1| seryl-tRNA synthetase [Escherichia coli E482]
 gi|323947318|gb|EGB43326.1| seryl-tRNA synthetase [Escherichia coli H120]
 gi|323953397|gb|EGB49263.1| seryl-tRNA synthetase [Escherichia coli H252]
 gi|323958200|gb|EGB53909.1| seryl-tRNA synthetase [Escherichia coli H263]
 gi|323962941|gb|EGB58514.1| seryl-tRNA synthetase [Escherichia coli H489]
 gi|323967140|gb|EGB62564.1| seryl-tRNA synthetase [Escherichia coli M863]
 gi|323969605|gb|EGB64892.1| seryl-tRNA synthetase [Escherichia coli TA007]
 gi|323976720|gb|EGB71808.1| seryl-tRNA synthetase [Escherichia coli TW10509]
 gi|324009812|gb|EGB79031.1| seryl-tRNA synthetase [Escherichia coli MS 57-2]
 gi|324012983|gb|EGB82202.1| seryl-tRNA synthetase [Escherichia coli MS 60-1]
 gi|324116106|gb|EGC10030.1| seryl-tRNA synthetase [Escherichia coli E1167]
 gi|326338211|gb|EGD62040.1| Seryl-tRNA synthetase [Escherichia coli O157:H7 str. 1125]
 gi|326346188|gb|EGD69926.1| Seryl-tRNA synthetase [Escherichia coli O157:H7 str. 1044]
 gi|327253681|gb|EGE65310.1| seryl-tRNA synthetase [Escherichia coli STEC_7v]
 gi|330910675|gb|EGH39185.1| seryl-tRNA synthetase [Escherichia coli AA86]
 gi|331038212|gb|EGI10432.1| serine--tRNA ligase [Escherichia coli H736]
 gi|331044912|gb|EGI17039.1| serine--tRNA ligase [Escherichia coli M605]
 gi|331050190|gb|EGI22248.1| serine--tRNA ligase [Escherichia coli M718]
 gi|331055213|gb|EGI27222.1| serine--tRNA ligase [Escherichia coli TA206]
 gi|331060730|gb|EGI32694.1| serine--tRNA ligase [Escherichia coli TA143]
 gi|331065623|gb|EGI37516.1| serine--tRNA ligase [Escherichia coli TA271]
 gi|331070340|gb|EGI41705.1| serine--tRNA ligase [Escherichia coli TA280]
 gi|331075369|gb|EGI46667.1| serine--tRNA ligase [Escherichia coli H591]
 gi|331080033|gb|EGI51212.1| serine--tRNA ligase [Escherichia coli H299]
 gi|332097143|gb|EGJ02126.1| seryl-tRNA synthetase [Shigella boydii 3594-74]
 gi|332104556|gb|EGJ07902.1| seryl-tRNA synthetase [Shigella sp. D9]
 gi|332342282|gb|AEE55616.1| seryl-tRNA synthetase SerS [Escherichia coli UMNK88]
 gi|332760582|gb|EGJ90871.1| seryl-tRNA synthetase [Shigella flexneri 2747-71]
 gi|332762948|gb|EGJ93198.1| seryl-tRNA synthetase [Shigella flexneri K-671]
 gi|332768071|gb|EGJ98257.1| seryl-tRNA synthetase [Shigella flexneri 2930-71]
 gi|333006696|gb|EGK26195.1| seryl-tRNA synthetase [Shigella flexneri VA-6]
 gi|333021000|gb|EGK40258.1| seryl-tRNA synthetase [Shigella flexneri K-304]
          Length = 430

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/431 (46%), Positives = 271/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T        T    LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|26990705|ref|NP_746130.1| seryl-tRNA synthetase [Pseudomonas putida KT2440]
 gi|38258319|sp|Q88FT2|SYS_PSEPK RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|24985698|gb|AAN69594.1|AE016593_2 seryl-tRNA synthetase [Pseudomonas putida KT2440]
          Length = 426

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/434 (46%), Positives = 283/434 (65%), Gaps = 18/434 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R        I SL+E+ + +  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRGQLQEVADRLASRGFSLDVARIESLEERRKAVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A A+G      ++ V+ + NE +  K +L  ++ E       L  ++  IPN+P   VP+
Sbjct: 61  AKAKGEDIAPLMADVERMANELAAGKAELDAIQAE-------LDGILLTIPNLPDASVPV 113

Query: 116 GTSANENILIRSVGKKPSAIHLS-REHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           G S ++N+ +R  G  P A     ++H  +GE  G +DF+ A KLSGARF+VL G +A L
Sbjct: 114 GASEDDNVEVRRWGT-PKAFDFEIKDHVALGEISGGLDFEAAAKLSGARFAVLRGPVARL 172

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIP 230
            RAL QFMI+LHT EHGY E   P +V+  A+ GTGQ+PKF +D+F  T +G    +LIP
Sbjct: 173 HRALAQFMINLHTGEHGYEEHYTPYMVQAPALQGTGQLPKFEEDLFKITREGEADFYLIP 232

Query: 231 TSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT 290
           T+EVSLTNL + EI+++K LPL+     P FRSEAG++GRDTRGM+RQHQF K E+V + 
Sbjct: 233 TAEVSLTNLVAGEILDAKQLPLKLVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQVV 292

Query: 291 REEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREI 350
               S    E + + AE +L+ L+L YRV++LCTGD+GF A KTYDLEVW+  Q+ YREI
Sbjct: 293 EPSKSMEALEGLTANAERVLQLLELPYRVLALCTGDMGFGAVKTYDLEVWVPSQDKYREI 352

Query: 351 SSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIP 410
           SSCS CG+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P
Sbjct: 353 SSCSNCGDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSILVP 412

Query: 411 TVLRPYMNNLAVIK 424
            VL+PYM  + VI+
Sbjct: 413 EVLKPYMGGVEVIR 426


>gi|226944892|ref|YP_002799965.1| seryl-tRNA synthetase [Azotobacter vinelandii DJ]
 gi|259511660|sp|C1DKY8|SYS_AZOVD RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|226719819|gb|ACO78990.1| seryl-tRNA synthetase [Azotobacter vinelandii DJ]
          Length = 426

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 198/432 (45%), Positives = 282/432 (65%), Gaps = 16/432 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R  +       SL+ + + +  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLVRTQLQEIVGRLATRGFQLDVARFESLEAQRKAVQTRTEQLQAERNARSKTIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A + G      L+ VD + ++    K +L  ++ E       L  L+  IPN+P E VP+
Sbjct: 61  AKSRGEDIAPLLAEVDRMGSDLEAGKRELDAIQAE-------LDALMLSIPNLPHESVPV 113

Query: 116 GTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLE 175
           G    +N+ +R  G   +     ++H  +GE  G +DF+ A KLSGARF+++ G +A L 
Sbjct: 114 GADEEDNVEVRRWGVPRTFDFAIKDHVALGERHGWLDFETAAKLSGARFALMRGPIARLH 173

Query: 176 RALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIPT 231
           RAL QFM+DLHT EHGY E   P LV+  A+ GTGQ+PKF +D+F  + +G    +LIPT
Sbjct: 174 RALAQFMLDLHTGEHGYEEAYTPYLVQAPALQGTGQLPKFEEDLFKISREGEADFYLIPT 233

Query: 232 SEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITR 291
           +EVSLTN+ + EI++++ LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I  
Sbjct: 234 AEVSLTNIVAGEILDARQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVRIVD 293

Query: 292 EEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREIS 351
              S+   E + + AE++L+RL+L YRV++LCTGD+GFSA KTYDLEVW+  Q+ YREIS
Sbjct: 294 PAKSYEALEELTANAEKVLQRLELPYRVLALCTGDMGFSATKTYDLEVWVPSQDKYREIS 353

Query: 352 SCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPT 411
           SCS CG+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P 
Sbjct: 354 SCSNCGDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPE 413

Query: 412 VLRPYMNNLAVI 423
           VL+PYM  + VI
Sbjct: 414 VLKPYMGGIEVI 425


>gi|293364834|ref|ZP_06611551.1| serine--tRNA ligase [Streptococcus oralis ATCC 35037]
 gi|307703083|ref|ZP_07640030.1| seryl-tRNA synthetase [Streptococcus oralis ATCC 35037]
 gi|291316284|gb|EFE56720.1| serine--tRNA ligase [Streptococcus oralis ATCC 35037]
 gi|307623476|gb|EFO02466.1| seryl-tRNA synthetase [Streptococcus oralis ATCC 35037]
          Length = 424

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/426 (47%), Positives = 277/426 (65%), Gaps = 5/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IR + + +   L  R ++      +  +D K R ++ K+E ++A RN+ SA+I 
Sbjct: 1   MLDIKRIRTDFDAVAEKLATRGVDAAILNEMKEIDAKRRDILVKVETLKAERNTVSAEIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA  + N    D       TL  ++  L+ E  ++ + L +  + +PN+P + VPIG   
Sbjct: 61  QA--KRNKENADDKIAAMQTLSAEVKALDAELADIDAKLTEFTTTLPNIPADSVPIGADE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+ +R  G         + H+++GE LG++D++R  K++GARF    G  A LERA+ 
Sbjct: 119 DDNVEVRRWGSPREFDFEPKAHWDLGEDLGILDWERGGKVTGARFLFYKGLGARLERAIY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLTN 238
            FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F   D  + LIPT+EV LTN
Sbjct: 179 NFMLDEHGKE-GYTEVITPYMVNHDSMFGTGQYPKFKEDTFELKDTNYVLIPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E+S+ E
Sbjct: 238 YYRDEILDGKDLPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESYEE 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M + AE IL++L+L YRVV+L TGD+GFSA KTYDLEVW+  QN YREISSCS   +
Sbjct: 298 LEKMTANAENILQKLNLPYRVVALSTGDMGFSAAKTYDLEVWIPAQNTYREISSCSNTED 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY NADGSVTIP  LRPYM 
Sbjct: 358 FQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNADGSVTIPEALRPYMG 417

Query: 419 NLAVIK 424
              VIK
Sbjct: 418 GAEVIK 423


>gi|170769264|ref|ZP_02903717.1| seryl-tRNA synthetase [Escherichia albertii TW07627]
 gi|170121916|gb|EDS90847.1| seryl-tRNA synthetase [Escherichia albertii TW07627]
          Length = 430

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/431 (46%), Positives = 271/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPRKFDFEIRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T        T    LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|320175334|gb|EFW50440.1| Seryl-tRNA synthetase [Shigella dysenteriae CDC 74-1112]
          Length = 430

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/431 (46%), Positives = 271/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T        T    LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNRLEYI 429


>gi|313498111|gb|ADR59477.1| SerS [Pseudomonas putida BIRD-1]
          Length = 426

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/434 (46%), Positives = 283/434 (65%), Gaps = 18/434 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R        I SL+E+ + +  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRGQLQEVADRLASRGFSLDVARIESLEERRKAVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A A+G      ++ V+ + NE +  K +L  ++ E       L  ++  IPN+P   VP+
Sbjct: 61  AKAKGEDIAPLMADVERMANELAAGKAELDAIQAE-------LDGILLTIPNLPDASVPV 113

Query: 116 GTSANENILIRSVGKKPSAIHLS-REHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           G S ++N+ +R  G  P A     ++H  +GE  G +DF+ A KLSGARF+VL G +A L
Sbjct: 114 GASEDDNVEVRRWGT-PKAFDFEIKDHVALGEISGGLDFEAAAKLSGARFAVLRGPVARL 172

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIP 230
            RAL QFMI+LHT EHGY E   P +V+  A+ GTGQ+PKF +D+F  T +G    +LIP
Sbjct: 173 HRALAQFMINLHTGEHGYEEHYTPYMVQAPALQGTGQLPKFEEDLFKITREGEADFYLIP 232

Query: 231 TSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT 290
           T+EVSLTNL + EI+++K LPL+     P FRSEAG++GRDTRGM+RQHQF K E+V + 
Sbjct: 233 TAEVSLTNLVAGEILDAKQLPLKLVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQVV 292

Query: 291 REEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREI 350
               S    E + + AE +L+ L+L YRV++LCTGD+GF A KTYDLEVW+  Q+ YREI
Sbjct: 293 EPAKSMEALEGLTANAERVLQLLELPYRVLALCTGDMGFGAVKTYDLEVWVPSQDKYREI 352

Query: 351 SSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIP 410
           SSCS CG+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P
Sbjct: 353 SSCSNCGDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSILVP 412

Query: 411 TVLRPYMNNLAVIK 424
            VL+PYM  + VI+
Sbjct: 413 EVLKPYMGGVEVIR 426


>gi|310819975|ref|YP_003952333.1| seryl-tRNA synthetase [Stigmatella aurantiaca DW4/3-1]
 gi|309393047|gb|ADO70506.1| Seryl-tRNA synthetase [Stigmatella aurantiaca DW4/3-1]
          Length = 426

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 205/426 (48%), Positives = 275/426 (64%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++++ QN + +   LK R           L  + R L   +E + ARRN+ + ++ +
Sbjct: 1   MLDLRYVAQNFDAVVARLKARSGNLDLGPFQKLFTERRELYVSVEGLSARRNAANDEMKR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              E   +L DAL+ +   + +++   E    EV   + +++  IPN+P E VP G S  
Sbjct: 61  KAKEDPKAL-DALRGDLRAVSQEIKEKEARLKEVEEEISRILLLIPNIPHESVPTGASEQ 119

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N++ R+ G+KP  +   R+HFEIGE LG++DF+RA K+SG+RF+     LA LERAL  
Sbjct: 120 DNVVTRTWGEKPDFLFTPRQHFEIGEKLGMLDFERAAKVSGSRFTFYKAALARLERALVT 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG--RWLIPTSEVSLTN 238
           FMID+HT + GYTE+  P LV  E M GTGQ+PKF DD F T+    R+LIPT+EV +TN
Sbjct: 180 FMIDVHT-QKGYTELLPPYLVLRETMMGTGQLPKFEDDAFKTSGDPERFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            +S EI+E   LPL++   +P FR+EAG+AGRDTRG++RQHQF K ELV     E S +E
Sbjct: 239 YHSDEILEGGQLPLKYCAFSPCFRAEAGAAGRDTRGLIRQHQFHKVELVKFATPETSLSE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E M   A +IL+RL LH+RV+ LCTGD+GF+A KT+D+EVWL GQ  YREISSCS CG+
Sbjct: 299 LEGMTDDACDILRRLGLHHRVMLLCTGDMGFAARKTFDIEVWLPGQGAYREISSCSDCGD 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   RYR       +  HTLNGSG+AVGR  IAILENY   DGSV IP  L PYM 
Sbjct: 359 FQARRAKIRYRAQKGDKPQLLHTLNGSGLAVGRTSIAILENYQREDGSVAIPDALVPYMG 418

Query: 419 NLAVIK 424
            L  I+
Sbjct: 419 GLKEIR 424


>gi|148284580|ref|YP_001248670.1| seryl-tRNA synthetase [Orientia tsutsugamushi str. Boryong]
 gi|166222756|sp|A5CDU5|SYS_ORITB RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|146740019|emb|CAM80103.1| seryl-tRNA synthetase [Orientia tsutsugamushi str. Boryong]
          Length = 429

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 204/425 (48%), Positives = 283/425 (66%), Gaps = 6/425 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR NP+ LD +L KR ++  S+ I+ +D + R LI  I+ ++  R   S  +  
Sbjct: 1   MLDIKWIRANPDKLDESLSKRGIDSVSKSIIHIDSEKRTLISLIQKLQHERKEKSNSVAH 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKE--EHEVCSSLKKLISCIPNVPLEEVPIGTS 118
            I + + +  + ++N+   + +++  LE     HE    L +++  +PN+  ++VP GT+
Sbjct: 61  -IYDKSSTDFEEIQNDVKLINQKITELETSLLHHE--KRLSEIMDNLPNLVADDVPYGTN 117

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
           ++ N +++  G   + I   + H+EIG+ LG++DF+ ATK+SG+RF +L   LA LERAL
Sbjct: 118 SDMNKVLKECGTIQN-IKFPKHHYEIGKNLGMIDFNTATKMSGSRFVILKHDLAKLERAL 176

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTN 238
             FMID+HT+E  + EVS P LV+D AMY  GQ+PKFAD  F TT G  LIPT+EV LTN
Sbjct: 177 INFMIDVHTTEFNFFEVSPPCLVKDHAMYNVGQLPKFADASFETTTGYRLIPTAEVPLTN 236

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           ++++  +  + LP+R     P FRSE GSAG+D +GMLR HQF K EL +I   E+S  E
Sbjct: 237 IFANTTLLEEKLPIRLVAFTPCFRSEVGSAGKDVKGMLRMHQFGKVELFTIATPEESNRE 296

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E + + AE ILK+L L YRVV LC+GD+GF+A KTYDLEVWL  QN YREISSCS   +
Sbjct: 297 FEYLTTAAETILKKLCLPYRVVLLCSGDIGFAAHKTYDLEVWLPAQNCYREISSCSHFSS 356

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR  S+YR+  SK + F HT+NGSG+AVGR +IAILENY N DGSVTIP  LR YM 
Sbjct: 357 FQARRSLSKYRELCSKKVNFLHTINGSGLAVGRTIIAILENYQNPDGSVTIPEKLRNYMG 416

Query: 419 NLAVI 423
              +I
Sbjct: 417 GQKLI 421


>gi|257871364|ref|ZP_05651017.1| seryl-tRNA synthetase [Enterococcus gallinarum EG2]
 gi|257805528|gb|EEV34350.1| seryl-tRNA synthetase [Enterococcus gallinarum EG2]
          Length = 425

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/430 (47%), Positives = 284/430 (66%), Gaps = 11/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IRQN + +   L+ R ++ +  E  L LDE+ R L+ + E+++  RN  SA+I 
Sbjct: 1   MLDIKMIRQNFDKVQTKLQTRGVKKEVLEEFLKLDERRRQLLVETEELKKVRNEVSAEIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKE---QLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIG 116
           Q           A  N+ + +KE   ++  L+ E  ++ S +K + + +PN+P + VP+G
Sbjct: 61  QLKRAKK-----AADNKITEMKEVGTKIKSLDDEIAKIDSEIKLIATTLPNLPHDSVPVG 115

Query: 117 TSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLER 176
              ++N+ +R           ++ H++I E LG++DF+R  K++G+RF    G  A LER
Sbjct: 116 KDEDDNVEVRRWATPKEFDFEAKPHWDIAENLGILDFERGAKVAGSRFVYYKGLGARLER 175

Query: 177 ALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-GRWLIPTSEVS 235
           AL  FM+D H  EHGYTE+  P +V  +AM+GTGQ PKF +D+F   + G  LIPT+EV 
Sbjct: 176 ALYNFMLDQHVYEHGYTEMITPYIVNSDAMFGTGQFPKFKEDVFQLAETGLTLIPTAEVP 235

Query: 236 LTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDS 295
           LTN Y+ EI++   LP+ FT L+PSFRSEAGSAGRDTRG++R HQF K E+V ++  E S
Sbjct: 236 LTNYYNGEILDLDQLPVYFTALSPSFRSEAGSAGRDTRGLIRLHQFNKVEMVKLSEAEHS 295

Query: 296 FTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCST 355
           + E E+M + AE+IL++L L YRV++L TGD+GFSA KTYDLEVW+  Q  YREISSCS 
Sbjct: 296 YEELEKMTANAEDILQKLQLPYRVMALSTGDMGFSAAKTYDLEVWIPAQETYREISSCSN 355

Query: 356 CGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
           C +FQ+RR   RYRD N   + + HTLNGSG+AVGR + A+LENY N DGSVTIP VL P
Sbjct: 356 CEDFQARRAMIRYRD-NDGKIHYMHTLNGSGLAVGRTVAAVLENYQNEDGSVTIPEVLVP 414

Query: 416 YMNNLAVIKK 425
           YM  +  I+K
Sbjct: 415 YMGGVTRIEK 424


>gi|312876134|ref|ZP_07736122.1| seryl-tRNA synthetase [Caldicellulosiruptor lactoaceticus 6A]
 gi|311797120|gb|EFR13461.1| seryl-tRNA synthetase [Caldicellulosiruptor lactoaceticus 6A]
          Length = 420

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 196/418 (46%), Positives = 278/418 (66%), Gaps = 3/418 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD+++IR NPE +   L KR+ +     IL LDEK R L+ ++E ++A +N  S ++ +
Sbjct: 1   MLDLKYIRANPEKVQGGLSKRNKDISIAPILELDEKRRKLLAEVESLKALQNQKSKEVPK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG    V  L NE   L +++  L+    EV   ++K++  IPN+P E VP+G    
Sbjct: 61  LKKEGKD--VTELMNELKELSDKIKELDSRVKEVEDEIEKILLTIPNIPHESVPVGKDDT 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G         + H+EIG +LG++DF+RA+K+SG+RF+   G  A LERAL  
Sbjct: 119 ENVEVRRWGDVRVPDFEVKPHWEIGMSLGILDFERASKVSGSRFTFYRGLGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLH  +HGYTE+  P LV  ++M GTGQ+PKF +D F TTD  +LIPT+EV +TN +
Sbjct: 179 FMLDLHIEKHGYTEIFPPFLVARKSMIGTGQLPKFEEDAFKTTDDYFLIPTAEVPVTNYH 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ + LP+++   +  FR+EAG+AG+DTRG++RQHQF K ELV   + EDS+ E E
Sbjct: 239 REEILKEEDLPIKYVAYSACFRAEAGAAGKDTRGLIRQHQFNKVELVKFAKPEDSYDELE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           ++ + AE++LK L L YRVV LC+GDLGFS+ KTYD+EVW+     Y EISSCS   ++Q
Sbjct: 299 KLTADAEDVLKELGLPYRVVLLCSGDLGFSSAKTYDIEVWMPSYGRYVEISSCSNFESYQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           +RR N R+R  + K L + HTLNGSG+AVGR + AILEN+   DG+V +P VLR YM 
Sbjct: 359 ARRANIRFRRKDGK-LDYVHTLNGSGLAVGRTVAAILENFQQKDGTVVVPEVLRKYMG 415


>gi|82777585|ref|YP_403934.1| seryl-tRNA synthetase [Shigella dysenteriae Sd197]
 gi|309784010|ref|ZP_07678654.1| seryl-tRNA synthetase [Shigella dysenteriae 1617]
 gi|123769580|sp|Q32E12|SYS_SHIDS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|81241733|gb|ABB62443.1| serine tRNA synthetase; also charges selenocystein tRNA with serine
           [Shigella dysenteriae Sd197]
 gi|308928153|gb|EFP73616.1| seryl-tRNA synthetase [Shigella dysenteriae 1617]
          Length = 430

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/431 (46%), Positives = 271/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSCWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T        T    LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|322832176|ref|YP_004212203.1| seryl-tRNA synthetase [Rahnella sp. Y9602]
 gi|321167377|gb|ADW73076.1| seryl-tRNA synthetase [Rahnella sp. Y9602]
          Length = 430

