PSIBLAST alignment of GI: 254780680 and protein with PDB id: 2dq3

>gi|149241134|pdb|2DQ3|A Chain A, Crystal Structure Of Aq_298 Length = 425
>gi|149241135|pdb|2DQ3|B Chain B, Crystal Structure Of Aq_298 Length = 425
 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 203/428 (47%), Positives = 280/428 (65%), Gaps = 7/428 (1%)

Query: 2   LDIQWIRQNPEHLDIALKKRHLEP--QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           +DI  IR+ P+++   L  R  E     + +L LD++ R +IK++E +R+ RN  S +IG
Sbjct: 2   IDINLIREKPDYVKERLATRDKELVSLVDKVLELDKRRREIIKRLEALRSERNKLSKEIG 61

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           +   EG  +    ++N    LKE++  LE+E  +V   LK  +  IPN+P   VP+G   
Sbjct: 62  KLKREGKDT--TEIQNRVKELKEEIDRLEEELRKVEEELKNTLLWIPNLPHPSVPVGEDE 119

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            +N+ +R  G+        + H+EIGE LG++DF R  KLSG+RF+V+ G  A LERAL 
Sbjct: 120 KDNVEVRRWGEPRKFDFEPKPHWEIGERLGILDFKRGAKLSGSRFTVIAGWGARLERALI 179

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGRWLIPTSEVSLTN 238
            F +DLHT + GY E+  P LV+ E + GTGQ+PKF +D++ C  D  +LIPT+EV LTN
Sbjct: 180 NFXLDLHT-KKGYKEICPPHLVKPEILIGTGQLPKFEEDLYKCERDNLYLIPTAEVPLTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           LY  EI++ ++LP+  T   P +R EAG+ G+D RG++RQHQF K ELV I   + S+ E
Sbjct: 239 LYREEILKEENLPIYLTAYTPCYRREAGAYGKDIRGIIRQHQFDKVELVKIVHPDTSYDE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+++  AEE+L+ L L YRVV LCTGDLGFSA KTYD+EVW   QN YREISSCS C +
Sbjct: 299 LEKLVKDAEEVLQLLGLPYRVVELCTGDLGFSAAKTYDIEVWFPSQNKYREISSCSNCED 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N+R++D  +   +F HTLNGSG+AVGR L AILENY   DGSV +P VLR Y+ 
Sbjct: 359 FQARRXNTRFKDSKTGKNRFVHTLNGSGLAVGRTLAAILENYQQEDGSVVVPEVLRDYV- 417

Query: 419 NLAVIKKE 426
              VI+ E
Sbjct: 418 GTDVIRPE 425