BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780680|ref|YP_003065093.1| seryl-tRNA synthetase
[Candidatus Liberibacter asiaticus str. psy62]
         (430 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|46578654|ref|YP_009462.1| seryl-tRNA synthetase [Desulfovibrio vulgaris str. Hildenborough]
 gi|67461806|sp|Q72FH6|SYS_DESVH RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|46448065|gb|AAS94721.1| seryl-tRNA synthetase [Desulfovibrio vulgaris str. Hildenborough]
 gi|311232527|gb|ADP85381.1| seryl-tRNA synthetase [Desulfovibrio vulgaris RCH1]
          Length = 424

 Score =  468 bits (1204), Expect = e-130,   Method: Composition-based stats.
 Identities = 203/425 (47%), Positives = 272/425 (64%), Gaps = 3/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++ +++NPE +  AL  RH +       +LD + R L+ ++E +++ RN  SA++ +
Sbjct: 1   MLDLKLLQKNPEVVAKALAMRHSDIDIATFTTLDTRRRALLTEVESLKSERNKASAEVAK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G      AL      + E++  L+ E   V S     +  IPN+P E VP G   N
Sbjct: 61  AKRAG--EDASALIERLGGVSERIKALDLEAEAVKSEQNDWMLTIPNIPHESVPEGRDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G   +     REH++IG ALG +DF+RA KL+G+RF+V     A LERAL  
Sbjct: 119 DNVEVLRWGTPRAFSFTPREHWDIGVALGGLDFERAGKLAGSRFTVYWKWAARLERALAN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-TTDGRWLIPTSEVSLTNL 239
           + +D H S +GYTEV  P +V  + M GTGQ+PKF +D+F   +   +LIPT+EV LTNL
Sbjct: 179 YFLDTHISANGYTEVLPPFMVNRKTMTGTGQLPKFEEDLFRLESWDYFLIPTAEVPLTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           ++ EI+E   LPL +T   P FRSEAGS G+DTRG++RQHQF K E+V     E SF E 
Sbjct: 239 HADEILEEGDLPLGYTAQTPCFRSEAGSYGKDTRGLIRQHQFTKVEMVRFAHPERSFDEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           ERM   AE +L+ L L YRV++LC+GD+GFSA KTYDLEVWL GQ+ YREISSCS CG+F
Sbjct: 299 ERMRGHAEALLQNLGLPYRVITLCSGDMGFSATKTYDLEVWLPGQDKYREISSCSNCGDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N R+R       +F HTLNGSG+AVGR L+A+LENY   DGSV +P VLRPYM  
Sbjct: 359 QARRANIRFRPAGGGKPEFVHTLNGSGLAVGRTLVAVLENYQQEDGSVIVPEVLRPYMGG 418

Query: 420 LAVIK 424
           L  I 
Sbjct: 419 LERIT 423


>gi|120603778|ref|YP_968178.1| seryl-tRNA synthetase [Desulfovibrio vulgaris DP4]
 gi|166221435|sp|A1VH35|SYS_DESVV RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|120564007|gb|ABM29751.1| seryl-tRNA synthetase [Desulfovibrio vulgaris DP4]
          Length = 424

 Score =  468 bits (1204), Expect = e-130,   Method: Composition-based stats.
 Identities = 203/425 (47%), Positives = 272/425 (64%), Gaps = 3/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++ +++NPE +  AL  RH +       +LD + R L+ ++E +++ RN  SA++ +
Sbjct: 1   MLDLKLLQKNPEVVAKALAMRHSDIDIATFTTLDTRRRALLTEVESLKSERNKASAEVAK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G      AL      + E++  L+ E   V S     +  IPN+P E VP G   N
Sbjct: 61  AKRAG--EDASALIERLGGVSERIKALDLEAEAVKSEQNDWMLTIPNIPHESVPEGRDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G   +     REH++IG ALG +DF+RA KL+G+RF+V     A LERAL  
Sbjct: 119 DNVEVLRWGTPRAFSFTPREHWDIGVALGGLDFERAGKLAGSRFTVYWKWAARLERALAN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-TTDGRWLIPTSEVSLTNL 239
           + +D H S +GYTEV  P +V  + M GTGQ+PKF +D+F   +   +LIPT+EV LTNL
Sbjct: 179 YFLDTHISANGYTEVLPPFMVNRKTMTGTGQLPKFEEDLFRLESWDYFLIPTAEVPLTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           ++ EI+E   LPL +T   P FRSEAGS G+DTRG++RQHQF K E+V     E SF E 
Sbjct: 239 HADEILEEGDLPLGYTAQTPCFRSEAGSYGKDTRGLIRQHQFTKVEMVRFAHPERSFEEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           ERM   AE +L+ L L YRV++LC+GD+GFSA KTYDLEVWL GQ+ YREISSCS CG+F
Sbjct: 299 ERMRGHAEALLQNLGLPYRVITLCSGDMGFSATKTYDLEVWLPGQDKYREISSCSNCGDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N R+R       +F HTLNGSG+AVGR L+A+LENY   DGSV +P VLRPYM  
Sbjct: 359 QARRANIRFRPAGGGKPEFVHTLNGSGLAVGRTLVAVLENYQQEDGSVIVPEVLRPYMGG 418