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/431 (47%), Positives = 270/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R   + +   L +R  +   E + S +E+ ++L  + E ++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNELDAVAEKLARRGFKLDVETLRSQEERRKVLQVETETLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E +TL E+L   + E   + + ++ + S IPN+P + VP G   N
Sbjct: 61  AKARG--EDIEPLRLEVNTLGEKLDAAKAELDALQNDIRDIASAIPNMPDDSVPAGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N  +   G         R+H  +GE  G +DF  A KL+GARF V+ G +A + RAL Q
Sbjct: 119 DNQEVSRWGTPRQYDFTVRDHVSLGEMAGGLDFAAAVKLTGARFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLHT +HGY E   P LV  E +YGTGQ+PKF +D+F T        +    LIPT+
Sbjct: 179 FMLDLHTEQHGYLETYVPYLVNQETLYGTGQLPKFGEDLFHTKPLDEEAGSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI+E +SLPL+ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLTRDEILEEESLPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E +   AE++L+ L+L YR V LCTGD+GF +CKTYDLEVWL  Q+ YREISS
Sbjct: 299 EDSMDALEELTGHAEKVLQLLNLPYRKVLLCTGDMGFGSCKTYDLEVWLPAQDTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS  G+FQ+RRM +R R+   K  +  HTLNGSG+AVGR L+A+LENY  ADG + +P V
Sbjct: 359 CSNMGDFQARRMQARCRNKTDKKPRLVHTLNGSGLAVGRTLVAVLENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMGGLEYI 429


>gi|71274488|ref|ZP_00650776.1| Seryl-tRNA synthetase, class IIa [Xylella fastidiosa Dixon]
 gi|71898321|ref|ZP_00680494.1| Seryl-tRNA synthetase, class IIa [Xylella fastidiosa Ann-1]
 gi|170730591|ref|YP_001776024.1| seryl-tRNA synthetase [Xylella fastidiosa M12]
 gi|238687926|sp|B0U3G5|SYS_XYLFM RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|71164220|gb|EAO13934.1| Seryl-tRNA synthetase, class IIa [Xylella fastidiosa Dixon]
 gi|71731844|gb|EAO33902.1| Seryl-tRNA synthetase, class IIa [Xylella fastidiosa Ann-1]
 gi|167965384|gb|ACA12394.1| Serine--tRNA ligase [Xylella fastidiosa M12]
          Length = 426

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/392 (51%), Positives = 269/392 (68%), Gaps = 6/392 (1%)

Query: 35  EKNRILIKKIEDIRARRNSNSAQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEV 94
           E+ RI +   +++++ RNS S  IGQA ++G    V AL  E +   + L   E    E+
Sbjct: 37  ERKRIQVH-TQELQSLRNSKSKAIGQARSKGED--VSALMAEVAAFSDDLKASEIALEEI 93

Query: 95  CSSLKKLISCIPNVPLEEVPIGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFD 154
            + L+K+   IPN+P ++VP+G    EN+     G   +     ++H E+G   G +D +
Sbjct: 94  RTELEKVALDIPNLPQQDVPLGADERENVEQARWGVPRTFDFAIKDHVELGACHGWLDAE 153

Query: 155 RATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPK 214
            A KLSGARF+VL G +A L RAL Q M+DLH S+HGY EV+ P++V  ++++GTGQ+PK
Sbjct: 154 SAAKLSGARFTVLRGPIARLHRALAQCMLDLHVSQHGYEEVNVPIIVNADSLHGTGQLPK 213

Query: 215 FADDMFCTTDG---RWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRD 271
           F +DMF T  G   R+LI TSE+SLTNL  +EIIE+  LPLR    +  FRSEAGS GRD
Sbjct: 214 FEEDMFSTQLGEHRRYLISTSEISLTNLVRNEIIEADRLPLRMVAHSLCFRSEAGSGGRD 273

Query: 272 TRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSA 331
           TRGM+RQHQF K ELVS+ + ++S  EH RM  CAE +L+ L L YR + LCTGD+GF+A
Sbjct: 274 TRGMIRQHQFEKVELVSVCKPQESEGEHHRMTRCAETVLEMLGLPYRKILLCTGDMGFAA 333

Query: 332 CKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGR 391
            KTYDLEVWL  Q +YREISSCS CG+FQ+RRM +R+R+  +   +  HTLNGSGVAVGR
Sbjct: 334 TKTYDLEVWLPSQGMYREISSCSNCGDFQARRMQARWRNSVTGKPELVHTLNGSGVAVGR 393

Query: 392 CLIAILENYLNADGSVTIPTVLRPYMNNLAVI 423
            +IA++ENY NADGS+T+P VLRPYM+ L+ I
Sbjct: 394 AMIAVMENYQNADGSITVPEVLRPYMDGLSRI 425


>gi|237800569|ref|ZP_04589030.1| seryl-tRNA synthetase [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331023429|gb|EGI03486.1| seryl-tRNA synthetase [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 426

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/433 (46%), Positives = 281/433 (64%), Gaps = 18/433 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R        I SL+ + +++  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRTQLQDVADRLASRGFTLDVARIESLEAQRKVVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A   G      ++ V+ + NE S  K +L  ++ E       L  L+  IPN+P E VP+
Sbjct: 61  AKQRGEDIAPLMADVERMGNELSEGKVELDAIQAE-------LDALVLNIPNLPHESVPL 113

Query: 116 GTSANENILIRSVGKKPSAIHLS-REHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           G     N+ +R  G  P+A     ++H  +GE  G +DF+ A KLSGARF++L G +A L
Sbjct: 114 GADEEGNVEVRRWGT-PTAFDFEVKDHVALGEKFGWLDFETAAKLSGARFALLRGPIARL 172

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIP 230
            RAL QFM++LH +EHGY E   P LV+  A+ GTGQ+PKF +D+F  + +G    +LIP
Sbjct: 173 HRALAQFMLNLHINEHGYEEAYTPYLVQAPALQGTGQLPKFEEDLFKISREGEADLYLIP 232

Query: 231 TSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT 290
           T+EVSLTN+ S EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I 
Sbjct: 233 TAEVSLTNIVSGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIV 292

Query: 291 REEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREI 350
             +DS    E +   AE +L+ L+L YR ++LCTGD+GFSA KTYDLEVW+  Q+ YREI
Sbjct: 293 APDDSMAALESLTGNAERVLQLLELPYRTLALCTGDMGFSAVKTYDLEVWIPSQDKYREI 352

Query: 351 SSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIP 410
           SSCS CG+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P
Sbjct: 353 SSCSNCGDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVP 412

Query: 411 TVLRPYMNNLAVI 423
            VL+PYM  + VI
Sbjct: 413 EVLKPYMGGIEVI 425


>gi|315026714|gb|EFT38646.1| seryl-tRNA synthetase [Enterococcus faecalis TX2137]
          Length = 423

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 204/428 (47%), Positives = 283/428 (66%), Gaps = 11/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEY-ILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IRQN E +   LK R ++ +     L+LDE+ R L+ K+E+++  RN  S +I 
Sbjct: 1   MLDMKKIRQNVEVVQKKLKTRGVDEEVLLRFLALDEERRALLVKVEELKKHRNQVSGEIA 60

Query: 60  Q---AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIG 116
           Q   A  + +  L++        + EQ+ +L++E   +      +   +PN+P E VP+G
Sbjct: 61  QLKRAQKDASQQLLN-----MQEVSEQIKVLDQEVVHLQEQCTAIAERLPNLPHESVPVG 115

Query: 117 TSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLER 176
                N+ +R      +     + H+EIGEALG++DF+R  K+SG+RF    G  A LER
Sbjct: 116 ADEAANVEVRRWSTPKTFSFEPKPHWEIGEALGILDFERGAKVSGSRFLYYKGLGARLER 175

Query: 177 ALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVS 235
           A+  F++D H +EHGYTEV  P LV  +AM+GTGQ PKF +D+F   +    LIPT+EV 
Sbjct: 176 AVYNFLLDQHVNEHGYTEVIPPYLVNSKAMFGTGQFPKFKEDVFQVAESDLTLIPTAEVP 235

Query: 236 LTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDS 295
           LTN Y++EI++++ LP+ FT L+PSFRSEAGSAGRDTRG++R HQF K E+V  +  E S
Sbjct: 236 LTNYYNNEILDAQELPIYFTALSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVRFSDAEHS 295

Query: 296 FTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCST 355
           + E E+M + A +IL++L L YRV++L TGD+GFSA KTYDLEVW+  Q  YREISSCS 
Sbjct: 296 YEELEKMTNNAGDILEKLGLPYRVITLSTGDMGFSAAKTYDLEVWIPAQKTYREISSCSN 355

Query: 356 CGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
           C +FQ+RR   RYRD  +  +++ HTLNGSG+AVGR + AILENY N DG+VTIP VLRP
Sbjct: 356 CEDFQARRALIRYRD-KTGHVQYAHTLNGSGLAVGRTVAAILENYQNEDGTVTIPEVLRP 414

Query: 416 YMNNLAVI 423
           YM  L  I
Sbjct: 415 YMGGLTKI 422


>gi|126440240|ref|YP_001059999.1| seryl-tRNA synthetase [Burkholderia pseudomallei 668]
 gi|167903832|ref|ZP_02491037.1| seryl-tRNA synthetase [Burkholderia pseudomallei NCTC 13177]
 gi|254298870|ref|ZP_04966320.1| seryl-tRNA synthetase [Burkholderia pseudomallei 406e]
 gi|166201240|sp|A3NCC8|SYS_BURP6 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|126219733|gb|ABN83239.1| serine--tRNA ligase [Burkholderia pseudomallei 668]
 gi|157808968|gb|EDO86138.1| seryl-tRNA synthetase [Burkholderia pseudomallei 406e]
          Length = 433

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/430 (47%), Positives = 276/430 (64%), Gaps = 11/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R +  + E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDLDGVAKRLADRGYPLDVAAFSALEAERRAIQTRTEELQARRNSLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G  +   A+  E   + +++     +  E+ + L +L+  +PNVP E VP+G    
Sbjct: 61  MKGRGEDT--SAVMAEVGGIGDEMKASAVKLDEIQARLSELMLEMPNVPHESVPVGRDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G         ++H ++G  LGL DF+   KLSGARF+VL G +A L RAL Q
Sbjct: 119 ENVEVRRWGAPRQFDFDVKDHVDVGTPLGL-DFETGAKLSGARFTVLRGPIARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGY+E   P +V  + +YGTGQ+PKFA+DMF    G       ++LI TSE
Sbjct: 178 FMLDTHTQQHGYSETYTPYIVNPDVLYGTGQLPKFAEDMFRVEKGGAENTVTQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     IIE+ +LP++ T  +P FRSEAGS GRDTRGM+RQHQF K E+V I   E
Sbjct: 238 ISLTNTVRDSIIEASALPIKLTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQIVAPE 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   + M+  AE IL++L+L YRVV+LCTGD+GFSA KT+DLEVWL  QN YREISSC
Sbjct: 298 ASYAALDEMVGHAEAILQKLELPYRVVALCTGDMGFSAAKTFDLEVWLPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+A+LENY NADGSVT+P  L
Sbjct: 358 SNTESFQARRMQARFRNAQGKP-ELVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPVAL 416

Query: 414 RPYMNNLAVI 423
           RPYM  +  I
Sbjct: 417 RPYMGGVERI 426


>gi|255004361|ref|ZP_05279162.1| seryl-tRNA synthetase [Anaplasma marginale str. Virginia]
          Length = 429

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 209/436 (47%), Positives = 276/436 (63%), Gaps = 15/436 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ I+++PE  D A+  R    Q+E I+ LD K R  +  +  +R +RN+ + ++  
Sbjct: 1   MHDIELIKKDPELFDRAMISRGFGEQAEKIIELDLKKRGELSTLYSLREQRNAVTREVAL 60

Query: 61  AIAEG-----NLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
               G      +     L  E  TL+  +    KE+    + L  L+  +PNVP   VP+
Sbjct: 61  LKRSGIECTPQIEASKKLAEEIETLEHSI----KED----TKLSNLLESLPNVPDPIVPV 112

Query: 116 GTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLE 175
           G   + N+ +RS G++       R H+E+GE L L+DF RA  LSGARFS+L G LA LE
Sbjct: 113 GKDESHNVEVRSHGQRRDFAFGIRPHYELGEMLNLLDFKRAAVLSGARFSILKGQLAELE 172

Query: 176 RALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVS 235
           RAL  FM+D+HT E GYTE+S P+LV +  MY  GQ+PKF DD F TT+   L PTSEV+
Sbjct: 173 RALASFMLDMHTKEFGYTEISHPVLVNERTMYNVGQLPKFHDDSFRTTNNFRLAPTSEVA 232

Query: 236 LTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDS 295
           L NL S   +   SLP+RFT  +  FR+EAGSAG DTRGM+RQHQF K ELVSIT  + S
Sbjct: 233 LANLVSGTTLPRDSLPMRFTAYSQCFRAEAGSAGLDTRGMMRQHQFGKVELVSITTSDAS 292

Query: 296 FTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCST 355
             E ERM S AEE+LKRL+L YRV+ LC+GD+GFSA  +YDLEVW+  Q+ YREISSCS 
Sbjct: 293 NAELERMTSIAEEVLKRLELPYRVMLLCSGDMGFSASISYDLEVWMPAQDKYREISSCSN 352

Query: 356 CGNFQSRRMNSRY--RDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           C +FQ+RRM ++Y   +   K     HTLNGS +A+GR + AI+ENY N DGS+TIP VL
Sbjct: 353 CRDFQARRMGAKYFFFENKKKHSTLVHTLNGSALAIGRTIAAIMENYQNEDGSITIPDVL 412

Query: 414 RPYMNNLAVIKKEHIL 429
           R Y    A+++ E  L
Sbjct: 413 RKYTGASAIMRAEDAL 428


>gi|302871467|ref|YP_003840103.1| seryl-tRNA synthetase [Caldicellulosiruptor obsidiansis OB47]
 gi|302574326|gb|ADL42117.1| seryl-tRNA synthetase [Caldicellulosiruptor obsidiansis OB47]
          Length = 420

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 195/417 (46%), Positives = 280/417 (67%), Gaps = 3/417 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD+++IR NPE +   L KR+ +     IL LDEK R L+ ++E ++A +N  S ++ +
Sbjct: 1   MLDLKYIRANPEKVQEGLSKRNKDISIAPILELDEKRRKLLAEVESLKALQNQKSKEVPK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG    V  L NE   L +++  L+ +  +V   ++K++  IPN+P E VP+G    
Sbjct: 61  LKKEGKD--VTGLMNELKELSDKIKELDSKVKDVEDEIEKILLTIPNIPHESVPVGKDDT 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G+      + + H+EIG  LG++DF+RA+K+SG+RF+   G  A LERAL  
Sbjct: 119 ENVEVRRWGEVREPDFIIKPHWEIGVNLGILDFERASKVSGSRFTFYRGLGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLH  +HGYTE+  P LV  ++M GTGQ+PKF +D F TTD  +LIPT+EV +TN +
Sbjct: 179 FMLDLHIEKHGYTELFPPFLVARKSMIGTGQLPKFEEDAFKTTDDYFLIPTAEVPVTNYH 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ + LP+++   +  FR+EAG+AG+DTRG++RQHQF K ELV   + EDS+ E E
Sbjct: 239 REEILKEEDLPIKYVAYSACFRAEAGAAGKDTRGLIRQHQFNKVELVKFAKPEDSYDELE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           ++ + AE++L+ L L YRVV LC+GDLGFS+ KTYD+EVW+     Y EISSCS   ++Q
Sbjct: 299 KLTADAEDVLRELGLPYRVVLLCSGDLGFSSAKTYDIEVWMPSYGRYVEISSCSNFESYQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +RR N R+R  + K L + HTLNGSG+AVGR L AILEN+   DG+V +P VLR YM
Sbjct: 359 ARRANIRFRRKDGK-LDYVHTLNGSGLAVGRTLAAILENFQQKDGTVVVPEVLRRYM 414


>gi|261365211|ref|ZP_05978094.1| serine--tRNA ligase [Neisseria mucosa ATCC 25996]
 gi|288566473|gb|EFC88033.1| serine--tRNA ligase [Neisseria mucosa ATCC 25996]
          Length = 431

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/431 (46%), Positives = 273/431 (63%), Gaps = 9/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R +   +   L +R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQQLRSHTAAVAERLAQRGYEFDTARFNALEEQRKAVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPAGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMKGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTLKHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDESKKTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  I+    LPL+ T  +P FRSEAG+ G+D RG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIVAGSDLPLKLTAHSPCFRSEAGAYGKDVRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIK 424
           +PYM  +  I+
Sbjct: 419 QPYMGGVEKIE 429


>gi|108757304|ref|YP_630179.1| seryl-tRNA synthetase [Myxococcus xanthus DK 1622]
 gi|122981222|sp|Q1DAZ4|SYS_MYXXD RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|108461184|gb|ABF86369.1| seryl-tRNA synthetase [Myxococcus xanthus DK 1622]
          Length = 426

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 206/426 (48%), Positives = 277/426 (65%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++ + QN + +   LK R           L  + R L   +E + ARRN+ + ++ +
Sbjct: 1   MLDLRNVAQNFDAVVARLKTRGGNLDLGPFQRLFAERRELYVSVESLAARRNAANEEMKR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              E   +L DAL+ +   + +++   E    +V   L +++  IPNVP E VP G  A 
Sbjct: 61  KAKEDPKAL-DALRGDLRAVSQEIKEKEARLKDVEEELNRILLLIPNVPHESVPEGGGAE 119

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G+KP  +   ++HFE+GE LG++DF+RA K+SG+RF+   G LA LERAL  
Sbjct: 120 DNVQVSIWGQKPDLLFAPKQHFELGEKLGMLDFERAAKVSGSRFTFYKGALARLERALVT 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG--RWLIPTSEVSLTN 238
           FMID+HTS+ GYTE+  P LV  E M GTGQ+PKF DD F T     R+LIPT+EV +TN
Sbjct: 180 FMIDVHTSK-GYTELLPPYLVLRETMMGTGQLPKFEDDAFKTLGEPERFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            ++ EI+E +SLP+R+   +PSFR+EAG+AG+DTRG++RQHQF K ELV    +E S  E
Sbjct: 239 YHADEILEGESLPIRYCAFSPSFRAEAGAAGKDTRGLIRQHQFHKVELVKFAHQEKSLDE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E M   A +IL+RL +H+RV+ LCTGD+GF+A KTYD+EVWL GQN YREISSCS CG+
Sbjct: 299 LEAMTDDACDILRRLGIHHRVMLLCTGDMGFAARKTYDIEVWLPGQNSYREISSCSDCGD 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   RYR       +  HTLNGSG+AVGR  IAILENY   DGSV IP  L PYM 
Sbjct: 359 FQARRAKIRYRAQRGDKPQLAHTLNGSGLAVGRTTIAILENYQREDGSVAIPEALVPYMG 418

Query: 419 NLAVIK 424
            L  +K
Sbjct: 419 GLKELK 424


>gi|332091134|gb|EGI96224.1| seryl-tRNA synthetase [Shigella dysenteriae 155-74]
          Length = 430

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/431 (46%), Positives = 270/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T        T    LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R    K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKPDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|323143152|ref|ZP_08077851.1| serine--tRNA ligase [Succinatimonas hippei YIT 12066]
 gi|322417079|gb|EFY07714.1| serine--tRNA ligase [Succinatimonas hippei YIT 12066]
          Length = 436

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/439 (46%), Positives = 288/439 (65%), Gaps = 14/439 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD +++R   +     L  R+ +   E +  L+E  + L+ + +D++A+RNS S  IGQ
Sbjct: 1   MLDSKYLRSELKETAERLATRNYKLDVEKLTKLEEMRKDLMVRTQDLQAKRNSMSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A  EG    +  +KNE + + ++L +++ E+ +V + + ++   +PN+P   +PIG   +
Sbjct: 61  AKREGKD--ITEIKNEVAKIGDELDVVKAEQDKVLAQINEIALTVPNLPDASLPIGPDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ IR VG         ++H  +GE LG++DF  A K+SGARF+V+TG +  L RAL  
Sbjct: 119 ANLEIRRVGTPRKFDFPIKDHVALGEGLGMLDFANARKISGARFAVMTGPICALHRALVH 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT-----DGR------WLI 229
           +M+DLH    GYTEV  P LV  +++YGTGQ+PKF +D+F T+     DG        LI
Sbjct: 179 YMLDLHCKHQGYTEVYVPYLVNLDSLYGTGQMPKFGEDLFHTSLNGNADGDDVNRHFCLI 238

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV LTN+   EII  + LP++ T   P FRSEAGSAGRDTRG++R HQF K E+V I
Sbjct: 239 PTAEVPLTNMVRGEIIPEEKLPIKVTAHTPCFRSEAGSAGRDTRGLIRMHQFDKVEMVQI 298

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
            R EDS+   E +   AE +L+ L+L YRV++L TGD+GFS+ KTYDLEVWL  QN YRE
Sbjct: 299 VRPEDSWEALEILTHDAEAVLQGLELPYRVMTLSTGDIGFSSAKTYDLEVWLPAQNTYRE 358

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS C +FQ+RRM +R R  + K ++  HTLNGSG+AVGR L+A++ENY N DGS+T+
Sbjct: 359 ISSCSNCTDFQARRMQARVRRKDGK-IELVHTLNGSGLAVGRTLVAVMENYQNEDGSITV 417

Query: 410 PTVLRPYMNNLAVIKKEHI 428
           P VLRPY+++  VI KE +
Sbjct: 418 PKVLRPYLDDREVITKESM 436


>gi|261381397|ref|ZP_05985970.1| serine--tRNA ligase [Neisseria subflava NJ9703]
 gi|284795610|gb|EFC50957.1| serine--tRNA ligase [Neisseria subflava NJ9703]
          Length = 431

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 198/427 (46%), Positives = 270/427 (63%), Gaps = 9/427 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L  R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLAARGYEFDTARFNALEEQRKAVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP+G    
Sbjct: 61  LKGQGKHEEAQAAMDQVTQIKADLEQAAADLDAVQKELDAWLLSIPNLPHESVPVGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMKGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTLKHGYTEHYTPYIVDDLTLQGTGQLPKFAEDLFHVTRGGDESKKTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  I+     PL+ T  +P FRSEAG+ G+D RG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIVAGSDFPLKLTAHSPCFRSEAGAYGKDVRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ +P  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINVPAAL 418

Query: 414 RPYMNNL 420
           +PYM  +
Sbjct: 419 QPYMGGV 425


>gi|194435163|ref|ZP_03067396.1| seryl-tRNA synthetase [Shigella dysenteriae 1012]
 gi|194416601|gb|EDX32737.1| seryl-tRNA synthetase [Shigella dysenteriae 1012]
          Length = 430