Query: 420 LAVIK 424
           L  I 
Sbjct: 419 LERIT 423


>gi|306843782|ref|ZP_07476380.1| seryl-tRNA synthetase [Brucella sp. BO1]
 gi|306275860|gb|EFM57576.1| seryl-tRNA synthetase [Brucella sp. BO1]
          Length = 469

 Score =  464 bits (1194), Expect = e-128,   Method: Composition-based stats.
 Identities = 258/425 (60%), Positives = 321/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 43  MLDIKWIRENPETLDKALAKRGAAPLSSELIALDEKRREHVGKVQAAQERRNAASKEIGK 102

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LKE L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 103 AMAAKDMDTAEKLKAEVGELKEFLAHAEEDERRLSKELNDALSTIPNIPLDDVPLGKDES 162

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 163 DNVELRRIGNPRNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 222

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 223 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 282

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K E+VS+T  E S  EHE
Sbjct: 283 AEEIVDMKGLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSVTDAESSVAEHE 342

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 343 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 402

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSGVAVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 403 GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQQEDGSIHIPEALQPYMGGL 462

Query: 421 AVIKK 425
             I+K
Sbjct: 463 TRIEK 467


>gi|306840377|ref|ZP_07473144.1| seryl-tRNA synthetase [Brucella sp. BO2]
 gi|306289662|gb|EFM60862.1| seryl-tRNA synthetase [Brucella sp. BO2]
          Length = 469

 Score =  463 bits (1192), Expect = e-128,   Method: Composition-based stats.
 Identities = 258/425 (60%), Positives = 321/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 43  MLDIKWIRENPETLDKALAKRGAAPLSSELIALDEKRREHVGKVQAAQERRNAASKEIGK 102

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LKE L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 103 AMAAKDMDTAEKLKAEVGELKEFLAHAEEDERRLSKELSDALSTIPNIPLDDVPLGKDES 162

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 163 DNVELRRIGNPRNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 222

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 223 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 282

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K E+VS+T  E S  EHE
Sbjct: 283 AEEIVDMKGLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSVTDAESSVAEHE 342

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 343 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 402

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSGVAVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 403 GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQQEDGSIHIPEALQPYMGGL 462

Query: 421 AVIKK 425
             I+K
Sbjct: 463 TRIEK 467


>gi|148559314|ref|YP_001258859.1| seryl-tRNA synthetase [Brucella ovis ATCC 25840]
 gi|148370571|gb|ABQ60550.1| seryl-tRNA synthetase [Brucella ovis ATCC 25840]
          Length = 469

 Score =  462 bits (1189), Expect = e-128,   Method: Composition-based stats.
 Identities = 258/425 (60%), Positives = 321/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 43  MLDIKWIRENPETLDKALAKRGAAPLSSELIALDEKRREHVGKVQAAQERRNAASKEIGK 102

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LK+ L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 103 AMAAKDMGTAEKLKAEVGELKDFLAHAEEDERCLSKELSDALSTIPNIPLDDVPLGKDES 162

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 163 DNVELRRIGNPHNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 222

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 223 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 282

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K E+VSIT  E S  EHE
Sbjct: 283 AEEIVDMKGLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSITDAESSVAEHE 342

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 343 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 402

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSGVAVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 403 GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQQEDGSIHIPEALQPYMGGL 462

Query: 421 AVIKK 425
             I+K
Sbjct: 463 TRIEK 467


>gi|258405089|ref|YP_003197831.1| seryl-tRNA synthetase [Desulfohalobium retbaense DSM 5692]
 gi|257797316|gb|ACV68253.1| seryl-tRNA synthetase [Desulfohalobium retbaense DSM 5692]
          Length = 426