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/431 (46%), Positives = 270/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T        T    LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQMPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R    K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKPDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|307708238|ref|ZP_07644705.1| seryl-tRNA synthetase [Streptococcus mitis NCTC 12261]
 gi|307615684|gb|EFN94890.1| seryl-tRNA synthetase [Streptococcus mitis NCTC 12261]
          Length = 424

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/426 (47%), Positives = 277/426 (65%), Gaps = 5/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IR + + +   L  R ++      +  +D K R ++ K+E ++A RN+ SA+I 
Sbjct: 1   MLDIKRIRTDFDAVAEKLATRGVDAAILNEMKEIDAKRRDILVKVETLKAERNTVSAEIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA  + N    D       TL  ++  L+ E  E+ + L +  + +PN+P + VP+G   
Sbjct: 61  QA--KRNKENADDKIAAMQTLSAEVKALDAELAEIDAKLTEFTTTLPNIPADSVPVGVDE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+ +R  G         + H+++GE LG++D++R  K++GARF    G  A LERA+ 
Sbjct: 119 DDNVEVRRWGTPREFDFEPKAHWDLGEDLGILDWERGGKVTGARFLFYKGLGARLERAIY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLTN 238
            FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+EV LTN
Sbjct: 179 NFMLDEHGKE-GYTEVITPYMVNHDSMFGTGQYPKFKEDTFELSDSNYVLIPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E+S+ E
Sbjct: 238 YYRDEILDGKDLPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESYEE 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M + AE IL++L+L YRVV+L TGD+GFSA KTYDLEVW+  QN YREISSCS   +
Sbjct: 298 LEKMTANAENILQKLNLPYRVVALSTGDMGFSAAKTYDLEVWIPAQNTYREISSCSNTED 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP  LRPYM 
Sbjct: 358 FQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEALRPYMG 417

Query: 419 NLAVIK 424
              VIK
Sbjct: 418 GAEVIK 423


>gi|327462380|gb|EGF08705.1| serine--tRNA ligase [Streptococcus sanguinis SK1057]
          Length = 425

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/430 (46%), Positives = 282/430 (65%), Gaps = 15/430 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IR + + +   L  R ++  +   + ++D++ R L+ K+E+++A RN+ SA+I 
Sbjct: 1   MLDLKRIRTDFDSVAEKLATRGVDAATLNQMKTIDKERRDLLVKVEELKAERNTVSAEIA 60

Query: 60  QAI-----AEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVP 114
           QA      A+  ++ +  L +E   L   L        E+ + L +  + +PN+P   VP
Sbjct: 61  QAKRNKENADNKIAAMQKLSSEVKNLDASLA-------ELDAKLTEFTTTLPNIPHGSVP 113

Query: 115 IGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           +G   +EN+ +R  G        ++ H+++GE L ++D++R  K++GARF    G  A L
Sbjct: 114 VGADEDENVEVRRWGTPRQFDFEAKAHWDLGEDLDILDWERGAKVTGARFLFYKGLGARL 173

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSE 233
           ERA+  FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+E
Sbjct: 174 ERAIYNFMLDEHGKE-GYTEVITPYMVNHDSMFGTGQYPKFKEDTFELSDTNFVLIPTAE 232

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V LTN Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E
Sbjct: 233 VPLTNYYRDEILDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPE 292

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
           +S+ E E+M + AE IL++L+L YRVV+LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 293 ESYQELEKMTANAENILQKLNLPYRVVALCTGDMGFSAAKTYDLEVWIPAQNTYREISSC 352

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP VL
Sbjct: 353 SNTEDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVL 412

Query: 414 RPYMNNLAVI 423
           RPYM  L VI
Sbjct: 413 RPYMGGLEVI 422


>gi|301793653|emb|CBW36038.1| seryl-tRNA synthetase [Streptococcus pneumoniae INV104]
          Length = 424

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 204/428 (47%), Positives = 280/428 (65%), Gaps = 9/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IR + E +   L  R ++      +  +D K R ++ K+E ++A RN+ SA+I 
Sbjct: 1   MLDIKRIRTDFEAVAEKLATRGVDAAVLNEMKEIDAKRRNILVKVETLKAERNTVSAEIA 60

Query: 60  QAI--AEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGT 117
           QA    E     + A++N    L  ++  L+ E  E+ + L +  + +PN+P + VP+GT
Sbjct: 61  QAKRNKENTDDKIAAMQN----LSAEVKALDAELAEIDAKLTEFTTTLPNIPADSVPVGT 116

Query: 118 SANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
             ++N+ +R  G         + H+++GE LG++D++R  K++GARF    G  A LERA
Sbjct: 117 DEDDNVEVRRWGTPREFDFEPKAHWDLGEDLGILDWERGGKVTGARFLFYKGLGARLERA 176

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSL 236
           +  FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+EV L
Sbjct: 177 IYNFMLDEHGKE-GYTEVITPYIVNHDSMFGTGQYPKFKEDTFELSDTNFVLIPTAEVPL 235

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E+S+
Sbjct: 236 TNYYRDEILDGKDLPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESY 295

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            E E+M + AE IL++L+L YRVV+L TGD+GFSA KTYDLEVW+  QN YREISSCS  
Sbjct: 296 EELEKMTANAENILQKLNLPYRVVALSTGDMGFSAAKTYDLEVWIPAQNNYREISSCSNT 355

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
            +FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP  LRPY
Sbjct: 356 EDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEALRPY 415

Query: 417 MNNLAVIK 424
           M    VIK
Sbjct: 416 MGGAEVIK 423


>gi|301063988|ref|ZP_07204453.1| serine--tRNA ligase [delta proteobacterium NaphS2]
 gi|300441899|gb|EFK06199.1| serine--tRNA ligase [delta proteobacterium NaphS2]
          Length = 428

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/429 (47%), Positives = 277/429 (64%), Gaps = 9/429 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++++R N E +   ++ R  +       +LDEK R  +  +E +R  RN+ S  I  
Sbjct: 1   MLDLKFVRSNLEDIKKMIRNRGYDLDVSQFDALDEKRREQLSVLEALRHHRNTVSDNIAT 60

Query: 61  AIAEGN--LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTS 118
               G    +++  +K  ++ +KE+    EKE  +V   L +L+  IPN+P   VP+G  
Sbjct: 61  MKKNGKDASNVIAEMKTVSAQIKEK----EKELPDVVEKLDQLLQLIPNIPDPSVPVGKD 116

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
             +N +IR+ G        +  H+EIGE LG++DF RA KLSGARF++  G  A LERAL
Sbjct: 117 EKDNPVIRTWGDIRDFPFEALPHWEIGENLGILDFARAAKLSGARFALYRGAGAALERAL 176

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGR--WLIPTSEVSL 236
             FMI +HT+EHGYTE+  P +V   +M+GTGQ+PKF +D+F    GR  +LIPT+EV +
Sbjct: 177 INFMIHIHTTEHGYTEILPPFMVNAASMFGTGQLPKFEEDLF-KVKGRDLYLIPTAEVPV 235

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN++  E+++   LP  +    P FRSEAGS G+DTRG++RQHQF K ELV  ++ EDS+
Sbjct: 236 TNMHREEVLQEDDLPAAYVAYTPCFRSEAGSYGKDTRGLIRQHQFNKVELVKFSKPEDSY 295

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            E E++   AEEIL+RL+L YRVV+LCTGD+GFSA KTYDLEVWL GQ LYREISSCS  
Sbjct: 296 HELEKLTQNAEEILRRLELPYRVVTLCTGDIGFSAAKTYDLEVWLPGQGLYREISSCSNF 355

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
             FQ+RR N R++       +  HTLNGSG+AVGR ++AILENY   DGSV IP  LRP+
Sbjct: 356 VEFQARRANIRFKRKGKSGNELVHTLNGSGLAVGRTVVAILENYQREDGSVEIPEALRPF 415

Query: 417 MNNLAVIKK 425
           M  +  I K
Sbjct: 416 MGGIIEIAK 424


>gi|315574025|gb|EFU86216.1| seryl-tRNA synthetase [Enterococcus faecalis TX0309B]
 gi|315581976|gb|EFU94167.1| seryl-tRNA synthetase [Enterococcus faecalis TX0309A]
          Length = 423

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 204/428 (47%), Positives = 282/428 (65%), Gaps = 11/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEY-ILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IRQN E +   LK R ++ +     L+LDE  R L+ K+E+++  RN  S +I 
Sbjct: 1   MLDMKKIRQNVEVVQKKLKTRGVDEEVLLRFLALDEGRRALLVKVEELKKHRNQVSGEIA 60

Query: 60  Q---AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIG 116
           Q   A  + +  L++        + EQ+ +L++E   +      +   +PN+P E VP+G
Sbjct: 61  QLKRAQKDASQQLLN-----MQEVSEQIKVLDQEVVHLQEQCTAIAERLPNLPHESVPVG 115

Query: 117 TSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLER 176
                N+ +R      +     + H+EIGEALG++DF+R  K+SG+RF    G  A LER
Sbjct: 116 ADEAANVEVRRWSTPKTFSFEPKPHWEIGEALGILDFERGAKVSGSRFLYYKGLGARLER 175

Query: 177 ALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVS 235
           A+  FM+D H +EHGYTEV  P LV  +A++GTGQ PKF +D+F   +    LIPT+EV 
Sbjct: 176 AVYNFMLDQHVNEHGYTEVIPPYLVNSKAIFGTGQFPKFKEDVFQVAESDLTLIPTAEVP 235

Query: 236 LTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDS 295
           LTN Y++EI++++ LP+ FT L+PSFRSEAGSAGRDTRG++R HQF K E+V  +  E S
Sbjct: 236 LTNYYNNEILDAQELPIYFTALSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFSDAEHS 295

Query: 296 FTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCST 355
           + E E+M + A +IL++L L YRV++L TGD+GFSA KTYDLEVW+  Q  YREISSCS 
Sbjct: 296 YEELEKMTNNAGDILEKLGLPYRVITLSTGDMGFSAAKTYDLEVWIPAQKTYREISSCSN 355

Query: 356 CGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
           C +FQ+RR   RYRD  +  +++ HTLNGSG+AVGR + AILENY N DG+VTIP VLRP
Sbjct: 356 CEDFQARRALIRYRD-KTGHVQYAHTLNGSGLAVGRTVAAILENYQNEDGTVTIPEVLRP 414

Query: 416 YMNNLAVI 423
           YM  L  I
Sbjct: 415 YMGGLTKI 422


>gi|9107447|gb|AAF85085.1|AE004040_10 seryl-tRNA synthetase [Xylella fastidiosa 9a5c]
          Length = 432

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/393 (50%), Positives = 270/393 (68%), Gaps = 8/393 (2%)

Query: 35  EKNRILIKKIEDIRARRNSNSAQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEV 94
           E+ RI +   +++++ RNS S  IGQA ++G    V +L  E +   + L   E    E+
Sbjct: 43  ERKRIQVH-TQELQSLRNSKSKAIGQARSKGE--DVSSLMAEVAAFSDDLKASEIALEEI 99

Query: 95  CSSLKKLISCIPNVPLEEVPIGTSANENILIRSVGKKPSAIHLS-REHFEIGEALGLMDF 153
            + L+K+   IPN+P ++VP+G    +N+     G  P     S ++H E+G   G +D 
Sbjct: 100 RTELEKVALGIPNLPQQDVPLGADERDNVEQARWG-VPRTFDFSIKDHVELGACHGWLDA 158

Query: 154 DRATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIP 213
           + A KLSGARF+VL G +A L RAL Q M+DLH  +HGY EV+ P++V  +++YGTGQ+P
Sbjct: 159 ESAAKLSGARFTVLRGPIARLHRALAQCMLDLHVRQHGYEEVNVPIIVNADSLYGTGQLP 218

Query: 214 KFADDMFCTTDG---RWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGR 270
           KF +DMF T  G   R+LI TSE+SLTNL  +EIIE+  LPLR    +  FRSEAGS GR
Sbjct: 219 KFEEDMFSTQLGEHRRYLISTSEISLTNLVRNEIIEADRLPLRMAAHSLCFRSEAGSGGR 278

Query: 271 DTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFS 330
           DTRGM+RQHQF K ELVS+ + ++S  EH+RM  CAE +L+ L L YR + LCTGD+GF+
Sbjct: 279 DTRGMIRQHQFEKVELVSVCKPQESEGEHQRMTRCAETVLEMLGLPYRKILLCTGDMGFA 338

Query: 331 ACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVG 390
           A KTYDLEVWL  Q +YREISSCS CG+FQ+RRM +R+R+  +   +  HTLNGSGVAVG
Sbjct: 339 ATKTYDLEVWLPSQGMYREISSCSNCGDFQARRMQARWRNSVTGKPELVHTLNGSGVAVG 398

Query: 391 RCLIAILENYLNADGSVTIPTVLRPYMNNLAVI 423
           R +IA++ENY NADGS+T+P VLRPYM+ L+ I
Sbjct: 399 RAMIAVMENYQNADGSITVPEVLRPYMDGLSRI 431


>gi|53720210|ref|YP_109196.1| seryl-tRNA synthetase [Burkholderia pseudomallei K96243]
 gi|53725981|ref|YP_103689.1| seryl-tRNA synthetase [Burkholderia mallei ATCC 23344]
 gi|67643953|ref|ZP_00442696.1| serine--tRNA ligase [Burkholderia mallei GB8 horse 4]
 gi|76811815|ref|YP_334445.1| seryl-tRNA synthetase [Burkholderia pseudomallei 1710b]
 gi|121599178|ref|YP_992139.1| seryl-tRNA synthetase [Burkholderia mallei SAVP1]
 gi|124384403|ref|YP_001028583.1| seryl-tRNA synthetase [Burkholderia mallei NCTC 10229]
 gi|126450411|ref|YP_001081518.1| seryl-tRNA synthetase [Burkholderia mallei NCTC 10247]
 gi|126454758|ref|YP_001067277.1| seryl-tRNA synthetase [Burkholderia pseudomallei 1106a]
 gi|134280315|ref|ZP_01767026.1| seryl-tRNA synthetase [Burkholderia pseudomallei 305]
 gi|166998315|ref|ZP_02264175.1| serine--tRNA ligase [Burkholderia mallei PRL-20]
 gi|167739749|ref|ZP_02412523.1| seryl-tRNA synthetase [Burkholderia pseudomallei 14]
 gi|167816969|ref|ZP_02448649.1| seryl-tRNA synthetase [Burkholderia pseudomallei 91]
 gi|167851461|ref|ZP_02476969.1| seryl-tRNA synthetase [Burkholderia pseudomallei B7210]
 gi|167912098|ref|ZP_02499189.1| seryl-tRNA synthetase [Burkholderia pseudomallei 112]
 gi|217420921|ref|ZP_03452426.1| serine--tRNA ligase [Burkholderia pseudomallei 576]
 gi|237813402|ref|YP_002897853.1| serine--tRNA ligase [Burkholderia pseudomallei MSHR346]
 gi|242317656|ref|ZP_04816672.1| serine--tRNA ligase [Burkholderia pseudomallei 1106b]
 gi|254175570|ref|ZP_04882230.1| seryl-tRNA synthetase [Burkholderia mallei ATCC 10399]
 gi|254181010|ref|ZP_04887608.1| seryl-tRNA synthetase [Burkholderia pseudomallei 1655]
 gi|254191854|ref|ZP_04898357.1| seryl-tRNA synthetase [Burkholderia pseudomallei Pasteur 52237]
 gi|254196127|ref|ZP_04902552.1| seryl-tRNA synthetase [Burkholderia pseudomallei S13]
 gi|254202385|ref|ZP_04908748.1| seryl-tRNA synthetase [Burkholderia mallei FMH]
 gi|254207717|ref|ZP_04914067.1| seryl-tRNA synthetase [Burkholderia mallei JHU]
 gi|254260671|ref|ZP_04951725.1| serine--tRNA ligase [Burkholderia pseudomallei 1710a]
 gi|254356383|ref|ZP_04972659.1| seryl-tRNA synthetase [Burkholderia mallei 2002721280]
 gi|67461699|sp|Q62HY1|SYS_BURMA RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|67461707|sp|Q63RS1|SYS_BURPS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|123598315|sp|Q3JPQ8|SYS_BURP1 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|166200607|sp|A3MMN2|SYS_BURM7 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|166201237|sp|A2S9G4|SYS_BURM9 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|166201238|sp|A1V1N6|SYS_BURMS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|166201239|sp|A3NY56|SYS_BURP0 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|52210624|emb|CAH36608.1| seryl-tRNA synthetase [Burkholderia pseudomallei K96243]
 gi|52429404|gb|AAU49997.1| seryl-tRNA synthetase [Burkholderia mallei ATCC 23344]
 gi|76581268|gb|ABA50743.1| seryl-tRNA synthetase [Burkholderia pseudomallei 1710b]
 gi|121227988|gb|ABM50506.1| seryl-tRNA synthetase [Burkholderia mallei SAVP1]
 gi|124292423|gb|ABN01692.1| serine--tRNA ligase [Burkholderia mallei NCTC 10229]
 gi|126228400|gb|ABN91940.1| seryl-tRNA synthetase [Burkholderia pseudomallei 1106a]
 gi|126243281|gb|ABO06374.1| serine--tRNA ligase [Burkholderia mallei NCTC 10247]
 gi|134248322|gb|EBA48405.1| seryl-tRNA synthetase [Burkholderia pseudomallei 305]
 gi|147746632|gb|EDK53709.1| seryl-tRNA synthetase [Burkholderia mallei FMH]
 gi|147751611|gb|EDK58678.1| seryl-tRNA synthetase [Burkholderia mallei JHU]
 gi|148025380|gb|EDK83534.1| seryl-tRNA synthetase [Burkholderia mallei 2002721280]
 gi|157939525|gb|EDO95195.1| seryl-tRNA synthetase [Burkholderia pseudomallei Pasteur 52237]
 gi|160696614|gb|EDP86584.1| seryl-tRNA synthetase [Burkholderia mallei ATCC 10399]
 gi|169652871|gb|EDS85564.1| seryl-tRNA synthetase [Burkholderia pseudomallei S13]
 gi|184211549|gb|EDU08592.1| seryl-tRNA synthetase [Burkholderia pseudomallei 1655]
 gi|217396333|gb|EEC36350.1| serine--tRNA ligase [Burkholderia pseudomallei 576]
 gi|237505314|gb|ACQ97632.1| serine--tRNA ligase [Burkholderia pseudomallei MSHR346]
 gi|238525426|gb|EEP88854.1| serine--tRNA ligase [Burkholderia mallei GB8 horse 4]
 gi|242140895|gb|EES27297.1| serine--tRNA ligase [Burkholderia pseudomallei 1106b]
 gi|243065387|gb|EES47573.1| serine--tRNA ligase [Burkholderia mallei PRL-20]
 gi|254219360|gb|EET08744.1| serine--tRNA ligase [Burkholderia pseudomallei 1710a]
          Length = 433

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/430 (46%), Positives = 276/430 (64%), Gaps = 11/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R +  + E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDLDGVAKRLADRGYPLDVAAFSALEAERRAIQTRTEELQARRNSLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G  +   A+  E   + +++     +  E+ + L +L+  +PNVP E VP+G    
Sbjct: 61  MKGRGEDT--SAVMAEVGGIGDEMKASAVKLDEIQARLSELMLEMPNVPHESVPVGRDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G         ++H ++G  LGL DF+   KLSGARF+VL G +A L RAL Q
Sbjct: 119 ENVEVRRWGAPRQFDFDVKDHVDVGTPLGL-DFETGAKLSGARFTVLRGPIARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGY+E   P +V  + +YGTGQ+PKFA+DMF    G       ++LI TSE
Sbjct: 178 FMLDTHTQQHGYSETYTPYIVNPDVLYGTGQLPKFAEDMFRVEKGGAENTVTQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     I+E+ +LP++ T  +P FRSEAGS GRDTRGM+RQHQF K E+V I   E
Sbjct: 238 ISLTNTVRDSIVEASALPIKLTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQIVAPE 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   + M+  AE IL++L+L YRVV+LCTGD+GFSA KT+DLEVWL  QN YREISSC
Sbjct: 298 ASYAALDEMVGHAEAILQKLELPYRVVALCTGDMGFSAAKTFDLEVWLPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+A+LENY NADGSVT+P  L
Sbjct: 358 SNTESFQARRMQARFRNAQGKP-ELVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPVAL 416

Query: 414 RPYMNNLAVI 423
           RPYM  +  I
Sbjct: 417 RPYMGGVERI 426


>gi|69247503|ref|ZP_00604373.1| Seryl-tRNA synthetase, class IIa [Enterococcus faecium DO]
 gi|257878632|ref|ZP_05658285.1| seryl-tRNA synthetase [Enterococcus faecium 1,230,933]
 gi|257881297|ref|ZP_05660950.1| seryl-tRNA synthetase [Enterococcus faecium 1,231,502]
 gi|257890514|ref|ZP_05670167.1| seryl-tRNA synthetase [Enterococcus faecium 1,231,410]
 gi|257893090|ref|ZP_05672743.1| seryl-tRNA synthetase [Enterococcus faecium 1,231,408]
 gi|258615286|ref|ZP_05713056.1| seryl-tRNA synthetase [Enterococcus faecium DO]
 gi|260558212|ref|ZP_05830408.1| seryl-tRNA synthetase [Enterococcus faecium C68]
 gi|293563863|ref|ZP_06678294.1| seryl-tRNA synthetase [Enterococcus faecium E1162]
 gi|293569174|ref|ZP_06680480.1| seryl-tRNA synthetase [Enterococcus faecium E1071]
 gi|294623744|ref|ZP_06702572.1| seryl-tRNA synthetase [Enterococcus faecium U0317]
 gi|314940146|ref|ZP_07847326.1| seryl-tRNA synthetase [Enterococcus faecium TX0133a04]
 gi|314943022|ref|ZP_07849826.1| seryl-tRNA synthetase [Enterococcus faecium TX0133C]
 gi|314948140|ref|ZP_07851536.1| seryl-tRNA synthetase [Enterococcus faecium TX0082]
 gi|314953446|ref|ZP_07856364.1| seryl-tRNA synthetase [Enterococcus faecium TX0133A]
 gi|314993814|ref|ZP_07859151.1| seryl-tRNA synthetase [Enterococcus faecium TX0133B]
 gi|314998160|ref|ZP_07863042.1| seryl-tRNA synthetase [Enterococcus faecium TX0133a01]
 gi|68194828|gb|EAN09303.1| Seryl-tRNA synthetase, class IIa [Enterococcus faecium DO]
 gi|257812860|gb|EEV41618.1| seryl-tRNA synthetase [Enterococcus faecium 1,230,933]
 gi|257816955|gb|EEV44283.1| seryl-tRNA synthetase [Enterococcus faecium 1,231,502]
 gi|257826874|gb|EEV53500.1| seryl-tRNA synthetase [Enterococcus faecium 1,231,410]
 gi|257829469|gb|EEV56076.1| seryl-tRNA synthetase [Enterococcus faecium 1,231,408]
 gi|260075386|gb|EEW63692.1| seryl-tRNA synthetase [Enterococcus faecium C68]
 gi|291588143|gb|EFF19985.1| seryl-tRNA synthetase [Enterococcus faecium E1071]
 gi|291596698|gb|EFF27921.1| seryl-tRNA synthetase [Enterococcus faecium U0317]
 gi|291604174|gb|EFF33677.1| seryl-tRNA synthetase [Enterococcus faecium E1162]
 gi|313587872|gb|EFR66717.1| seryl-tRNA synthetase [Enterococcus faecium TX0133a01]
 gi|313591737|gb|EFR70582.1| seryl-tRNA synthetase [Enterococcus faecium TX0133B]
 gi|313594549|gb|EFR73394.1| seryl-tRNA synthetase [Enterococcus faecium TX0133A]
 gi|313598222|gb|EFR77067.1| seryl-tRNA synthetase [Enterococcus faecium TX0133C]
 gi|313640651|gb|EFS05231.1| seryl-tRNA synthetase [Enterococcus faecium TX0133a04]
 gi|313645394|gb|EFS09974.1| seryl-tRNA synthetase [Enterococcus faecium TX0082]
          Length = 423

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 205/428 (47%), Positives = 280/428 (65%), Gaps = 9/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ +RQN E +   L  R ++ ++    + LDE  R L+ K E+++  RN  SA+I 
Sbjct: 1   MLDVKMMRQNIEEVQEKLMTRGVKKETLAEFMELDENRRKLLVKSEELKKYRNDVSAEIA 60

Query: 60  Q--AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGT 117
           Q     E   + +  +K     +K     L+ E  EV   LK++ + +PN+P + VP+GT
Sbjct: 61  QLKRAKEDASAKIAEMKEVGGNIK----ALDTEIAEVDEKLKQIATTLPNLPHDSVPVGT 116

Query: 118 SANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
              +N+ IR   +  +     + H+EI E L ++DF+R  K++G+RF    G  A LERA
Sbjct: 117 DEEDNVEIRRWSEPRTFAFEPKPHWEIAENLDILDFERGAKVAGSRFVYYKGLGARLERA 176

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSL 236
           +  FM+D H  EHGYTE+  P +V  +AM+GTGQ PKF +D+F   +    LIPT+EV L
Sbjct: 177 VYNFMLDQHIYEHGYTEMITPYIVNSKAMFGTGQFPKFKEDVFQLENTDLTLIPTAEVPL 236

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN Y+ EI++   LP+ FT L+P+FRSEAGSAGRDTRG++R HQF K E+V  +  E S+
Sbjct: 237 TNYYNDEILDGADLPIYFTALSPAFRSEAGSAGRDTRGLIRLHQFNKVEMVKFSDVEHSY 296

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            E E+M + AE+ILK+L L YRV++L TGD+GFSA KTYDLEVW+  Q+ YREISSCS C
Sbjct: 297 EELEKMTADAEDILKKLHLPYRVMALSTGDMGFSAAKTYDLEVWIPAQDTYREISSCSNC 356

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
            +FQ+RR   RYRD N   + +THTLNGSG+AVGR + AILENY N DGSVT+P  L PY
Sbjct: 357 EDFQARRAMIRYRD-NDGKIHYTHTLNGSGLAVGRTVAAILENYQNEDGSVTVPEALVPY 415

Query: 417 MNNLAVIK 424
           M NL VIK
Sbjct: 416 MGNLKVIK 423


>gi|255066517|ref|ZP_05318372.1| serine--tRNA ligase [Neisseria sicca ATCC 29256]
 gi|255049101|gb|EET44565.1| serine--tRNA ligase [Neisseria sicca ATCC 29256]
          Length = 431

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 199/427 (46%), Positives = 272/427 (63%), Gaps = 9/427 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R +   +   L +R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQQLRSHTAAVAERLAQRGYEFDTARFNALEEQRKAVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP+G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPVGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMKGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTLKHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDESKKTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  I+    LPL+ T  +P FRSEAG+ G+D RG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSILAEGDLPLKLTAHSPCFRSEAGAYGKDVRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNL 420
           +PYM  +
Sbjct: 419 QPYMGGV 425


>gi|56388116|gb|AAV86703.1| seryl-tRNA synthetase [Anaplasma marginale str. St. Maries]
          Length = 437

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 208/434 (47%), Positives = 276/434 (63%), Gaps = 15/434 (3%)

Query: 3   DIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQAI 62
           DI+ I+++PE  D A+  R    Q+E I+ LD K R  +  +  +R +RN+ + ++    
Sbjct: 11  DIELIKKDPELFDRAMISRGFGEQAEKIIELDLKKRGELSTLYSLREQRNAVTREVALLK 70

Query: 63  AEG-----NLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGT 117
             G      +     L  E +TL+  +    KE+    + L  L+  +PNVP   VP+G 
Sbjct: 71  RSGIECTPQIEASKKLAEEIATLEHSI----KED----TKLSNLLESLPNVPDPIVPVGK 122

Query: 118 SANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
             + N+ +RS G++       R H+E+GE L L+DF RA  LSGARFS+L G LA LERA
Sbjct: 123 DESHNVEVRSHGQRRDFAFGIRPHYELGEMLNLLDFKRAAVLSGARFSILKGQLAELERA 182

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLT 237
           L  FM+D+HT E GYTE+S P+LV +  MY  GQ+PKF DD F TT+   L PTSEV+L 
Sbjct: 183 LASFMLDMHTKEFGYTEISHPVLVNERTMYNVGQLPKFHDDSFRTTNNFRLAPTSEVALA 242

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           NL S   +   SLP+RFT  +  FR+EAGSAG DTRGM+RQHQF K ELVSIT  + S  
Sbjct: 243 NLVSGTTLPRDSLPMRFTAYSQCFRAEAGSAGLDTRGMMRQHQFGKVELVSITTSDASNA 302

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E ERM S AEE+LKRL+L YRV+ LC+GD+GFSA  +YDLEVW+  Q+ YREISSCS C 
Sbjct: 303 ELERMTSIAEEVLKRLELPYRVMLLCSGDMGFSASISYDLEVWMPAQDKYREISSCSNCR 362

Query: 358 NFQSRRMNSRY--RDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
           +FQ+RRM ++Y   +   K     HTLNGS +A+GR + AI+ENY N DGS+TIP VLR 
Sbjct: 363 DFQARRMGAKYFFFENKKKHSTLVHTLNGSALAIGRTIAAIMENYQNEDGSITIPDVLRK 422

Query: 416 YMNNLAVIKKEHIL 429
           Y    A+++ E  L
Sbjct: 423 YTGASAIMRAEDAL 436


>gi|227543803|ref|ZP_03973852.1| serine--tRNA ligase [Lactobacillus reuteri CF48-3A]
 gi|300908871|ref|ZP_07126334.1| serine--tRNA ligase [Lactobacillus reuteri SD2112]
 gi|227186218|gb|EEI66289.1| serine--tRNA ligase [Lactobacillus reuteri CF48-3A]
 gi|300894278|gb|EFK87636.1| serine--tRNA ligase [Lactobacillus reuteri SD2112]
          Length = 435

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 205/431 (47%), Positives = 291/431 (67%), Gaps = 6/431 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IRQ P+     L  R ++ +  + +++LD+K R L+++ E ++A+RN  S +IG
Sbjct: 1   MLDIKKIRQEPDFYKEKLATRGVKSEEIDEVIALDKKRRELLQQTETMKAQRNEASKKIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           +A   G  +  DA   ET  L +++  L+ E     + L   ++ +PNVP + VP+  + 
Sbjct: 61  EAKRNGESA--DAAIKETRELGDKIKELDAELEVNDAELHDKMAHLPNVPHDGVPVSLTE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +  + +R VGK        + H++IGE LG++DFDRA K+SGARF    G  A LERA+ 
Sbjct: 119 DGAVELRRVGKVRDFDFEPKHHWDIGENLGILDFDRAGKVSGARFVYYLGLGAQLERAVY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGRWLIPTSEVSLTN 238
            FM+D H  E GYTEV  P +V  ++MYGTGQ PKF + ++    +   LIPT+EV LTN
Sbjct: 179 NFMLDEHMKE-GYTEVLPPYIVNADSMYGTGQFPKFKEGVYQVNGEDMTLIPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  E+I ++ LP+  T L PSFRSEAG+AGRDTRG++R HQF K E+V  T+ E+S+ E
Sbjct: 238 YYRGEVIPTEELPVYVTALTPSFRSEAGAAGRDTRGLIRMHQFNKVEMVKYTKPENSWDE 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M + AE ILK+L+L Y V++L TGD+ F+A +T+DLE+W+  QN YRE+SSCS C +
Sbjct: 298 LEKMTANAENILKKLNLPYHVITLTTGDMSFTASETHDLELWMPAQNKYREVSSCSNCLD 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRM+++YRD N K L++ HTLNGSG+AVGR + AILENY NADGSVTIP VL PYM+
Sbjct: 358 FQARRMHTQYRDENGK-LQYVHTLNGSGLAVGRTVAAILENYQNADGSVTIPEVLVPYMH 416

Query: 419 NLAVIKKEHIL 429
            +  I KE+ +
Sbjct: 417 GVTKITKENAV 427


>gi|167034601|ref|YP_001669832.1| seryl-tRNA synthetase [Pseudomonas putida GB-1]
 gi|189083580|sp|B0KLW8|SYS_PSEPG RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|166861089|gb|ABY99496.1| seryl-tRNA synthetase [Pseudomonas putida GB-1]
          Length = 426

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/434 (46%), Positives = 283/434 (65%), Gaps = 18/434 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R        I SL+E+ + +  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRGQLQEVADRLASRGFSLDVARIESLEERRKAVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A A+G      ++ V+ + NE +  K +L  ++ E       L  ++  IPN+P   VP+
Sbjct: 61  AKAKGEDIAPLMADVERMANELAAGKLELDGIQAE-------LDGILLTIPNLPDASVPV 113

Query: 116 GTSANENILIRSVGKKPSAIHLS-REHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           G S ++N+ +R  G  P A     ++H  +GE  G +DF+ A KLSGARF+VL G +A L
Sbjct: 114 GASEDDNVEVRRWGT-PKAFDFEIKDHVALGEVSGGLDFEAAAKLSGARFAVLRGPIARL 172

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIP 230
            RAL QFMI+LHT EHGY E   P LV+  A+ GTGQ+PKF +D+F  T +G    +LIP
Sbjct: 173 HRALAQFMINLHTGEHGYEEHYTPYLVQAPALQGTGQLPKFEEDLFKITREGEADFYLIP 232

Query: 231 TSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT 290
           T+EVSLTNL + EI+++K LPL+     P FRSEAG++GRDTRGM+RQHQF K E+V + 
Sbjct: 233 TAEVSLTNLVAGEILDAKQLPLKLVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQVV 292

Query: 291 REEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREI 350
               S    E + + AE +L+ L+L YRV++LCTGD+GF A KTYDLEVW+  Q+ YREI
Sbjct: 293 EPAKSMEALEGLTANAERVLQLLELPYRVLALCTGDMGFGAVKTYDLEVWVPSQDKYREI 352

Query: 351 SSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIP 410
           SSCS CG+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P
Sbjct: 353 SSCSNCGDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSILVP 412

Query: 411 TVLRPYMNNLAVIK 424
            VL+PYM  + VI+
Sbjct: 413 EVLKPYMGGVEVIR 426


>gi|222475249|ref|YP_002563665.1| seryl-tRNA synthetase (serS) [Anaplasma marginale str. Florida]
 gi|222419386|gb|ACM49409.1| seryl-tRNA synthetase (serS) [Anaplasma marginale str. Florida]
          Length = 437

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 208/434 (47%), Positives = 275/434 (63%), Gaps = 15/434 (3%)

Query: 3   DIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQAI 62
           DI+ I+++PE  D A+  R    Q+E I+ LD K R  +  +  +R +RN+ + ++    
Sbjct: 11  DIELIKKDPELFDRAMISRGFGEQAEKIIELDLKKRGELSTLYSLREQRNAVTREVALLK 70

Query: 63  AEG-----NLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGT 117
             G      +     L  E  TL+  +    KE+    + L  L+  +PNVP   VP+G 
Sbjct: 71  RSGIECTPQIEASKKLAEEIETLEHSI----KED----TKLSNLLESLPNVPDPIVPVGK 122

Query: 118 SANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
             + N+ +RS G++       R H+E+GE L L+DF RA  LSGARFS+L G LA LERA
Sbjct: 123 DESHNVEVRSHGQRRDFAFGIRPHYELGEMLNLLDFKRAAVLSGARFSILKGQLAELERA 182

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLT 237
           L  FM+D+HT E GYTE+S P+LV +  MY  GQ+PKF DD F TT+   L PTSEV+L 
Sbjct: 183 LASFMLDMHTKEFGYTEISHPVLVNERTMYNVGQLPKFHDDSFRTTNNFRLAPTSEVALA 242

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           NL S   +   SLP+RFT  +  FR+EAGSAG DTRGM+RQHQF K ELVSIT  + S  
Sbjct: 243 NLVSGTTLPRDSLPMRFTAYSQCFRAEAGSAGLDTRGMMRQHQFGKVELVSITTSDASNA 302

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E ERM S AEE+LKRL+L YRV+ LC+GD+GFSA  +YDLEVW+  Q+ YREISSCS C 
Sbjct: 303 ELERMTSIAEEVLKRLELPYRVMLLCSGDMGFSASISYDLEVWMPAQDKYREISSCSNCR 362

Query: 358 NFQSRRMNSRY--RDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
           +FQ+RRM ++Y   +   K     HTLNGS +A+GR + AI+ENY N DGS+TIP VLR 
Sbjct: 363 DFQARRMGAKYFFFENKKKHSTLVHTLNGSALAIGRTIAAIMENYQNEDGSITIPDVLRK 422

Query: 416 YMNNLAVIKKEHIL 429
           Y    A+++ E  L
Sbjct: 423 YTGTSAIMRAEDAL 436


>gi|148988163|ref|ZP_01819626.1| seryl-tRNA synthetase [Streptococcus pneumoniae SP6-BS73]
 gi|148993951|ref|ZP_01823321.1| seryl-tRNA synthetase [Streptococcus pneumoniae SP9-BS68]
 gi|168488101|ref|ZP_02712300.1| seryl-tRNA synthetase [Streptococcus pneumoniae SP195]
 gi|147926627|gb|EDK77700.1| seryl-tRNA synthetase [Streptococcus pneumoniae SP6-BS73]
 gi|147927540|gb|EDK78567.1| seryl-tRNA synthetase [Streptococcus pneumoniae SP9-BS68]
 gi|183573172|gb|EDT93700.1| seryl-tRNA synthetase [Streptococcus pneumoniae SP195]
 gi|332075256|gb|EGI85726.1| seryl-tRNA synthetase [Streptococcus pneumoniae GA17570]
          Length = 424

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 204/428 (47%), Positives = 280/428 (65%), Gaps = 9/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IR + E +   L  R ++      +  +D K R ++ K+E ++A RN+ SA+I 
Sbjct: 1   MLDIKRIRTDFEAVAEKLATRGVDAAVLNEMKEIDAKRRNILVKVETLKAERNTVSAEIA 60

Query: 60  QAI--AEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGT 117
           QA    E     + A++N    L  ++  L+ E  E+ + L +  + +PN+P + VP+GT
Sbjct: 61  QAKRNKENTDDKIAAMQN----LSAEVKALDAELAEIDAKLTEFTTTLPNIPADSVPVGT 116

Query: 118 SANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
             ++N+ +R  G         + H+++GE LG++D++R  K++GARF    G  A LERA
Sbjct: 117 DEDDNVEVRRWGTPREFDFEPKAHWDLGEDLGILDWERGGKVTGARFLFYKGLGARLERA 176

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSL 236
           +  FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+EV L
Sbjct: 177 IYNFMLDEHGKE-GYTEVITPYIVNHDSMFGTGQYPKFKEDTFELSDTNFVLIPTAEVPL 235

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E+S+
Sbjct: 236 TNYYRDEILDGKDLPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESY 295

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            E E+M + AE IL++L+L YRVV+L TGD+GFSA KTYDLEVW+  QN YREISSCS  
Sbjct: 296 EELEKMTANAENILQKLNLPYRVVALSTGDMGFSATKTYDLEVWIPAQNNYREISSCSNT 355

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
            +FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP  LRPY
Sbjct: 356 EDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEALRPY 415

Query: 417 MNNLAVIK 424
           M    VIK
Sbjct: 416 MGGAEVIK 423


>gi|315174090|gb|EFU18107.1| seryl-tRNA synthetase [Enterococcus faecalis TX1346]
          Length = 423

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 204/428 (47%), Positives = 283/428 (66%), Gaps = 11/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEY-ILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++  RQN E +   LK R ++ +     L+LDE+ R L+ K+E+++  RN  S +I 
Sbjct: 1   MLDMKKNRQNVEVVQKKLKTRGVDEEVLLRFLALDEERRALLVKVEELKKHRNQVSGEIA 60

Query: 60  Q---AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIG 116
           Q   A  + +  L++        + EQ+ +L++E   +      +   +PN+P E VP+G
Sbjct: 61  QLKRAQKDASQQLLN-----MQEVSEQIKVLDQEVVHLQEQCTAIAERLPNLPHESVPVG 115

Query: 117 TSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLER 176
              + N+ +R      +     + H+EIGEALG++DF+R  K+SG+RF    G  A LER
Sbjct: 116 ADESANVEVRRWSTPKTFSFEPKPHWEIGEALGILDFERGAKVSGSRFLYYKGLGARLER 175

Query: 177 ALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVS 235
           A+  FM+D H +EHGYTEV  P LV  +AM+GTGQ PKF +D+F   +    LIPT+EV 
Sbjct: 176 AVYNFMLDQHVNEHGYTEVIPPYLVNSKAMFGTGQFPKFKEDVFQVAESDLTLIPTAEVP 235

Query: 236 LTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDS 295
           LTN Y++EI++++ LP+ FT L+PSFRSEAGSAGRDTRG++R HQF K E+V  +  E S
Sbjct: 236 LTNYYNNEILDAQELPIYFTALSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFSDAEHS 295

Query: 296 FTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCST 355
           + E E+M + A +IL++L L YRV++L TGD+GFSA KTYDLEVW+  Q  YREISSCS 
Sbjct: 296 YEELEKMTNNAGDILEKLGLPYRVITLSTGDMGFSAAKTYDLEVWIPAQKTYREISSCSN 355

Query: 356 CGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
           C +FQ+RR   RYRD  +  +++ HTLNGSG+AVGR + AILENY N DG+VTIP VLRP
Sbjct: 356 CEDFQARRALIRYRD-KTGHVQYAHTLNGSGLAVGRTVAAILENYQNEDGTVTIPEVLRP 414

Query: 416 YMNNLAVI 423
           YM  L  I
Sbjct: 415 YMGGLTKI 422


>gi|312952534|ref|ZP_07771401.1| seryl-tRNA synthetase [Enterococcus faecalis TX0102]
 gi|310629532|gb|EFQ12815.1| seryl-tRNA synthetase [Enterococcus faecalis TX0102]
 gi|315153454|gb|EFT97470.1| seryl-tRNA synthetase [Enterococcus faecalis TX0031]
          Length = 423

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 204/428 (47%), Positives = 282/428 (65%), Gaps = 11/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEY-ILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IRQN E +   LK R ++ +     L+LDE+ R L+ K+E+++  RN  S +I 
Sbjct: 1   MLDMKKIRQNVEVVQKKLKTRGVDEEVLLRFLALDEERRALLVKVEELKKHRNQVSGEIA 60

Query: 60  Q---AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIG 116
           Q   A  + +  L++        + EQ+ +L++E   +      +   +PN+P E VP+G
Sbjct: 61  QLKRAQKDASQQLLN-----MQEVSEQIKVLDQEVVHLQEQCTAIAERLPNLPHESVPVG 115

Query: 117 TSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLER 176
                N+ +R      +     + H+EIGEALG++DF+R  K+SG+RF       A LER
Sbjct: 116 ADEAANVEVRRWSTPKTFSFEPKPHWEIGEALGILDFERGAKVSGSRFLYYKDLGARLER 175

Query: 177 ALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVS 235
           A+  FM+D H +EHGYTEV  P LV  +AM+GTGQ PKF +D+F   +    LIPT+EV 
Sbjct: 176 AVYNFMLDQHVNEHGYTEVIPPYLVNSKAMFGTGQFPKFKEDVFQVAESDLTLIPTAEVP 235

Query: 236 LTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDS 295
           LTN Y++EI++++ LP+ FT L+PSFRSEAGSAGRDTRG++R HQF K E+V  +  E S
Sbjct: 236 LTNYYNNEILDAQELPIYFTALSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFSDAEHS 295

Query: 296 FTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCST 355
           + E E+M + A +IL++L L YRV++L TGD+GFSA KTYDLEVW+  Q  YREISSCS 
Sbjct: 296 YEELEKMTNNAGDILEKLGLPYRVITLSTGDMGFSAAKTYDLEVWIPAQKTYREISSCSN 355

Query: 356 CGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
           C +FQ+RR   RYRD  +  +++ HTLNGSG+AVGR + AILENY N DG+VTIP VLRP
Sbjct: 356 CEDFQARRALIRYRD-KTGHVQYAHTLNGSGLAVGRTVAAILENYQNEDGTVTIPEVLRP 414

Query: 416 YMNNLAVI 423
           YM  L  I
Sbjct: 415 YMGGLTKI 422


>gi|187923045|ref|YP_001894687.1| seryl-tRNA synthetase [Burkholderia phytofirmans PsJN]
 gi|238689594|sp|B2T1A6|SYS_BURPP RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|187714239|gb|ACD15463.1| seryl-tRNA synthetase [Burkholderia phytofirmans PsJN]
          Length = 431

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/427 (46%), Positives = 274/427 (64%), Gaps = 11/427 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R    + E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDLDGVAKRLADRGYTLDVAAFAALEAERRETQTRTEEMQARRNSLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G  +   A+  E   + +++     +  ++   L +L+  +PN+P E VP+G    
Sbjct: 61  MKGKGEDT--SAVMAEVGGIGDEMKASAAKLDDIQKRLSELLQGVPNLPHESVPMGKDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G         ++H ++G  LGL DF+   KLSGARF++L G +A L RAL Q
Sbjct: 119 GNVEVRRWGTPRQFDFEVKDHVDVGTPLGL-DFETGAKLSGARFTMLRGQIARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FMID HT +HGYTEV  P +V  E +YGTGQ+PKFADDMF    G       ++LI TSE
Sbjct: 178 FMIDTHTQQHGYTEVYTPYIVNPEILYGTGQLPKFADDMFRVEKGGDENTVTQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     I+E+ +LP++ T  +P FRSEAGS GRDTRG++RQHQF K E+V I   E
Sbjct: 238 ISLTNTVRDSILEADALPIKLTAHSPCFRSEAGSYGRDTRGLIRQHQFDKVEMVQIVAPE 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE IL++L+L YRV++LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 298 TSYAALEEMVGHAETILQKLELPYRVITLCTGDMGFSAAKTYDLEVWVPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RRM +RYR+   K  +  HTLNGSG+AVGR L+A+LEN+ NADGSVT+P  L
Sbjct: 358 SNTESFQARRMQARYRNAQGKP-ELVHTLNGSGLAVGRTLVAVLENFQNADGSVTVPAAL 416

Query: 414 RPYMNNL 420
           RPY+  +
Sbjct: 417 RPYLGGI 423


>gi|323350377|ref|ZP_08086041.1| serine--tRNA ligase [Streptococcus sanguinis VMC66]
 gi|322123450|gb|EFX95126.1| serine--tRNA ligase [Streptococcus sanguinis VMC66]
          Length = 425

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/430 (47%), Positives = 281/430 (65%), Gaps = 15/430 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IR + + +   L  R ++  +   +  +D++ R L+ K+E+++A RN+ SA+I 
Sbjct: 1   MLDLKRIRTDFDSVAEKLATRGVDAATLNQMKIIDKERRDLLVKVEELKAERNTVSAEIA 60

Query: 60  QAI-----AEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVP 114
           QA      A+  ++ +  L  E   L   L        E+ + L +  + +PN+P E VP
Sbjct: 61  QAKRNKENADDKIAAMQKLSAEVKNLDATLA-------ELDAKLTEFTTTLPNIPHESVP 113

Query: 115 IGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           +G   +EN+ +R  G        ++ H+++GE L ++D++R  K++GARF    G  A L
Sbjct: 114 VGADEDENVEVRRWGTPRQFDFEAKAHWDLGEDLDILDWERGAKVTGARFLFYKGLGARL 173

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSE 233
           ERA+  FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+E
Sbjct: 174 ERAIYNFMLDEHGKE-GYTEVITPYMVNHDSMFGTGQYPKFKEDTFELSDTNFVLIPTAE 232

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V LTN Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E
Sbjct: 233 VPLTNYYRDEILDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPE 292

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
           +S+ E E+M + AE IL++L+L YRVV+LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 293 ESYEELEKMTANAENILQKLNLPYRVVALCTGDMGFSAAKTYDLEVWIPAQNTYREISSC 352

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP VL
Sbjct: 353 SNTEDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVL 412

Query: 414 RPYMNNLAVI 423
           RPYM  L VI
Sbjct: 413 RPYMGGLEVI 422


>gi|307704266|ref|ZP_07641185.1| seryl-tRNA synthetase [Streptococcus mitis SK597]
 gi|307622177|gb|EFO01195.1| seryl-tRNA synthetase [Streptococcus mitis SK597]
          Length = 424

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 201/426 (47%), Positives = 277/426 (65%), Gaps = 5/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IR + + +   L  R ++      +  +D K R ++ K+E ++A RN+ SA+I 
Sbjct: 1   MLDIKRIRTDFDAVAEKLATRGVDATVLNEMKEIDAKRRDILVKVETLKAERNTVSAEIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA  + N    D       TL  ++  L+ E  ++ + L +  + +PN+P + VP+G   
Sbjct: 61  QA--KRNKENADDKIAAMQTLSAEVKALDAELADIDAKLTEFTTTLPNIPADSVPVGADE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+ +R  G         + H+++GE LG++D++R  K++GARF    G  A LERA+ 
Sbjct: 119 DDNVEVRRWGTPREFDFEPKAHWDLGEDLGILDWERGGKVTGARFLFYKGLGARLERAIY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLTN 238
            FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+EV LTN
Sbjct: 179 NFMLDEHGKE-GYTEVITPYMVNHDSMFGTGQYPKFKEDTFELSDSNYVLIPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E+S+ E
Sbjct: 238 YYRDEILDGKDLPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESYEE 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M + AE IL++L+L YRVV+L TGD+GFSA KTYDLEVW+  QN YREISSCS   +
Sbjct: 298 LEKMTANAENILQKLNLPYRVVALSTGDMGFSAAKTYDLEVWIPAQNTYREISSCSNTED 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP  LRPYM 
Sbjct: 358 FQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEALRPYMG 417

Query: 419 NLAVIK 424
              VIK
Sbjct: 418 GAEVIK 423


>gi|156934612|ref|YP_001438528.1| seryl-tRNA synthetase [Cronobacter sakazakii ATCC BAA-894]
 gi|166221438|sp|A7MER7|SYS_ENTS8 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|156532866|gb|ABU77692.1| hypothetical protein ESA_02446 [Cronobacter sakazakii ATCC BAA-894]
          Length = 430

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/431 (46%), Positives = 274/431 (63%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + +++L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRTEPDAVAEKLARRGFKLDVDKLVALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   +PN+P +EVP+G   +
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKNELDALLAEIRDIALTLPNLPDDEVPLGKDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +   G         R+H  +GE LG +DF  A KL+G+RF V+ G +A L RAL Q
Sbjct: 119 ENVEVSRWGTPRKFDFEIRDHVTLGETLGGLDFASAVKLTGSRFVVMKGQIARLHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLHT EHGY+E   P LV  + +YGTGQ+PKFA D+F T        +    LIPT+
Sbjct: 179 FMLDLHTEEHGYSENYVPYLVNHDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+ +SLP++ T   P FRSEAGS GRDTRG++R HQF K E+V + R 
Sbjct: 239 EVPLTNLVRDEIIDEESLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQVVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR V LC+GD+GF A KTYDLEVWL  Q+ YREISS
Sbjct: 299 EDSMQALEEMTGHAEKVLQLLGLPYRKVLLCSGDMGFGARKTYDLEVWLPAQDTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A+LENY  ADG + IP V
Sbjct: 359 CSNMWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVLENYQQADGRIEIPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMKGLEFI 429


>gi|260597297|ref|YP_003209868.1| seryl-tRNA synthetase [Cronobacter turicensis z3032]
 gi|260216474|emb|CBA29619.1| Seryl-tRNA synthetase [Cronobacter turicensis z3032]
          Length = 430

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/431 (46%), Positives = 274/431 (63%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + +++L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRTEPDAVAEKLARRGFKLDVDKLVALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   +PN+P ++VP+G   +
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDTAKNELDALLAEIRDIALTLPNLPDDDVPLGKDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +   G         R+H  +GE LG MDF  A KL+G+RF V+ G +A L RAL Q
Sbjct: 119 ENVEVSRWGTPRKFDFEIRDHVTLGETLGGMDFASAVKLTGSRFVVMKGQIARLHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLHT EHGY+E   P LV  + +YGTGQ+PKFA D+F T        +    LIPT+
Sbjct: 179 FMLDLHTEEHGYSENYVPYLVNHDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+ ++LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIIDEETLPVKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR V LC+GD+GF A KTYDLEVWL  Q+ YREISS
Sbjct: 299 EDSMQALEEMTGHAEKVLQLLGLPYRKVLLCSGDMGFGARKTYDLEVWLPAQDTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A+LENY  ADG + IP V
Sbjct: 359 CSNMWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVLENYQQADGRIEIPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMKGLEFI 429


>gi|260584327|ref|ZP_05852074.1| serine--tRNA ligase [Granulicatella elegans ATCC 700633]
 gi|260157845|gb|EEW92914.1| serine--tRNA ligase [Granulicatella elegans ATCC 700633]
          Length = 426

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 205/428 (47%), Positives = 274/428 (64%), Gaps = 5/428 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ +R + E + + L+ R +E Q  E +  LDEK R LI K E ++  RN+ + +I 
Sbjct: 1   MLDMKRVRDHFEEVVVGLQNRGVERQVVEELRDLDEKRRELILKTEQLKQYRNTVTEEIS 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           Q   + N     A   E   + E +   +    EV   L+ + S +PN+   +VP+G   
Sbjct: 61  QL--KRNKEDASAKIAEMKQVGEDVKATDALLAEVEEKLEYIASRLPNIAAADVPVGEDE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           NEN+ IR  G         + H+E+ EAL ++DF+R  K+SG+RF    G  A LERA+ 
Sbjct: 119 NENVEIRREGTPRVFDFEPKPHWEVAEALDILDFERGAKVSGSRFLYYKGLGARLERAIY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGR--WLIPTSEVSLT 237
            +MIDLH  +HGYTE+  P LV +++MYGTGQ PKF +D+F   D R   LIPT+EV LT
Sbjct: 179 NYMIDLHVEKHGYTEMITPYLVNEQSMYGTGQFPKFKEDVFQINDERNLTLIPTAEVPLT 238

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           N Y++EI+E   LP+ FT L+PSFRSEAGSAGRDTRG++R HQF K E+V     E SF 
Sbjct: 239 NYYANEILEEAQLPIYFTALSPSFRSEAGSAGRDTRGLIRLHQFNKVEMVKFATPETSFE 298

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E E+M   AE++L+ L L +R + LCTGD+GFSA KTYD+EVW+  Q+ YREISSCS C 
Sbjct: 299 ELEKMTDNAEDVLRGLGLPFRTIVLCTGDMGFSASKTYDVEVWIPAQDTYREISSCSNCV 358

Query: 358 NFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +FQ+RR   RYR   +  ++  HTLNGSG+AVGR + AILENY  ADGSVTIP VL PYM
Sbjct: 359 DFQARRAKIRYRQAETGKIELLHTLNGSGLAVGRTVAAILENYQEADGSVTIPEVLVPYM 418

Query: 418 NNLAVIKK 425
             +  I K
Sbjct: 419 GGVTKITK 426


>gi|237738388|ref|ZP_04568869.1| seryl-tRNA synthetase [Fusobacterium mortiferum ATCC 9817]
 gi|229420268|gb|EEO35315.1| seryl-tRNA synthetase [Fusobacterium mortiferum ATCC 9817]
          Length = 423

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 198/425 (46%), Positives = 275/425 (64%), Gaps = 2/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           ML++++IR+N E ++  LK R+     +    LD++ R ++ ++E ++ +RNS SA+I +
Sbjct: 1   MLELKFIRENREKVEEMLKNRNSNLTLDEFFQLDDERREILGEVEALKQKRNSESAEIAR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              E   +   AL  E   +  Q+  L+ +  EV   L  +   IPN+  E  P+G   N
Sbjct: 61  LKKEKQDAT--ALIEEMGKVSAQIKELDTKLAEVEEKLTYIQMTIPNMYQEGTPVGEDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ IR  G         + H++IGE LG++DF+R  KL G+RF +  G  A +ERAL  
Sbjct: 119 SNVEIRRWGTPREFTFEPKAHWDIGEDLGILDFERGAKLGGSRFVLYRGLGARVERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT EHGYTE   P +V+ E   GTGQ+PKF DDM+ TTD  +LI TSE+++TN++
Sbjct: 179 FMLDLHTLEHGYTEHITPFMVKREICEGTGQLPKFEDDMYRTTDDMFLISTSEITMTNIH 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ K LP  +T  +P FR EAGS G+D +G++R HQF K E+V IT +E S+ E E
Sbjct: 239 RKEILDEKELPKYYTAYSPCFRREAGSYGKDVKGIIRLHQFNKVEMVKITNQESSYDELE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           +M++ AEE+L+RL+L YRV+ LCTGDLGF A KTYD+EVWL  Q  YREISSCS C  FQ
Sbjct: 299 KMVNNAEEVLQRLELPYRVIQLCTGDLGFGAAKTYDIEVWLPSQKKYREISSCSNCEGFQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM  +YR   S   ++ HTLNGSG+AVGR L+AI+ENY   DGS  IP  L PYM  +
Sbjct: 359 ARRMGLKYRPNGSSKSEYCHTLNGSGLAVGRTLVAIMENYQQEDGSFLIPKALVPYMGGI 418

Query: 421 AVIKK 425
            V+KK
Sbjct: 419 EVVKK 423


>gi|83645246|ref|YP_433681.1| seryl-tRNA synthetase [Hahella chejuensis KCTC 2396]
 gi|123533541|sp|Q2SJB8|SYS_HAHCH RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|83633289|gb|ABC29256.1| seryl-tRNA synthetase [Hahella chejuensis KCTC 2396]
          Length = 427

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 197/426 (46%), Positives = 272/426 (63%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R + + +   LK +  +   +    L+E+ + +  + E++++ RNS S  IG 
Sbjct: 1   MLDPKLLRNSLDEVAARLKTKRYDLDVDAFSQLEERRKSVQVRTEELQSERNSKSKNIGM 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            I +G       LK+E + + EQL   + E  ++   L  L+  IPN+P   VP G S +
Sbjct: 61  MIKQGQDP--QPLKDEVAKIGEQLETAKAELQDIQDKLDDLLQGIPNLPDASVPEGASED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G         ++H ++GE+LGL+DF+   KL+G+RF V+   LA L RAL Q
Sbjct: 119 DNVEVRQWGSVREFDFEPKDHVDLGESLGLLDFNSGAKLAGSRFVVMRRELARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGR--WLIPTSEVSLTN 238
           FM+D+HT+EHGY E   P LV   A+ GTGQ+PKF  D+F        +LIPT+EV +TN
Sbjct: 179 FMLDIHTTEHGYQETMTPFLVHAHALQGTGQLPKFEADLFKVPGEHDFYLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L   EI+++K LPL+ T+  P FRSEAGS GRD RGM+RQHQF K EL+ +   E S   
Sbjct: 239 LVREEILDAKELPLKMTSHTPCFRSEAGSYGRDVRGMIRQHQFEKVELIHVVAPEQSDAA 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E +   AE IL+ L+L YRVV+LC GDLGFSA KTYD+EVWL  Q  YREISSCS C +
Sbjct: 299 LEELTGNAERILQLLNLPYRVVALCGGDLGFSAAKTYDIEVWLPAQKKYREISSCSNCRD 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRM +R+R+P +   +  HTLNGSG+A+GR LIA+LENY  ADGS+ +P VL PYM 
Sbjct: 359 FQARRMQARWRNPETGKPELVHTLNGSGLAIGRTLIAVLENYQQADGSILVPDVLEPYMG 418

Query: 419 NLAVIK 424
            + VIK
Sbjct: 419 GVKVIK 424


>gi|187929624|ref|YP_001900111.1| seryl-tRNA synthetase [Ralstonia pickettii 12J]
 gi|309781610|ref|ZP_07676344.1| serine--tRNA ligase [Ralstonia sp. 5_7_47FAA]
 gi|238691803|sp|B2U9Y5|SYS_RALPJ RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|187726514|gb|ACD27679.1| seryl-tRNA synthetase [Ralstonia pickettii 12J]
 gi|308919585|gb|EFP65248.1| serine--tRNA ligase [Ralstonia sp. 5_7_47FAA]
          Length = 438

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 204/439 (46%), Positives = 277/439 (63%), Gaps = 19/439 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   LK R          +L+ + + +  + E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDIDAVAARLKDRGYVLDVAGFAALEAERKAIQTRTEELQARRNSLSKQIG- 59

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            + +G       +  E S + ++L     +   V + L+ L+  IPN+P E VP G    
Sbjct: 60  -VLKGKGEDASGVMAEVSGIGDELKASAAQLDVVQAKLQDLMLSIPNLPHESVPAGRDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G   +     ++H ++G ALGL DFD   KLSGARF+VL G +A L RAL Q
Sbjct: 119 QNVEVRREGTPRTFDFPVKDHVDLGAALGL-DFDAGAKLSGARFTVLKGQVARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT----------DGR---- 226
           FM+D HT EHGYTE   P +V   +M GTGQ+PKF +D+F             DG     
Sbjct: 178 FMLDTHTLEHGYTEAYVPYIVNAASMRGTGQLPKFEEDLFRVPRKMGHSAEEGDGERVEN 237

Query: 227 -WLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCE 285
            +LIPT+EV LTNL   EI+ + +LP+ F   +P FRSEAGS G+DTRGM+RQHQF K E
Sbjct: 238 FYLIPTAEVPLTNLVRDEIVAADTLPMMFAAHSPCFRSEAGSYGKDTRGMIRQHQFDKVE 297

Query: 286 LVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQN 345
           +V I + E S    E M +CAE IL++L+L +R V LCTGD+GF + KTYD+EVW+  QN
Sbjct: 298 MVQIVQPETSAAALEAMTNCAENILRKLELPFRTVVLCTGDMGFGSTKTYDIEVWIPAQN 357

Query: 346 LYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADG 405
            YREISSCS  G+FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+A+LENY NADG
Sbjct: 358 TYREISSCSNMGDFQARRMQARFRNAQGKP-ELVHTLNGSGLAVGRTLVALLENYQNADG 416

Query: 406 SVTIPTVLRPYMNNLAVIK 424
           SVT+PT LRPY+    V+K
Sbjct: 417 SVTVPTALRPYLGGQEVLK 435


>gi|237746814|ref|ZP_04577294.1| seryl-tRNA synthetase [Oxalobacter formigenes HOxBLS]
 gi|229378165|gb|EEO28256.1| seryl-tRNA synthetase [Oxalobacter formigenes HOxBLS]
          Length = 438

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 206/428 (48%), Positives = 273/428 (63%), Gaps = 12/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M+DIQ +R++ + +   L+ R  E       +L+ + R L  + E+++ARRN+ S QIG 
Sbjct: 1   MIDIQLLRKDIDAVAAKLETRKFELDVATFNALEAQRRQLQTQTEEMQARRNALSKQIG- 59

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            I +       A+  E   L ++L   E    EV + L   +  IPN+P E VP+G   +
Sbjct: 60  -ILKSKKEDASAVMAEVGGLGDKLKANEAALSEVQAKLSGFMLSIPNLPHESVPVGPDES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ IR +G         ++H +IG  LGL DF+ A KL+GARF V+ G++A L RAL Q
Sbjct: 119 ANVEIRRIGTPREFDFEVKDHVDIGVPLGL-DFETAGKLAGARFCVMRGNMARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGR--------WLIPTS 232
           FM+D+ T EHGYTE   P +V  +++YGTGQ+PKFADD+F    G         +LIPT+
Sbjct: 178 FMLDVQTMEHGYTECYTPYMVNADSLYGTGQLPKFADDLFAAKKGGQEGENENLYLIPTA 237

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV+LTN    EI+ S  LP++ T   P FRSEAGS GRDTRGM+RQHQF K E+V I   
Sbjct: 238 EVTLTNTVRGEILSSGQLPIKLTAHTPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQIVHP 297

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E S+   E M+  A  +L++L L YRVVSL TGD+GFSA KTYDLEVWL  QN YREISS
Sbjct: 298 EKSYEALEEMVKNAGRVLEKLGLPYRVVSLSTGDMGFSAAKTYDLEVWLPAQNTYREISS 357

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
            S C  FQ+RRM +R+R+   +  +  HTLNGSG+AVGR L+AILEN+  ADGSVTIPT 
Sbjct: 358 VSNCEAFQARRMQARFRNEKGRP-ELVHTLNGSGLAVGRTLVAILENFQQADGSVTIPTA 416

Query: 413 LRPYMNNL 420
           L+PYM+ L
Sbjct: 417 LQPYMSGL 424


>gi|257792717|ref|YP_003183323.1| seryl-tRNA synthetase [Eggerthella lenta DSM 2243]
 gi|317489004|ref|ZP_07947531.1| seryl-tRNA synthetase [Eggerthella sp. 1_3_56FAA]
 gi|325831041|ref|ZP_08164365.1| serine--tRNA ligase [Eggerthella sp. HGA1]
 gi|257476614|gb|ACV56934.1| seryl-tRNA synthetase [Eggerthella lenta DSM 2243]
 gi|316911871|gb|EFV33453.1| seryl-tRNA synthetase [Eggerthella sp. 1_3_56FAA]
 gi|325486962|gb|EGC89408.1| serine--tRNA ligase [Eggerthella sp. HGA1]
          Length = 429

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 197/430 (45%), Positives = 275/430 (63%), Gaps = 5/430 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+++R N E +  A+K RH    +     LDE  R  I K E ++A RN+ S  IGQ
Sbjct: 1   MLDIKFVRDNQEAVAEAMKNRHASWDAARFSELDETRRAAIAKEEALQAERNATSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +A G     +A K     + ++L ++ K+      +L++++   PN+P +  P+G   +
Sbjct: 61  MMAAGQKDEAEAAKQRVRAINDELAVIGKDREAADEALREVLLRTPNMPADSTPVGDDED 120

Query: 121 ENILIRSVGKKPSAIHLSRE---HFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
           +N  +R  G          E   H+++G  LG++DF+RA KL+ +RF +L G  A LERA
Sbjct: 121 DNPEVRRWGAPRDFAAEGFEMKPHWDLGPELGIIDFERAVKLAASRFILLGGLGARLERA 180

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLT 237
           L  FM D H S  GY E   P +   E + GTGQ+PKF +D+F TT+G +LIPT+EV LT
Sbjct: 181 LINFMADTHAS-RGYKEWWCPAMANAETLTGTGQLPKFEEDLFHTTEGLYLIPTAEVQLT 239

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           N+++ E++++  LPL++    P FR EAGSAGRDTRG++R HQF K E+V   + E+SF 
Sbjct: 240 NIHAGEVLDAGQLPLKYCAFTPCFREEAGSAGRDTRGLIRVHQFDKVEMVKYAKPEESFD 299

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           + E M++ AE IL+ L L YRV+SLCTGD+GFSA KTYDLEVWL   N Y+EISSCS C 
Sbjct: 300 DLEAMVADAENILQLLGLPYRVISLCTGDIGFSAAKTYDLEVWLPSYNGYKEISSCSNCT 359

Query: 358 NFQSRRMNSRYRDP-NSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           +FQ+RR N +YRDP N K  ++ HTLNGSG+AVGR + A++ENY   DG+V +P VL PY
Sbjct: 360 DFQARRANIKYRDPENFKGSRYVHTLNGSGLAVGRTMAAVIENYQQPDGTVRVPDVLVPY 419

Query: 417 MNNLAVIKKE 426
           M  + VI  E
Sbjct: 420 MGGVEVIAPE 429


>gi|167720765|ref|ZP_02404001.1| seryl-tRNA synthetase [Burkholderia pseudomallei DM98]
          Length = 433

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/430 (46%), Positives = 276/430 (64%), Gaps = 11/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R +  + E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDLDGVAKRLADRGYPLDVAAFSALEAERRAIQTRTEELQARRNSLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G  +   A+  E   + +++     +  E+ + L +L+  +PNVP E VP+G    
Sbjct: 61  MKGRGEDT--SAVMAEVGGIGDEMKASAVKLDEIQARLSELMLEMPNVPHESVPVGRDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G         ++H ++G  LGL DF+   KLSGARF+VL G +A L RAL Q
Sbjct: 119 ENVEVRRWGAPRQFDFDVKDHVDVGTPLGL-DFETGAKLSGARFTVLRGPIARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGY+E   P +V  + +YGTGQ+PKFA+DMF    G       ++LI TSE
Sbjct: 178 FMLDTHTQQHGYSETYTPYIVNPDVLYGTGQLPKFAEDMFRVEKGGAENTVTQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     I+E+ +LP++ T  +P FRSEAGS GRDTRGM+RQHQF K E+V I   E
Sbjct: 238 ISLTNTVRDSIVEASALPIKLTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQIVAPE 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   + M+  AE IL++L+L YRVV+LCTGD+GFSA KT+DLEVWL  QN YREISSC
Sbjct: 298 ASYAALDEMVGHAEAILQKLELPYRVVALCTGDMGFSAAKTFDLEVWLPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+A+LENY NADGSVT+P  L
Sbjct: 358 SNTESFQARRMQARFRNAQGKP-ELVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPIAL 416

Query: 414 RPYMNNLAVI 423
           RPYM  +  I
Sbjct: 417 RPYMGGVERI 426


>gi|167825379|ref|ZP_02456850.1| seryl-tRNA synthetase [Burkholderia pseudomallei 9]
 gi|167895446|ref|ZP_02482848.1| seryl-tRNA synthetase [Burkholderia pseudomallei 7894]
 gi|167920072|ref|ZP_02507163.1| seryl-tRNA synthetase [Burkholderia pseudomallei BCC215]
 gi|226193869|ref|ZP_03789471.1| serine--tRNA ligase [Burkholderia pseudomallei Pakistan 9]
 gi|225934174|gb|EEH30159.1| serine--tRNA ligase [Burkholderia pseudomallei Pakistan 9]
          Length = 433

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/430 (46%), Positives = 276/430 (64%), Gaps = 11/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R +  + E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDLDGVAKRLADRGYPLDVAAFSALEAERRAIQTRTEELQARRNSLSKQIG- 59

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A+  E   + +++     +  E+ + L +L+  +PNVP E VP+G    
Sbjct: 60  -AMKGRSEDTSAVMAEVGGIGDEMKASAVKLDEIQARLSELMLEMPNVPHESVPVGRDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G         ++H ++G  LGL DF+   KLSGARF+VL G +A L RAL Q
Sbjct: 119 ENVEVRRWGAPRQFDFDVKDHVDVGTPLGL-DFETGAKLSGARFTVLRGPIARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGY+E   P +V  + +YGTGQ+PKFA+DMF    G       ++LI TSE
Sbjct: 178 FMLDTHTQQHGYSETYTPYIVNPDVLYGTGQLPKFAEDMFRVEKGGAENTVTQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     I+E+ +LP++ T  +P FRSEAGS GRDTRGM+RQHQF K E+V I   E
Sbjct: 238 ISLTNTVRDSIVEASALPIKLTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQIVAPE 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   + M+  AE IL++L+L YRVV+LCTGD+GFSA KT+DLEVWL  QN YREISSC
Sbjct: 298 ASYAALDEMVGHAEAILQKLELPYRVVALCTGDMGFSAAKTFDLEVWLPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+A+LENY NADGSVT+P  L
Sbjct: 358 SNTESFQARRMQARFRNAQGKP-ELVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPVAL 416

Query: 414 RPYMNNLAVI 423
           RPYM  +  I
Sbjct: 417 RPYMGGVERI 426


>gi|188997109|ref|YP_001931360.1| seryl-tRNA synthetase [Sulfurihydrogenibium sp. YO3AOP1]
 gi|229560100|sp|B2VA33|SYS_SULSY RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|188932176|gb|ACD66806.1| seryl-tRNA synthetase [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 417

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 199/420 (47%), Positives = 277/420 (65%), Gaps = 6/420 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS--EYILSLDEKNRILIKKIEDIRARRNSNSAQI 58
           M+DI+ +R+NP+ +   LK R        + +L +DE+ R +IK+IE +RA RN  S   
Sbjct: 1   MIDIKLLRENPDFVKERLKTRDESYLKLIDRLLEIDEERRKIIKEIESLRAERNEKSKLF 60

Query: 59  GQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTS 118
                EG  +    ++     + E +  LE +  E+ +    ++  IPN+P  +VPIG  
Sbjct: 61  PILKKEGKDTT--EIQQRVKQIGEIIKNLEDKLQEIENEFNNILYYIPNLPAPDVPIGKD 118

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
            N+N+ IR  GK          H+EIGE LG++DF+R  KLSG+RF+V+    A LERAL
Sbjct: 119 ENDNVEIRRWGKPRKFDFEPLSHYEIGERLGILDFERGAKLSGSRFTVMFKEAARLERAL 178

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-GRWLIPTSEVSLT 237
             FM+D+HT +HGYTEV  P LV+ E ++GTGQ+PKF DD++   D   +LIPT+EV+LT
Sbjct: 179 INFMLDVHTKQHGYTEVWTPALVKPEILFGTGQLPKFKDDLYKIEDEDLYLIPTAEVTLT 238

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           NL++ EI+  + LP  +T   P FR EAGS G+D +G+LRQHQF K ELV I + EDS+ 
Sbjct: 239 NLHADEILNEEDLPKYYTAYTPCFRKEAGSHGKDVKGILRQHQFDKVELVKIVKPEDSYN 298

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E E++++ AE+IL+ L++ YRVV LCTGD+GFSA KTYD+EVW+  QN YREISSCS   
Sbjct: 299 ELEKLVNEAEKILQLLEIPYRVVLLCTGDMGFSAAKTYDIEVWIPSQNRYREISSCSNTE 358

Query: 358 NFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +FQ+RR   RY+D + K+  + HTLNGSG+AVGR LIAI+ENY   DG+  IP VL+ Y+
Sbjct: 359 DFQARRAKIRYKDKDGKN-HYVHTLNGSGLAVGRTLIAIMENYQKPDGTFEIPKVLKDYL 417


>gi|330965617|gb|EGH65877.1| seryl-tRNA synthetase [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 426

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/433 (46%), Positives = 280/433 (64%), Gaps = 18/433 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R        I SL+ + +++  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRTQLQDVADRLASRGFTLDVARIESLEAQRKVVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A   G      ++ V+ + NE S  K +L  ++ E       L  L+  IPN+P E VP+
Sbjct: 61  AKQRGEDIAPLMADVERMGNELSEGKVELDAIQAE-------LDALVLNIPNLPHESVPV 113

Query: 116 GTSANENILIRSVGKKPSAIHLS-REHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           G     N+ +R  G  P+A     ++H  +GE    +DF+ A KLSGARF++L G +A L
Sbjct: 114 GADEEGNVEVRRWGT-PTAFDFEVKDHVALGEKFRWLDFETAAKLSGARFALLRGPIARL 172

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIP 230
            RAL QFMI+LH +EHGY E   P LV+  A+ GTGQ+PKF +D+F  + +G    +LIP
Sbjct: 173 HRALAQFMINLHINEHGYEETYTPYLVQAPALQGTGQLPKFEEDLFKISREGEADLYLIP 232

Query: 231 TSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT 290
           T+EVSLTN+ S EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I 
Sbjct: 233 TAEVSLTNIVSGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIV 292

Query: 291 REEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREI 350
             +DS    E +   AE +L+ L+L YR ++LCTGD+GFSA KTYDLEVW+  Q+ YREI
Sbjct: 293 APDDSMAALESLTGNAERVLQLLELPYRTLALCTGDMGFSAVKTYDLEVWIPSQDKYREI 352

Query: 351 SSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIP 410
           SSCS CG+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P
Sbjct: 353 SSCSNCGDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVP 412

Query: 411 TVLRPYMNNLAVI 423
            VL+PYM  L VI
Sbjct: 413 EVLKPYMGGLEVI 425


>gi|225076272|ref|ZP_03719471.1| hypothetical protein NEIFLAOT_01312 [Neisseria flavescens
           NRL30031/H210]
 gi|224952396|gb|EEG33605.1| hypothetical protein NEIFLAOT_01312 [Neisseria flavescens
           NRL30031/H210]
          Length = 431

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 199/427 (46%), Positives = 270/427 (63%), Gaps = 9/427 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L  R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLAARGYEFDTARFNALEEQRKAVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKVDLEQAAADLDAVQKELDAWLLTIPNLPHESVPAGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMKGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTLKHGYTEHYTPYIVDDLTLQGTGQLPKFAEDLFHVTRGGDESKKTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  I+    LPL+ T  +P FRSEAG+ G+D RG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIVAGSDLPLKLTAHSPCFRSEAGAYGKDVRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ +P  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINVPAAL 418

Query: 414 RPYMNNL 420
           +PYM  +
Sbjct: 419 QPYMGGV 425


>gi|254449273|ref|ZP_05062720.1| seryl-tRNA synthetase [gamma proteobacterium HTCC5015]
 gi|198261128|gb|EDY85426.1| seryl-tRNA synthetase [gamma proteobacterium HTCC5015]
          Length = 427

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 205/429 (47%), Positives = 274/429 (63%), Gaps = 7/429 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R + + +  AL KR      +    L+ + +    + +D++  RN+ S  IGQ
Sbjct: 1   MLDPKRLRSDLDAVADALTKRGFTLDKDQFSQLEARRKSEQTRTQDLQNERNTRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ LK   + L ++L   E E   + S L +L+  IPN P E VP G   +
Sbjct: 61  AKAAGED--IEPLKAAVAELGKELAQSEGELKTIQSELDELVLGIPNEPHETVPEGKDES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G+  S     ++H  +GE  G MDF+ A+K++G+RF VL G +  L RAL Q
Sbjct: 119 DNVEVSRWGEPKSFEFDVKDHVALGEHKGWMDFEEASKITGSRFVVLRGAMCRLHRALTQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-----CTTDGRWLIPTSEVS 235
           FM+D H  +HGY EV  P +V  +++YGTGQ+PKF +D+F        +  +LIPT+EV 
Sbjct: 179 FMLDTHADQHGYQEVYVPYIVNQDSLYGTGQLPKFGEDLFKIEREGEDNSFYLIPTAEVP 238

Query: 236 LTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDS 295
           +TN+    I E K LPL+     P FRSEAGS GRDTRGM+RQHQF K ELV + + EDS
Sbjct: 239 VTNMARDVIYEEKDLPLKRVAHTPCFRSEAGSYGRDTRGMIRQHQFEKVELVQLVKPEDS 298

Query: 296 FTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCST 355
           +   E +   AE IL++L+L YR V LC GDLGFSA KTYDLEVWL GQ+ YREISSCS 
Sbjct: 299 WQALEELCGHAETILQKLELPYRKVVLCGGDLGFSAAKTYDLEVWLPGQSAYREISSCSN 358

Query: 356 CGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
             +FQ+RRM +RYR P+SK  +  HTLNGSG+AVGR LIA+LENY NADGSVT+P VLRP
Sbjct: 359 FVDFQARRMKARYRSPDSKKPELLHTLNGSGLAVGRALIAVLENYQNADGSVTVPEVLRP 418

Query: 416 YMNNLAVIK 424
           YM  L V+K
Sbjct: 419 YMGGLDVLK 427


>gi|269958701|ref|YP_003328488.1| seryl-tRNA synthetase [Anaplasma centrale str. Israel]
 gi|269848530|gb|ACZ49174.1| seryl-tRNA synthetase [Anaplasma centrale str. Israel]
          Length = 437

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 208/434 (47%), Positives = 275/434 (63%), Gaps = 15/434 (3%)

Query: 3   DIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQAI 62
           DI+ I+++PE  D A+  R    Q+E I+ LD K R  +  +  +R +RN+ + ++    
Sbjct: 11  DIELIKKDPELFDRAMISRGFGEQAEKIIELDLKKRGELSTLYSLREQRNAVTREVALLK 70

Query: 63  AEG-----NLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGT 117
             G      +     L  E  TL+  +    KE+    + L  L+  +PNVP   VP+G 
Sbjct: 71  RSGIECTPQIEASKKLAEEIETLEHSI----KED----TKLSNLLESLPNVPDPIVPVGK 122

Query: 118 SANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
             + N+ +RS G++       R H+E+GE L L+DF RA  LSGARFS+L G LA LERA
Sbjct: 123 DESHNVEVRSHGQRRDFAFGIRPHYELGEMLNLLDFKRAAVLSGARFSILKGQLAELERA 182

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLT 237
           L  FM+D+HT E GYTE+S P+LV +  MY  GQ+PKF DD F TT+   L PTSEV+L 
Sbjct: 183 LASFMLDMHTKEFGYTEISHPVLVNERTMYNVGQLPKFHDDSFRTTNNFRLAPTSEVALA 242

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           NL S   +   SLP+RFT  +  FR+EAGSAG DTRGM+RQHQF K ELVSIT  + S  
Sbjct: 243 NLVSGTTLPRDSLPMRFTAYSQCFRAEAGSAGLDTRGMMRQHQFGKVELVSITTSDASNA 302

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E ERM S AEE+LKRL+L YRV+ LC+GD+GFSA  +YDLEVW+  Q+ YREISSCS C 
Sbjct: 303 ELERMTSIAEEVLKRLELPYRVMLLCSGDMGFSASISYDLEVWMPAQDKYREISSCSNCR 362

Query: 358 NFQSRRMNSRY--RDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
           +FQ+RRM ++Y   +   K     HTLNGS +A+GR + AI+ENY N DGS+TIP VLR 
Sbjct: 363 DFQARRMGAKYFFFENKKKHSTLVHTLNGSALAIGRTIAAIMENYQNEDGSITIPDVLRK 422

Query: 416 YMNNLAVIKKEHIL 429
           Y    A+++ E  L
Sbjct: 423 YTGASAIMRAEDAL 436


>gi|161378160|ref|NP_299565.2| seryl-tRNA synthetase [Xylella fastidiosa 9a5c]
 gi|30173217|sp|Q9PB58|SYS_XYLFA RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
          Length = 426

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/393 (50%), Positives = 270/393 (68%), Gaps = 8/393 (2%)

Query: 35  EKNRILIKKIEDIRARRNSNSAQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEV 94
           E+ RI +   +++++ RNS S  IGQA ++G    V +L  E +   + L   E    E+
Sbjct: 37  ERKRIQVH-TQELQSLRNSKSKAIGQARSKGE--DVSSLMAEVAAFSDDLKASEIALEEI 93

Query: 95  CSSLKKLISCIPNVPLEEVPIGTSANENILIRSVGKKPSAIHLS-REHFEIGEALGLMDF 153
            + L+K+   IPN+P ++VP+G    +N+     G  P     S ++H E+G   G +D 
Sbjct: 94  RTELEKVALGIPNLPQQDVPLGADERDNVEQARWG-VPRTFDFSIKDHVELGACHGWLDA 152

Query: 154 DRATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIP 213
           + A KLSGARF+VL G +A L RAL Q M+DLH  +HGY EV+ P++V  +++YGTGQ+P
Sbjct: 153 ESAAKLSGARFTVLRGPIARLHRALAQCMLDLHVRQHGYEEVNVPIIVNADSLYGTGQLP 212

Query: 214 KFADDMFCTTDG---RWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGR 270
           KF +DMF T  G   R+LI TSE+SLTNL  +EIIE+  LPLR    +  FRSEAGS GR
Sbjct: 213 KFEEDMFSTQLGEHRRYLISTSEISLTNLVRNEIIEADRLPLRMAAHSLCFRSEAGSGGR 272

Query: 271 DTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFS 330
           DTRGM+RQHQF K ELVS+ + ++S  EH+RM  CAE +L+ L L YR + LCTGD+GF+
Sbjct: 273 DTRGMIRQHQFEKVELVSVCKPQESEGEHQRMTRCAETVLEMLGLPYRKILLCTGDMGFA 332

Query: 331 ACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVG 390
           A KTYDLEVWL  Q +YREISSCS CG+FQ+RRM +R+R+  +   +  HTLNGSGVAVG
Sbjct: 333 ATKTYDLEVWLPSQGMYREISSCSNCGDFQARRMQARWRNSVTGKPELVHTLNGSGVAVG 392

Query: 391 RCLIAILENYLNADGSVTIPTVLRPYMNNLAVI 423
           R +IA++ENY NADGS+T+P VLRPYM+ L+ I
Sbjct: 393 RAMIAVMENYQNADGSITVPEVLRPYMDGLSRI 425


>gi|71899891|ref|ZP_00682039.1| Seryl-tRNA synthetase, class IIa [Xylella fastidiosa Ann-1]
 gi|71730331|gb|EAO32414.1| Seryl-tRNA synthetase, class IIa [Xylella fastidiosa Ann-1]
          Length = 426

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 199/392 (50%), Positives = 269/392 (68%), Gaps = 6/392 (1%)

Query: 35  EKNRILIKKIEDIRARRNSNSAQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEV 94
           E+ RI +   +++++ RNS S  IGQA ++G    V AL  E +   + L   E    E+
Sbjct: 37  ERKRIQVH-TQELQSLRNSKSKAIGQARSKGED--VSALMAEVAAFSDDLKASEIALEEI 93

Query: 95  CSSLKKLISCIPNVPLEEVPIGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFD 154
            + L+K+   IPN+P ++VP+G    +N+     G   +     ++H E+G   G +D +
Sbjct: 94  RTELEKVALDIPNLPQQDVPLGADERDNVEQARWGVPRTFDFAIKDHVELGACHGWLDAE 153

Query: 155 RATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPK 214
            A KLSGARF+VL G +A L RAL Q M+DLH S+HGY EV+ P++V  ++++GTGQ+PK
Sbjct: 154 SAAKLSGARFTVLRGPIARLHRALAQCMLDLHVSQHGYEEVNVPIIVNADSLHGTGQLPK 213

Query: 215 FADDMFCTTDG---RWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRD 271
           F +DMF T  G   R+LI TSE+SLTNL  +EIIE+  LPLR    +  FRSEAGS GRD
Sbjct: 214 FEEDMFSTQLGEHRRYLISTSEISLTNLVRNEIIEADRLPLRMVAHSLCFRSEAGSGGRD 273

Query: 272 TRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSA 331
           TRGM+RQHQF K ELVS+ + ++S  EH RM  CAE +L+ L L YR + LCTGD+GF+A
Sbjct: 274 TRGMIRQHQFEKVELVSVCKPQESEGEHHRMTRCAETVLEMLGLPYRKILLCTGDMGFAA 333

Query: 332 CKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGR 391
            KTYDLEVWL  Q +YREISSCS CG+FQ+RRM +R+R+  +   +  HTLNGSGVAVGR
Sbjct: 334 TKTYDLEVWLPSQGMYREISSCSNCGDFQARRMQARWRNSVTGKPELVHTLNGSGVAVGR 393

Query: 392 CLIAILENYLNADGSVTIPTVLRPYMNNLAVI 423
            +IA++ENY NADGS+T+P VLRPYM+ L+ I
Sbjct: 394 AMIAVMENYQNADGSITVPEVLRPYMDGLSRI 425


>gi|312792870|ref|YP_004025793.1| seryl-tRNA synthetase [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312180010|gb|ADQ40180.1| seryl-tRNA synthetase [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 420

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 196/417 (47%), Positives = 278/417 (66%), Gaps = 3/417 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD+++IR NPE +   L KR+ +     IL LDEK R L+ ++E ++A +N  S ++ +
Sbjct: 1   MLDLKYIRTNPEKVQEGLSKRNKDISIAPILELDEKRRKLLAEVESLKALQNQKSKEVPR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG    V  L NE   L +++  L+    EV   ++K++  IPN+P E VP+G    
Sbjct: 61  LKKEGKD--VTELMNELKELSDKIKELDSRFKEVEDEIEKILLTIPNIPHESVPVGKDDT 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G         + H+EIG +LG++DF+RA+K+SG+RF+   G  A LERAL  
Sbjct: 119 ENVEVRRWGDVRVPDFEVKPHWEIGMSLGILDFERASKVSGSRFTFYRGLGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLH  +HGYTE+  P LV  ++M GTGQ+PKF +D F TTD  +LIPT+EV +TN +
Sbjct: 179 FMLDLHIEKHGYTEIFPPFLVARKSMIGTGQLPKFEEDAFKTTDDYFLIPTAEVPVTNYH 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ + LP+++   +  FR+EAG+AG+DTRG++RQHQF K ELV   + E+S+ E E
Sbjct: 239 REEILKEEDLPIKYVAYSACFRAEAGAAGKDTRGLIRQHQFNKVELVKFAKPEESYDELE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           ++ + AE++LK L L YRVV LC+GDLGFS+ KTYD+EVW+     Y EISSCS   ++Q
Sbjct: 299 KLTADAEDVLKELGLPYRVVLLCSGDLGFSSAKTYDIEVWMPSYGRYVEISSCSNFESYQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +RR N R+R  + K L + HTLNGSG+AVGR L AILEN+   DG+V +P VLR YM
Sbjct: 359 ARRANIRFRRKDGK-LDYVHTLNGSGLAVGRTLAAILENFQQKDGTVVVPEVLRKYM 414


>gi|229591232|ref|YP_002873351.1| seryl-tRNA synthetase [Pseudomonas fluorescens SBW25]
 gi|259511678|sp|C3JY54|SYS_PSEFS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|229363098|emb|CAY50099.1| serine tRNA synthetase [Pseudomonas fluorescens SBW25]
          Length = 426

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 201/434 (46%), Positives = 284/434 (65%), Gaps = 18/434 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R N + +   L  R        I +L+E+ + +  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRSNLQDVADRLASRGFALDVARIEALEEQRKTVQTRTEALQAERNARSKSIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A   G      ++ V+ +  E S  K +L        ++ S L  ++  IPN+P E VPI
Sbjct: 61  AKQRGEDIAPLMADVERMGTELSDGKVEL-------EKIQSELDSILLGIPNLPHESVPI 113

Query: 116 GTSANENILIRSVGKKPSAIHLS-REHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           G   + N+ +R  G  P+A     ++H  +GE  G +DF+ A K+SGARF++L G +A +
Sbjct: 114 GEDEDGNVEVRRWGT-PTAFDFEIKDHVALGELTGGLDFETAAKMSGARFALLRGPIARM 172

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIP 230
            RAL QFMI+LHT+EHGY E   P LV+  A+ GT Q+PKF +D+F  + DG    +LIP
Sbjct: 173 HRALAQFMINLHTAEHGYEEAYTPYLVQAPALMGTSQLPKFEEDLFKISRDGEADLYLIP 232

Query: 231 TSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT 290
           T+EVSLTN+ S EI+++K LPL+F   +P FRSEAG++GRDTRGM+RQHQF K E+V + 
Sbjct: 233 TAEVSLTNIVSGEILDAKQLPLKFVAHSPCFRSEAGASGRDTRGMIRQHQFDKVEMVQVV 292

Query: 291 REEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREI 350
               S    E + + AE +L+ L+L YRV++LCTGD+GFSA KTYDLEVW+  Q+ YREI
Sbjct: 293 EPSTSMEALEGLTANAERVLQLLELPYRVLALCTGDMGFSAVKTYDLEVWVPSQDKYREI 352

Query: 351 SSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIP 410
           SSCS CG+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P
Sbjct: 353 SSCSNCGDFQARRMQARFRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVP 412

Query: 411 TVLRPYMNNLAVIK 424
            VL+PYM  + VI+
Sbjct: 413 EVLKPYMAGVEVIR 426


>gi|319943864|ref|ZP_08018145.1| serine--tRNA ligase [Lautropia mirabilis ATCC 51599]
 gi|319743097|gb|EFV95503.1| serine--tRNA ligase [Lautropia mirabilis ATCC 51599]
          Length = 453

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 209/455 (45%), Positives = 286/455 (62%), Gaps = 34/455 (7%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M+DIQ +R++   ++  LK R          +L+ + + L  + E ++A+RN+ S QIGQ
Sbjct: 1   MIDIQTLRRDAAQVESRLKTRGFVFDRAGYEALEARRKALQTRAEALQAQRNALSKQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A  +G  +   AL  E + + ++   +  E   V +SL  L++ +PN+P E VP+G S  
Sbjct: 61  AKGKGEDA--SALLAEVNAVTQEQAGIPAELESVQASLDALLASLPNLPHESVPVGRSEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G   +     ++H ++GE LGL D     KLSGARF+V+ G +A L RAL Q
Sbjct: 119 DNVEVRRWGTPATFDFAVKDHLDVGEPLGL-DAAAGAKLSGARFTVMRGGVARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF------------CTTDGR-- 226
           FM+D+HT+ HGYTE   P LV   A++GTGQ+PKF +D+F             T  G+  
Sbjct: 178 FMLDMHTTRHGYTECYTPYLVNASALFGTGQLPKFEEDLFRVQKLGDQGPAAGTEAGQEA 237

Query: 227 ---------WLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLR 277
                    +LIPTSEVSLTNL + EI+  ++LPLR T   P FRSEAGS GRDTRGM+R
Sbjct: 238 SGQAVPATMYLIPTSEVSLTNLVAGEILPGEALPLRLTAHTPCFRSEAGSYGRDTRGMIR 297

Query: 278 QHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDL 337
           QHQF K E+V +TR EDS+   E M+  AE IL+ L+L YRVV+LCTGD+GFSA KTYDL
Sbjct: 298 QHQFDKVEMVQVTRPEDSYATLESMVGHAEAILQALELPYRVVALCTGDMGFSAAKTYDL 357

Query: 338 EVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSL--------KFTHTLNGSGVAV 389
           EVWL GQ+ YREISS S    FQ+RRM +R+R  +++          +  HTLNGSG+AV
Sbjct: 358 EVWLPGQSAYREISSISNTEAFQARRMQARFRPADAEGKGGKGKAKPEHVHTLNGSGLAV 417

Query: 390 GRCLIAILENYLNADGSVTIPTVLRPYMNNLAVIK 424
           GR L+A+LEN+  ADGSV IP  L+PYM  + V+K
Sbjct: 418 GRTLVAVLENHQQADGSVRIPKALQPYMGGVEVLK 452


>gi|302877502|ref|YP_003846066.1| seryl-tRNA synthetase [Gallionella capsiferriformans ES-2]
 gi|302580291|gb|ADL54302.1| seryl-tRNA synthetase [Gallionella capsiferriformans ES-2]
          Length = 431

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 206/431 (47%), Positives = 280/431 (64%), Gaps = 11/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R + + +   L  R     +     L+   + +  + ++++++RNS S  IGQ
Sbjct: 1   MLDIQVLRSDLDGVAARLATRGFVLDTARFGELEAARKAIQVRTQELQSKRNSASKLIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G  +   A+  E + + E+L  +E +   +   L++L+  +PN+P E VPIG S  
Sbjct: 61  AKAKGEDT--TAIMAEVTLVGEELKSIEVQLGALQGQLQQLLEGLPNMPHESVPIGGSEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G  P      ++H E+GEALG +DF+ A K+SGARFSVL G LA L RAL Q
Sbjct: 119 DNVEVRKSGSVPVFDFAVKDHVELGEALGGLDFETAAKISGARFSVLKGGLARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+D HT  HGYTEV  P LV  ++M GTGQ+PKF +D+F              +LIPT+
Sbjct: 179 FMLDTHTDTHGYTEVYVPYLVNADSMRGTGQLPKFEEDLFAVPRQMGEGGMQNFYLIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV +TN+   EII  + LPL++    P FRSEAGSAGRDTRG++RQHQF K ELV I   
Sbjct: 239 EVPVTNMVRDEIIPLEQLPLKYVAHTPCFRSEAGSAGRDTRGLIRQHQFEKVELVQIVHP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           +DS+   E++L  AE IL++L LHYRVV LCTGD+GFS+  TYD+EVWL  QN YREISS
Sbjct: 299 DDSYAALEQLLGHAEAILQKLGLHYRVVRLCTGDIGFSSATTYDIEVWLPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS    FQ+RR+ +R++    K  +  HTLNGSG+AVGR L+A+LEN   ADGS++IP V
Sbjct: 359 CSNFEAFQARRLQARFKSGTGKP-ELLHTLNGSGLAVGRTLVAVLENNQLADGSISIPEV 417

Query: 413 LRPYMNNLAVI 423
           LRPYM  LAV+
Sbjct: 418 LRPYMGGLAVL 428


>gi|333006955|gb|EGK26450.1| seryl-tRNA synthetase [Shigella flexneri K-218]
          Length = 430

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 199/431 (46%), Positives = 270/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T        T    LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++     P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMIAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|312867885|ref|ZP_07728090.1| serine--tRNA ligase [Streptococcus parasanguinis F0405]
 gi|311096640|gb|EFQ54879.1| serine--tRNA ligase [Streptococcus parasanguinis F0405]
          Length = 425

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 205/428 (47%), Positives = 276/428 (64%), Gaps = 11/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILS----LDEKNRILIKKIEDIRARRNSNSA 56
           MLDI+ IR +    D   KK         IL+    +D K R ++ K+E+++A RN+ SA
Sbjct: 1   MLDIKRIRTD---FDAVAKKLATRGVDAAILNEMKEIDAKRRDILVKVENLKAERNTVSA 57

Query: 57  QIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIG 116
           +I QA  + N    D       TL  ++  L+ E  E+ + L +  + +PN+P + VPIG
Sbjct: 58  EIAQA--KRNKENADDKIAAMQTLSAEVKALDTELAEIDAKLTEFTTTLPNIPADSVPIG 115

Query: 117 TSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLER 176
              ++N+ +R  G         + H+++GE L ++D++R  K++GARF    G  A LER
Sbjct: 116 ADEDDNVEVRRWGTPREFGFEPKAHWDLGEDLDILDWERGAKVTGARFLFYKGLGARLER 175

Query: 177 ALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVS 235
           A+  FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+EV 
Sbjct: 176 AIYNFMLDEHGKE-GYTEVITPYMVNHDSMFGTGQYPKFKEDTFELSDTNYVLIPTAEVP 234

Query: 236 LTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDS 295
           LTN Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E+S
Sbjct: 235 LTNYYRDEILDGKDLPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEES 294

Query: 296 FTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCST 355
           + E E+M+  AE IL++L+L YRVV+L TGD+GFSA KTYDLEVW+  QN YREISSCS 
Sbjct: 295 YDELEKMVVNAENILQKLNLPYRVVALSTGDMGFSAAKTYDLEVWIPAQNTYREISSCSN 354

Query: 356 CGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
             +FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP VLRP
Sbjct: 355 TEDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVLRP 414

Query: 416 YMNNLAVI 423
           YM    VI
Sbjct: 415 YMGGAEVI 422


>gi|241759885|ref|ZP_04757985.1| serine--tRNA ligase [Neisseria flavescens SK114]
 gi|241319893|gb|EER56289.1| serine--tRNA ligase [Neisseria flavescens SK114]
          Length = 431

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 199/427 (46%), Positives = 270/427 (63%), Gaps = 9/427 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L  R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLAARGYEFDTARFNALEEQRKAVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKVDLEQAAADLDAVQKELDAWLLTIPNLPHESVPAGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LGL DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLGL-DFEGGAKLSGARFTVMKGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T G       ++LIPT+E
Sbjct: 180 FMLDTHTLKHGYTEHYTPYIVDDLTLQGTGQLPKFAEDLFHVTRGGDESKKTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  I+    LPL+ T  +P FRSEAG+ G+D RG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIVAGSDLPLKLTAHSPCFRSEAGAYGKDVRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ +P  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINVPAAL 418

Query: 414 RPYMNNL 420
           +PYM  +
Sbjct: 419 QPYMGGV 425


>gi|325273409|ref|ZP_08139664.1| seryl-tRNA synthetase [Pseudomonas sp. TJI-51]
 gi|324101454|gb|EGB99045.1| seryl-tRNA synthetase [Pseudomonas sp. TJI-51]
          Length = 426

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/433 (46%), Positives = 281/433 (64%), Gaps = 16/433 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R        I SL+E+ + +  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRGQLQEVADRLASRGFSLDVARIESLEERRKAVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A A+G      ++ V+ + NE +  K +L        E+ + L  ++  IPN+P   VP+
Sbjct: 61  AKAKGEDIAPLMADVERMANELAAGKAEL-------DEIQAELDGILLTIPNLPDASVPV 113

Query: 116 GTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLE 175
           G S ++N+ +R  G   +     ++H  +GE  G +DF+ A KLSGARF+VL G +A L 
Sbjct: 114 GASEDDNVEVRRWGTPQTFDFDIKDHVALGELSGGLDFEAAAKLSGARFAVLRGPIARLH 173

Query: 176 RALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIPT 231
           RAL QFMI+LHT EHGY E   P LV+  A+ GTGQ+PKF +D+F  T +G    +LIPT
Sbjct: 174 RALAQFMINLHTGEHGYEEHYTPYLVQAPALQGTGQLPKFEEDLFKITREGEADFYLIPT 233

Query: 232 SEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITR 291
           +EVSLTNL +  I+++K LPL+     P FRSEAG++GRDTRGM+RQHQF K E+V +  
Sbjct: 234 AEVSLTNLVAGAILDAKQLPLKLVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQVVE 293

Query: 292 EEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREIS 351
              S    E + + AE +L+ L+L YRV++LCTGD+GF A KTYDLEVW+  Q+ YREIS
Sbjct: 294 PAKSMEALEGLTANAERVLQLLELPYRVLALCTGDMGFGAVKTYDLEVWVPSQDKYREIS 353

Query: 352 SCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPT 411
           SCS CG+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P 
Sbjct: 354 SCSNCGDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPE 413

Query: 412 VLRPYMNNLAVIK 424
           VL+PYM  + VI+
Sbjct: 414 VLKPYMGGVEVIR 426


>gi|315126413|ref|YP_004068416.1| seryl-tRNA synthetase [Pseudoalteromonas sp. SM9913]
 gi|315014927|gb|ADT68265.1| seryl-tRNA synthetase [Pseudoalteromonas sp. SM9913]
          Length = 434

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/437 (46%), Positives = 278/437 (63%), Gaps = 16/437 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD +++RQ+ E     L  R  E     +  L+E+ + L  K ++++++RN+++  IGQ
Sbjct: 1   MLDSKYLRQDVEQTAARLAARGYELDVAAVTELEERRKTLQVKTQELQSQRNASAKAIGQ 60

Query: 61  AIAEGNLS--LVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTS 118
           A A+G  +  L+DA+ N    L  +L   + E+ EV  ++K++   IPN+P E VP G  
Sbjct: 61  AKAKGEDAQPLLDAVAN----LGSELDAAKTEQDEVLEAIKQIALAIPNLPDESVPAGAD 116

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
            ++N+ I + G         ++H ++G+ L  +DF+   K+SGARF+V+ G +A + RAL
Sbjct: 117 EDDNVEILTWGTPKKYDFEVKDHVDVGQDLNGLDFEMGVKISGARFTVMRGQVARMHRAL 176

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-----TDGRW-----L 228
            Q+M+D HT ++GYTE+  P LV   ++YGT Q+PKFA D+F T      DG       L
Sbjct: 177 TQYMLDTHTDKNGYTEMYVPYLVNSASLYGTSQLPKFAGDLFHTLGLVNDDGEQQPGFSL 236

Query: 229 IPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVS 288
           IPT+EV LTN    EI E   LP+R T   P FRSEAGS GRDTRG++RQHQF K ELV 
Sbjct: 237 IPTAEVPLTNSARDEIYEESDLPIRLTAHTPCFRSEAGSYGRDTRGLIRQHQFDKVELVQ 296

Query: 289 ITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYR 348
           + + EDS    E +   AE+IL+ L+L YR V LC GD+GF A KTYDLEVWL  Q+ YR
Sbjct: 297 LVKPEDSMQALEELTGHAEQILQALELPYRKVILCMGDMGFGAAKTYDLEVWLPAQDTYR 356

Query: 349 EISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVT 408
           EISSCS   +FQ+RRM +R+R   +K  +  HTLNGSG+AVGR L+AILENY  ADGSV 
Sbjct: 357 EISSCSNMVDFQARRMQARFRREGAKKPELLHTLNGSGLAVGRTLVAILENYQQADGSVV 416

Query: 409 IPTVLRPYMNNLAVIKK 425
           +P VLRPYM  L VI K
Sbjct: 417 VPEVLRPYMGGLEVIGK 433


>gi|261339231|ref|ZP_05967089.1| hypothetical protein ENTCAN_05465 [Enterobacter cancerogenus ATCC
           35316]
 gi|288319086|gb|EFC58024.1| serine--tRNA ligase [Enterobacter cancerogenus ATCC 35316]
          Length = 430

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 198/431 (45%), Positives = 273/431 (63%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVQTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P + VP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDQAKAELDVLLAEIRDIALAIPNIPDDSVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ ++  G         R+H  +GE    +DF  A KL+G+RF V+ G +AHL RAL Q
Sbjct: 119 DNVEVKRWGTPREFDFEVRDHVTLGEMHAGLDFAAAVKLTGSRFVVMKGQIAHLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T        +    LIPT+
Sbjct: 179 FMLDLHTEQHGYSETYVPYLVNHDTLYGTGQLPKFAGDLFHTRPLDEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T  +P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIIDEDDLPIKLTAHSPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR ++LCTGD+GF ACKT+DLEVW+  QN YREISS
Sbjct: 299 EDSMDALEEMTGHAEKVLELLGLPYRRMALCTGDMGFGACKTFDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R+ + K  +  HTLNGSG+AVGR L+A+LENY  ADG + IP V
Sbjct: 359 CSNVWDFQARRMQARCRNKSDKKTRLVHTLNGSGLAVGRTLVAVLENYQQADGRIEIPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM     I
Sbjct: 419 LRPYMKGQQFI 429


>gi|158522755|ref|YP_001530625.1| seryl-tRNA synthetase [Desulfococcus oleovorans Hxd3]
 gi|238686901|sp|A8ZXS1|SYS_DESOH RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|158511581|gb|ABW68548.1| seryl-tRNA synthetase [Desulfococcus oleovorans Hxd3]
          Length = 425

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 201/427 (47%), Positives = 276/427 (64%), Gaps = 8/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD +++R+  +    AL  R+ +P   +  L  D   + ++ +IE +R +RN  S  I 
Sbjct: 1   MLDSRFVREQADRARQALAHRNEDPVMIDAFLGYDTARKDILAEIEALRHKRNVASDTIA 60

Query: 60  QAIAEGNLS--LVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGT 117
           Q    G  +   + A++  ++ +KE L +L  E  E   +L   +  IPN+P   VPIG 
Sbjct: 61  QMKKAGQTADEPIAAMREVSAKIKE-LEVLLAENQEKSDAL---LMRIPNIPHASVPIGP 116

Query: 118 SANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
             + N+  R VG  P+     R H EIGEALG+ DF RA K++GARF +  G  A +ERA
Sbjct: 117 DESANVTEREVGTPPAFDFAPRPHEEIGEALGIFDFARAAKIAGARFPLYKGAGALMERA 176

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-GRWLIPTSEVSL 236
           L  FM+D+HT+EHGYTE   PL+V  + M GTGQ+PKF +D+F     G +LIPT+EV +
Sbjct: 177 LINFMLDIHTTEHGYTECLPPLMVNAKTMTGTGQLPKFEEDLFKLERWGFYLIPTAEVPV 236

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+++ EI+    LP+++T   P FRSEAGS G+DT+G++RQHQF K ELV     E S+
Sbjct: 237 TNIFADEILNEADLPIKYTAYTPCFRSEAGSYGKDTKGLIRQHQFNKVELVKFAHPEHSY 296

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            E E++L+ AE IL+RL L YRV++LC+GD+GFSA KTYD+EVW   QN YREISSCS  
Sbjct: 297 DELEKLLADAETILQRLGLAYRVITLCSGDMGFSAAKTYDIEVWFPAQNRYREISSCSNF 356

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
            +FQ+RR N R++ P  K   F HTLNGSG+AVGR L AILEN+   +G+V IP  LRPY
Sbjct: 357 EDFQARRANIRFKRPGQKGTGFVHTLNGSGLAVGRTLAAILENFQTKEGAVEIPDTLRPY 416

Query: 417 MNNLAVI 423
           M N+AV+
Sbjct: 417 MRNMAVL 423


>gi|324991702|gb|EGC23634.1| serine--tRNA ligase [Streptococcus sanguinis SK353]
          Length = 425

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/430 (46%), Positives = 281/430 (65%), Gaps = 15/430 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IR + + +   L  R ++  +   + ++D++ R L+ K+E+++A RN+ SA+I 
Sbjct: 1   MLDLKRIRTDFDSVAEKLATRGVDAATLSQMKTIDKERRDLLVKVEELKAERNTVSAEIA 60

Query: 60  QAI-----AEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVP 114
           QA      A+  ++ +  L  E   L   L        E+ + L +  + +PN+P + VP
Sbjct: 61  QAKRNKENADDKIAAMQKLSAEVKNLDASLA-------ELDAKLTEFTTTLPNIPHDSVP 113

Query: 115 IGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           +G   +EN+ +R  G        ++ H+++GE L ++D++R  K++GARF    G  A L
Sbjct: 114 VGADEDENVEVRRWGTPRQFDFEAKAHWDLGEDLDILDWERGAKVTGARFLFYKGLGARL 173

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSE 233
           ERA+  FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+E
Sbjct: 174 ERAIYNFMLDEHGKE-GYTEVITPYMVNHDSMFGTGQYPKFKEDTFELSDTNFVLIPTAE 232

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V LTN Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E
Sbjct: 233 VPLTNYYRDEILDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPE 292

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
           +S+ E E M + AE IL++L+L YRVV+LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 293 ESYEELENMTANAENILQKLNLPYRVVALCTGDMGFSAAKTYDLEVWIPAQNTYREISSC 352

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP VL
Sbjct: 353 SNTEDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEVL 412

Query: 414 RPYMNNLAVI 423
           RPYM  L VI
Sbjct: 413 RPYMGGLEVI 422


>gi|168482647|ref|ZP_02707599.1| seryl-tRNA synthetase [Streptococcus pneumoniae CDC1873-00]
 gi|172043721|gb|EDT51767.1| seryl-tRNA synthetase [Streptococcus pneumoniae CDC1873-00]
 gi|332077694|gb|EGI88155.1| seryl-tRNA synthetase [Streptococcus pneumoniae GA41301]
 gi|332203581|gb|EGJ17648.1| seryl-tRNA synthetase [Streptococcus pneumoniae GA47368]
          Length = 424

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/428 (47%), Positives = 279/428 (65%), Gaps = 9/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IR + E +   L  R ++      +  +D K R ++ K+E ++A RN+ SA+I 
Sbjct: 1   MLDIKRIRTDFEAVAEKLATRGVDAAVLNEMKEIDAKRRNILVKVETLKAERNTVSAEIA 60

Query: 60  QAI--AEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGT 117
           QA    E     + A++N    L  ++  L+ E  E+ + L +  + +PN+P + VP+G 
Sbjct: 61  QAKRNKENTDDKIAAMQN----LSAEVKALDAELAEIDAKLTEFTTTLPNIPADSVPVGA 116

Query: 118 SANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
             ++N+ +R  G         + H+++GE LG++D++R  K++GARF    G  A LERA
Sbjct: 117 DEDDNVEVRRWGTPREFDFEPKAHWDLGEDLGILDWERGGKVTGARFLFYKGLGARLERA 176

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSL 236
           +  FM+D H  E GYTEV  P +V  ++M+GTGQ PKF +D F  +D  + LIPT+EV L
Sbjct: 177 IYNFMLDEHGKE-GYTEVITPYIVNHDSMFGTGQYPKFKEDTFELSDTNFVLIPTAEVPL 235

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E+S+
Sbjct: 236 TNYYRDEILDGKDLPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESY 295

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            E E+M + AE IL++L+L YRVV+L TGD+GFSA KTYDLEVW+  QN YREISSCS  
Sbjct: 296 EELEKMTANAENILQKLNLPYRVVALSTGDMGFSAAKTYDLEVWIPAQNNYREISSCSNA 355

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
            +FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP  LRPY
Sbjct: 356 EDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEALRPY 415

Query: 417 MNNLAVIK 424
           M    VIK
Sbjct: 416 MGGAEVIK 423


>gi|304397062|ref|ZP_07378941.1| seryl-tRNA synthetase [Pantoea sp. aB]
 gi|304355211|gb|EFM19579.1| seryl-tRNA synthetase [Pantoea sp. aB]
          Length = 430

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/431 (46%), Positives = 270/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   E + SL+E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGYKLDVETLRSLEERRKVLQVETENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E  E+ + ++     +PN+P +EVP+G   +
Sbjct: 61  AKARG--EDIEPLRQEVNALGERLDAAKAELDELQNQIRDFALAMPNIPADEVPLGKDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN  +   G         ++H E+GEA   +DF  A KL+G+RF V+ G +A L RAL Q
Sbjct: 119 ENQEVSRWGTPREFSFQVKDHVELGEAAKGLDFAAAVKLTGSRFVVMQGQIARLHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FMIDLHT +HGY E S P LV    +YGTGQ+PKF +D+F T        +    LIPT+
Sbjct: 179 FMIDLHTEQHGYLETSVPYLVNHATLYGTGQLPKFGEDLFHTRPLEEESDSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI+E  +LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I   
Sbjct: 239 EVPLTNLVRDEILEEDTLPVKLTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVTP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E S    E +   AE++L+ L+L YR V LCTGD+GF A KTYDLEVWL  QN YREISS
Sbjct: 299 EQSMEALEELTGHAEKVLQLLNLPYRKVLLCTGDMGFGATKTYDLEVWLPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS  G+FQ+RRM +R R+   K  +  HTLNGSG+AVGR L+A+LENY   DG + +P V
Sbjct: 359 CSNMGDFQARRMQARCRNKQDKKPRLVHTLNGSGLAVGRTLVAVLENYQQEDGRIAVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  + +I
Sbjct: 419 LRPYMKGVEII 429


>gi|241663731|ref|YP_002982091.1| seryl-tRNA synthetase [Ralstonia pickettii 12D]
 gi|240865758|gb|ACS63419.1| seryl-tRNA synthetase [Ralstonia pickettii 12D]
          Length = 438

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 204/439 (46%), Positives = 278/439 (63%), Gaps = 19/439 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   LK R          +L+ + + +  + E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDIDAVAARLKDRCYVLDVAGFAALEAERKAIQTRTEELQARRNSLSKQIGM 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G  +    +  E S + ++L     +   V + L+ L+  IPN+P E VP G    
Sbjct: 61  LKGKGEDA--SGVMAEVSGIGDELKASAAQLDVVQAKLQDLMLSIPNLPHESVPAGRDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G   +     ++H ++G ALGL DFD   KLSGARF+VL G +A L RAL Q
Sbjct: 119 QNVEVRREGTPRTFDFPVKDHVDLGAALGL-DFDAGAKLSGARFTVLKGQVARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT----------DGR---- 226
           FM+D HT EHGYTE   P +V   +M GTGQ+PKF +D+F             DG     
Sbjct: 178 FMLDTHTLEHGYTEAYVPYIVNAASMRGTGQLPKFEEDLFRVPRKMGHSAEGEDGERVEN 237

Query: 227 -WLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCE 285
            +LIPT+EV LTNL   EI+ + +LP+ F   +P FRSEAGS G+DTRGM+RQHQF K E
Sbjct: 238 FYLIPTAEVPLTNLVRDEIVAADALPMMFAAHSPCFRSEAGSYGKDTRGMIRQHQFDKVE 297

Query: 286 LVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQN 345
           +V I + + SF   E M + AE IL++L+L +R V LCTGD+GF + KTYD+EVW+  QN
Sbjct: 298 MVQIVQPQTSFDALEAMTNAAENILRKLELPFRTVVLCTGDMGFGSTKTYDIEVWIPAQN 357

Query: 346 LYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADG 405
            YREISSCS  G+FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+A+LENY NADG
Sbjct: 358 TYREISSCSNMGDFQARRMQARFRNAQGKP-ELVHTLNGSGLAVGRALVAVLENYQNADG 416

Query: 406 SVTIPTVLRPYMNNLAVIK 424
           SVT+PTVLRPY+    V+K
Sbjct: 417 SVTVPTVLRPYLGGQEVLK 435


>gi|312128024|ref|YP_003992898.1| seryl-tRNA synthetase [Caldicellulosiruptor hydrothermalis 108]
 gi|311778043|gb|ADQ07529.1| seryl-tRNA synthetase [Caldicellulosiruptor hydrothermalis 108]
          Length = 420

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 195/417 (46%), Positives = 279/417 (66%), Gaps = 3/417 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD+++IR NPE +   L KR+ +     IL LDE+ R L+ ++E ++A +N  S ++ +
Sbjct: 1   MLDLKYIRSNPEKVQEGLSKRNKDISIAPILELDERRRKLLAEVESLKALQNQKSKEVPK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG    V  L NE   L +++  L+ +  EV   ++K++  IPN+P E VP+G    
Sbjct: 61  LKKEGKD--VTDLMNELKELSDKIKELDSKVKEVEDEIEKILLTIPNIPHESVPVGKDDT 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G+        + H+EIG  LG++DF+RA+K+SG+RF+   G  A LERAL  
Sbjct: 119 ENVEVRRWGEVREPDFEIKPHWEIGVNLGILDFERASKVSGSRFTFYRGLGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLH  +HGYTE+  P LV  ++M GTGQ+PKF +D F TTD  +LIPT+EV +TN +
Sbjct: 179 FMLDLHIEKHGYTELFPPFLVARKSMIGTGQLPKFEEDAFKTTDDYFLIPTAEVPVTNYH 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ + LP+++   +  FR+EAG+AG+DTRG++RQHQF K ELV   + EDS+ E E
Sbjct: 239 REEILKEEDLPIKYVAYSACFRAEAGAAGKDTRGLIRQHQFNKVELVKFAKPEDSYDELE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           ++ + AE++LK L L YRVV LC+GDLGFS+ KTYD+EVW+     Y EISSCS   ++Q
Sbjct: 299 KLTADAEDVLKELGLPYRVVLLCSGDLGFSSAKTYDIEVWMPSYGRYVEISSCSNFESYQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +RR N R+R  + K L + HTLNGSG+AVGR L A+LEN+   DG+V +P VLR YM
Sbjct: 359 ARRANIRFRRKDGK-LDYVHTLNGSGLAVGRTLAAVLENFQQKDGTVVVPEVLRKYM 414


>gi|257885573|ref|ZP_05665226.1| seryl-tRNA synthetase [Enterococcus faecium 1,231,501]
 gi|261206902|ref|ZP_05921591.1| seryl-tRNA synthetase [Enterococcus faecium TC 6]
 gi|289567404|ref|ZP_06447770.1| seryl-tRNA synthetase [Enterococcus faecium D344SRF]
 gi|293557178|ref|ZP_06675729.1| seryl-tRNA synthetase [Enterococcus faecium E1039]
 gi|294614525|ref|ZP_06694437.1| seryl-tRNA synthetase [Enterococcus faecium E1636]
 gi|257821429|gb|EEV48559.1| seryl-tRNA synthetase [Enterococcus faecium 1,231,501]
 gi|260078530|gb|EEW66232.1| seryl-tRNA synthetase [Enterococcus faecium TC 6]
 gi|289160800|gb|EFD08734.1| seryl-tRNA synthetase [Enterococcus faecium D344SRF]
 gi|291592618|gb|EFF24215.1| seryl-tRNA synthetase [Enterococcus faecium E1636]
 gi|291600659|gb|EFF30960.1| seryl-tRNA synthetase [Enterococcus faecium E1039]
          Length = 423

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 204/428 (47%), Positives = 279/428 (65%), Gaps = 9/428 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ +RQN E +   L  R ++ ++    + LDE  R L+ K E+++  RN  SA+I 
Sbjct: 1   MLDVKMMRQNIEEVQEKLMTRGVKKETLAEFMELDENRRKLLVKSEELKKYRNDVSAEIA 60

Query: 60  Q--AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGT 117
           Q     E   + +  +K     +K     L+ E  EV   LK++ + +PN+P + VP+GT
Sbjct: 61  QLKRAKEDASAKIAEMKEVGGNIK----ALDTEIAEVDEKLKQIATTLPNLPHDSVPVGT 116

Query: 118 SANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
              +N+ IR   +  +     + H+EI E L ++DF+R  K++G+RF    G  A LERA
Sbjct: 117 DEEDNVEIRRWSEPRTFAFEPKPHWEIAENLDILDFERGAKVAGSRFVYYKGLGARLERA 176

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSL 236
           +  FM+D H  EHGYTE+  P +V  +AM+GTGQ PKF +D+F   +    LIPT+EV L
Sbjct: 177 VYNFMLDQHIYEHGYTEMITPYIVNSKAMFGTGQFPKFKEDVFQLENTDLTLIPTAEVPL 236

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN Y+ EI++   LP+ FT L+P+FRSEAGSAGRDTRG++R HQF K E+V  +  E S+
Sbjct: 237 TNYYNDEILDGADLPIYFTALSPAFRSEAGSAGRDTRGLIRLHQFNKVEMVKFSDAEHSY 296

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            E E+M + AE+ILK+L L YRV++L TGD+GFSA KTYDLEVW+  Q+ YREISSCS C
Sbjct: 297 EELEKMTADAEDILKKLHLPYRVMALSTGDMGFSAAKTYDLEVWIPAQDTYREISSCSNC 356

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
            +FQ+RR   RYRD N   + + HTLNGSG+AVGR + AILENY N DGSVT+P  L PY
Sbjct: 357 EDFQARRAMIRYRD-NDGKIHYAHTLNGSGLAVGRTVAAILENYQNEDGSVTVPEALVPY 415

Query: 417 MNNLAVIK 424
           M NL VIK
Sbjct: 416 MGNLKVIK 423


>gi|315612585|ref|ZP_07887498.1| serine--tRNA ligase [Streptococcus sanguinis ATCC 49296]
 gi|315315566|gb|EFU63605.1| serine--tRNA ligase [Streptococcus sanguinis ATCC 49296]
          Length = 424

 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/426 (47%), Positives = 275/426 (64%), Gaps = 5/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IR + + +   L  R ++P     +  +D K R ++ K+E ++A RN+ SA+I 
Sbjct: 1   MLDIKRIRTDFDAVAEKLATRGVDPAILNEMKKIDAKRRDILVKVETLKAERNTVSAEIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA  + N    D       TL  ++  L+ E  ++ S L +  + +PN+P + VPIG   
Sbjct: 61  QA--KRNKENADDKIAAMQTLSAEVKALDAELADIDSKLTEFTTTLPNIPADSVPIGADE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+ +R  G         + H+++GE LG++D++R  K++GARF    G  A LERA+ 
Sbjct: 119 DDNVEVRRWGTPREFDFEPKAHWDLGEDLGILDWERGGKVTGARFLFYKGLGARLERAIY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLTN 238
            FM+D H  E GYTEV  P +V  ++M+GTG  PKF DD F      + LIPT+EV LTN
Sbjct: 179 NFMLDEHGKE-GYTEVITPYMVNHDSMFGTGNYPKFKDDTFELKATNYVLIPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  EI++ K LP+ FT ++PSFRSEAGSAGRDTRG++R HQF K E+V   + E+S+ E
Sbjct: 238 YYRDEILDGKDLPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESYEE 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M + AE IL++L+L YRVV+L TGD+GFSA KTYDLEVW+  QN YREISSCS   +
Sbjct: 298 LEKMTANAENILQKLNLPYRVVALSTGDMGFSAAKTYDLEVWIPAQNTYREISSCSNTED 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   RYRD     +K  HTLNGSG+AVGR + AILENY N DGSVTIP  LRPYM 
Sbjct: 358 FQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEALRPYMG 417

Query: 419 NLAVIK 424
              VIK
Sbjct: 418 GAEVIK 423


>gi|77459804|ref|YP_349311.1| seryl-tRNA synthetase [Pseudomonas fluorescens Pf0-1]
 gi|123604068|sp|Q3KA84|SYS_PSEPF RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|77383807|gb|ABA75320.1| serine tRNA synthetase; also charges selenocystein tRNA with serine
           [Pseudomonas fluorescens Pf0-1]
          Length = 426

 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 201/433 (46%), Positives = 280/433 (64%), Gaps = 18/433 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R N + +   L  R        I +L+E+ + +  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRSNLQDVADRLASRGFALDVARIEALEEQRKTVQTRTEALQAERNARSKSIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A   G      ++ V+ +  E S  K +L  ++ E       L  ++  IPN+P E VP+
Sbjct: 61  AKQRGEDIAPLMADVERMAGELSAGKVELEAIQTE-------LDSILLGIPNLPHESVPV 113

Query: 116 GTSANENILIRSVGKKPSAIHLS-REHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           G   + N+ +R  G  P+A     ++H  +GE  G +DF+ A KLSGARF++L G +A L
Sbjct: 114 GEDEDGNVEVRRWGT-PTAFDFPVQDHVALGEKFGWLDFETAAKLSGARFALLRGPIARL 172

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIP 230
            RAL QFMI+LH +EHGY E   P LV+  A+ GTGQ+PKF +D+F    +G    +LIP
Sbjct: 173 HRALAQFMINLHVTEHGYEEAYTPYLVQAPALQGTGQLPKFEEDLFKIAREGEADLYLIP 232

Query: 231 TSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT 290
           T+EVSLTN+ + EI++SK LP++F    P FRSEAG++GRDTRGM+RQHQF K E+V I 
Sbjct: 233 TAEVSLTNIVAGEIVDSKQLPIKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIV 292

Query: 291 REEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREI 350
               S    E + + AE++L+ L L YR ++LCTGD+GFSA KTYDLEVW+  Q+ YREI
Sbjct: 293 EPSKSMEALESLTANAEKVLQLLGLPYRTLALCTGDMGFSAVKTYDLEVWIPSQDKYREI 352

Query: 351 SSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIP 410
           SSCS CG+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P
Sbjct: 353 SSCSNCGDFQARRMQARFRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVP 412

Query: 411 TVLRPYMNNLAVI 423
            VL+PYM  L VI
Sbjct: 413 DVLKPYMGGLEVI 425


>gi|332759807|gb|EGJ90110.1| seryl-tRNA synthetase [Shigella flexneri 4343-70]
          Length = 430

 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 199/431 (46%), Positives = 270/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDTLQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T        T    LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++     P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMIAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|161503911|ref|YP_001571023.1| seryl-tRNA synthetase [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|189083583|sp|A9MHZ1|SYS_SALAR RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|160865258|gb|ABX21881.1| hypothetical protein SARI_02001 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 430

 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 198/431 (45%), Positives = 270/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L    E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVNTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRREVNKLGEELDAAKAELEALLAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEIRDHVTLGEMHSGLDFAAAVKLTGSRFVVMRGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T        +    LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNHDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIIDEDQLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNIWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|308272097|emb|CBX28705.1| Seryl-tRNA synthetase [uncultured Desulfobacterium sp.]
          Length = 431

 Score =  395 bits (1014), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 198/426 (46%), Positives = 284/426 (66%), Gaps = 7/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           ML+I+++RQN + +  ++ KRH     E   + D K R ++ +IE++R RRN  S +I  
Sbjct: 8   MLEIKFVRQNLDLVQSSILKRHKSADIEGFKNYDSKVRSILLEIEELRHRRNVFSDKIAS 67

Query: 61  AIAEG--NLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTS 118
              +G    +LV  ++NE+    E++ IL  E  E    L K+I  IPN+P   VP G  
Sbjct: 68  MKKKGIDPNTLVLEMRNES----EKIKILNSELLENEEKLNKIIMEIPNMPNASVPEGKD 123

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
            ++N+LIR+VGK P      + H+E+GE+L + DF+RA+K++GARF +  G  A LER++
Sbjct: 124 CSDNLLIRTVGKIPDFDFEPKNHWELGESLKIFDFERASKITGARFPLYFGAGAKLERSI 183

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-GRWLIPTSEVSLT 237
             FM+++HT+EHGYTEV  P +V  +++  TGQ+PKF DD+F       +++PT+EV +T
Sbjct: 184 INFMLEIHTTEHGYTEVLPPFIVNSQSLTSTGQLPKFKDDLFKLEGWDYYMVPTAEVPVT 243

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           N++ +EI++   LP+ +T   P FRSEAGS G+DT+G++RQHQF K ELV   + E S+ 
Sbjct: 244 NIHQNEILDESDLPILYTAYTPCFRSEAGSYGKDTKGLIRQHQFNKVELVKFVKPETSYD 303

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E E++   AE ILKRL+L YRVVSLC GDLGFS+ +TYD+EVW+  Q +YREISSCS   
Sbjct: 304 ELEKLTQDAESILKRLNLPYRVVSLCAGDLGFSSAQTYDIEVWMPAQGVYREISSCSNFE 363

Query: 358 NFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           NFQ+RR N R++   +K  +  HTLNGSG+AVGR + AI+ENY   DGS+ IP  LRPYM
Sbjct: 364 NFQARRGNIRFKRKGAKKTELVHTLNGSGLAVGRTVAAIIENYQQKDGSIIIPDSLRPYM 423

Query: 418 NNLAVI 423
            N+  I
Sbjct: 424 GNMERI 429


>gi|206561375|ref|YP_002232140.1| seryl-tRNA synthetase [Burkholderia cenocepacia J2315]
 gi|238693102|sp|B4EBR4|SYS_BURCJ RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|198037417|emb|CAR53352.1| seryl-tRNA synthetase [Burkholderia cenocepacia J2315]
          Length = 433

 Score =  395 bits (1014), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 202/430 (46%), Positives = 273/430 (63%), Gaps = 11/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R +    E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDLDGVAKRLADRGYTLDVAAFSALEAERRAIQTHTEELQARRNSLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G  +   A+  E S + + +   E +  E+ + L  L+  +PNV  E VP+G    
Sbjct: 61  MKGKGEDT--SAVMAEVSGIGDDMKASEAKLGEIQARLSDLMLGMPNVAHESVPVGKDEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G         ++H ++G  LGL DF+   KL+GARF++L G +A L RAL Q
Sbjct: 119 DNVEVRRWGTPRQFDFEVKDHVDVGTPLGL-DFETGAKLAGARFTMLRGPIARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-------RWLIPTSE 233
           FMID HT +HGYTE   P +V  E +YGTGQ+PKFADDMF    G       ++LI TSE
Sbjct: 178 FMIDTHTQQHGYTETYTPYIVNPEILYGTGQLPKFADDMFRVEKGGAENTVTQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     I++  +LP++ T  +P FRSEAGS GRDTRGM+RQHQF K E+V +   E
Sbjct: 238 ISLTNTVRESIVDGAALPIKLTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQVVAPE 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   + M+  AE IL++L L YRV++LCTGD+GFSA KT+DLEVWL  QN YREISSC
Sbjct: 298 TSYAALDEMVGHAEAILQKLGLPYRVITLCTGDMGFSAAKTFDLEVWLPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S    FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+A+LENY NADGSVT+P VL
Sbjct: 358 SNTEAFQARRMQARFRNAQGKP-ELVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPEVL 416

Query: 414 RPYMNNLAVI 423
           RPYM  +  I
Sbjct: 417 RPYMGGMERI 426


>gi|324019016|gb|EGB88235.1| seryl-tRNA synthetase [Escherichia coli MS 117-3]
          Length = 430

 Score =  395 bits (1014), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 199/431 (46%), Positives = 270/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--------TDGRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T        T    LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+   L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLRGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|312961665|ref|ZP_07776163.1| Seryl-tRNA synthetase [Pseudomonas fluorescens WH6]
 gi|311283924|gb|EFQ62507.1| Seryl-tRNA synthetase [Pseudomonas fluorescens WH6]
          Length = 426

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 200/434 (46%), Positives = 283/434 (65%), Gaps = 18/434 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R N + +   L  R        I +L+E+ + +  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRSNLQDVADRLASRGFALDVARIEALEEQRKTVQTRTEALQAERNARSKSIGQ 60

Query: 61  AIAEGN-----LSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
           A   G      ++ V+ +  E S  K +L        ++ S L  ++  IPN+P E VPI
Sbjct: 61  AKQRGEDIAPLMADVERMGTELSDGKVEL-------DKIQSELDSILLGIPNIPHESVPI 113

Query: 116 GTSANENILIRSVGKKPSAIHLS-REHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHL 174
           G   + N+ +R  G  P A     ++H  +GE  G +DF+ A K+SGARF++L G +A +
Sbjct: 114 GADEDGNVEVRRWGT-PKAFDFEIKDHVALGELTGGLDFETAAKMSGARFALLRGPIARM 172

Query: 175 ERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGR---WLIP 230
            RAL QFMI+LHT+EHGY E   P LV+  A+ GT Q+PKF +D+F  + DG    +LIP
Sbjct: 173 HRALAQFMINLHTAEHGYEEAYTPYLVQAPALVGTSQLPKFEEDLFKISRDGEADLYLIP 232

Query: 231 TSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT 290
           T+EVSLTN+ + EI+++K LP++F   +P FRSEAG++GRDTRGM+RQHQF K E+V + 
Sbjct: 233 TAEVSLTNIVAGEILDAKQLPIKFVAHSPCFRSEAGASGRDTRGMIRQHQFDKVEMVQVV 292

Query: 291 REEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREI 350
               S    E + + AE +L+ L+L YRV+SLCTGD+GFSA KTYDLEVW+  Q+ YREI
Sbjct: 293 EPSTSMQALEGLTANAERVLQLLELPYRVLSLCTGDMGFSAVKTYDLEVWVPSQDKYREI 352

Query: 351 SSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIP 410
           SSCS CG+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P
Sbjct: 353 SSCSNCGDFQARRMQARFRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVP 412

Query: 411 TVLRPYMNNLAVIK 424
            VL+PYM  + VI+
Sbjct: 413 EVLKPYMAGVEVIR 426


>gi|242280836|ref|YP_002992965.1| seryl-tRNA synthetase [Desulfovibrio salexigens DSM 2638]
 gi|259511664|sp|C6BS43|SYS_DESAD RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|242123730|gb|ACS81426.1| seryl-tRNA synthetase [Desulfovibrio salexigens DSM 2638]
          Length = 425

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 193/428 (45%), Positives = 286/428 (66%), Gaps = 5/428 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD+++++ N + +  +L+KR  +        LD + + L++++E ++A RNS S +I +
Sbjct: 1   MLDLKFVQNNLDVVRESLEKRGSKLDVNEFSDLDSRRKSLLQEVESLKAERNSTSGEIAK 60

Query: 61  AIAEG-NLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
              EG + S + A   E S    ++  L+++  ++ ++ ++ +S +PN+P E VP G + 
Sbjct: 61  IKREGGDASEIIARMGEVSG---KIKALDEDLKDIEAAEREWLSSVPNMPDESVPFGKTE 117

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N +IR  G+KP      REH+++   LG +DF+RA KL+GARF VL    A LERAL 
Sbjct: 118 DDNPVIRHWGEKPEFDFTPREHWDLAVELGGVDFERAAKLTGARFVVLKKWGARLERALT 177

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRW-LIPTSEVSLTN 238
            FM+D+ T +HGYTEV  P +V  ++++GTGQ+PKF +D+F   +  + +IPT+EV LTN
Sbjct: 178 SFMVDVQTMDHGYTEVIPPYIVNRDSLFGTGQLPKFEEDLFKLKNWEYYMIPTAEVPLTN 237

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L+  E++    L + +    P FRSEAGS G+DT+G++RQHQF K E+V     + SF +
Sbjct: 238 LHRDEVLSEDDLSIAYCAPTPCFRSEAGSYGKDTKGLIRQHQFHKVEMVRFAHPDKSFED 297

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M   AEEILKRL LHYRV++LCTGD+GF + KTYD+EVWL GQ+ YREISSCS C +
Sbjct: 298 LEKMTGHAEEILKRLGLHYRVITLCTGDMGFGSAKTYDIEVWLPGQDKYREISSCSNCVD 357

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N +++  +SK  +F HTLNGSG+AVGR  +A++ENY   DGS+ IP  LRPYM 
Sbjct: 358 FQARRANIKFQPKDSKKKQFVHTLNGSGLAVGRTFVAVVENYQQKDGSIVIPEALRPYMG 417

Query: 419 NLAVIKKE 426
            L VI  E
Sbjct: 418 GLEVITAE 425


>gi|90961171|ref|YP_535087.1| seryl-tRNA synthetase [Lactobacillus salivarius UCC118]
 gi|301299680|ref|ZP_07205935.1| serine--tRNA ligase [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|122449395|sp|Q1WVB3|SYS_LACS1 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|90820365|gb|ABD99004.1| Seryl-tRNA synthetase [Lactobacillus salivarius UCC118]
 gi|300852720|gb|EFK80349.1| serine--tRNA ligase [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 425

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 205/430 (47%), Positives = 282/430 (65%), Gaps = 10/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS-EYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IR N E     L  R ++P+  + +++ D+K R L+ + E+++  RN  S  I 
Sbjct: 1