 Score =  462 bits (1189), Expect = e-128,   Method: Composition-based stats.
 Identities = 199/428 (46%), Positives = 283/428 (66%), Gaps = 3/428 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++++R++PE +  AL+KR+++   +   ++D K R  ++++ED+++RRN  S QIGQ
Sbjct: 1   MLDLKFVRKSPETVKDALRKRNMDLDLDAFQAIDAKRREYLQEVEDLKSRRNEVSKQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G     + L        E++  L+    E  + ++  +  +PN+P   VP G    
Sbjct: 61  RKKNG--EDAEDLIQAMGEAAERIKELDALAKEAEAEVQDWMLSLPNIPDTSVPDGEDDA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N  +R+ G  P+   L +EH+E+G  L  +DF+RA KL+G+RF+V  G  A LERAL Q
Sbjct: 119 DNEELRTWGALPTFSFLPKEHWELGVQLSGLDFERAAKLTGSRFAVYWGWAAKLERALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-TTDGRWLIPTSEVSLTNL 239
           FM+D+ T+EH YTEV  P++V  + M GTGQ+PKF +D+F       +LIPT+EV LTNL
Sbjct: 179 FMLDIQTTEHDYTEVMPPVIVNSQTMRGTGQLPKFEEDLFKLEGWEYYLIPTAEVPLTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           ++ E+++ + LP  +    P FRSEAGS G+DT+G++RQHQF K ELV     + SF E 
Sbjct: 239 HAGEVLDEQDLPRGYAAFTPCFRSEAGSYGKDTKGLIRQHQFNKVELVRFAHPDHSFEEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E +L  AE +LKRL+L YRVV+LC GD+GFSA KTYDLEVWL GQ+ YREISSCS CG+F
Sbjct: 299 ENLLGHAETVLKRLELPYRVVTLCGGDIGFSAVKTYDLEVWLPGQDTYREISSCSNCGDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR   R++   +K  +F HTLNGSG+AVGR L+A+LENY   DGSV IP  L+PYM  
Sbjct: 359 QARRAGIRFKRAGAKKAEFLHTLNGSGLAVGRTLVAVLENYQQEDGSVAIPEALKPYMGG 418

Query: 420 LAVIKKEH 427
           L  I  ++
Sbjct: 419 LERITPKN 426


>gi|237815315|ref|ZP_04594313.1| seryl-tRNA synthetase [Brucella abortus str. 2308 A]
 gi|237790152|gb|EEP64362.1| seryl-tRNA synthetase [Brucella abortus str. 2308 A]
          Length = 469

 Score =  462 bits (1188), Expect = e-128,   Method: Composition-based stats.
 Identities = 258/425 (60%), Positives = 321/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 43  MLDIKWIRENPETLDKALAKRGAAPLSSELIALDEKRREHVGKVQAAQERRNAASKEIGK 102

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LK+ L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 103 AMAAKDMGTAEKLKAEVGELKDFLAHAEEDERRLSKELSDALSTIPNIPLDDVPLGKDES 162

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 163 DNVELRRIGNPHNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 222

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 223 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 282

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K E+VSIT  E S  EHE
Sbjct: 283 AEEIVDMKGLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSITDAESSVAEHE 342

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 343 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 402

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSGVAVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 403 GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQQEDGSIHIPEALQPYMGGL 462

Query: 421 AVIKK 425
             I+K
Sbjct: 463 TRIEK 467


>gi|225627373|ref|ZP_03785410.1| seryl-tRNA synthetase [Brucella ceti str. Cudo]
 gi|225617378|gb|EEH14423.1| seryl-tRNA synthetase [Brucella ceti str. Cudo]
          Length = 469

 Score =  462 bits (1188), Expect = e-128,   Method: Composition-based stats.
 Identities = 258/425 (60%), Positives = 321/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 43  MLDIKWIRENPETLDKALAKRGAAPLSSELIALDEKRREHVGKVQAAQERRNAASKEIGK 102

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LK+ L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 103 AMAAKDMGTAEKLKAEVGELKDFLAHAEEDERRLSKELSDALSTIPNIPLDDVPLGKDES 162

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 163 DNVELRRIGNPHNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 222

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 223 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 282

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K E+VSIT  E S  EHE
Sbjct: 283 AEEIVDMKGLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSITDAESSVAEHE 342

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 343 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 402

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSGVAVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 403 GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQQEDGSIHIPEALQPYMGGL 462

Query: 421 AVIKK 425
             I+K
Sbjct: 463 TRIEK 467


>gi|288574952|ref|ZP_06393309.1| seryl-tRNA synthetase [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288570693|gb|EFC92250.1| seryl-tRNA synthetase [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 425

 Score =  461 bits (1185), Expect = e-127,   Method: Composition-based stats.
 Identities = 200/425 (47%), Positives = 278/425 (65%), Gaps = 3/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+++R + + +   LK R+ +   + IL LD K R LI ++E+++A RN+ S ++G 
Sbjct: 1   MLDIKYVRDHMDEVRDFLKARNHDFNLDSILELDAKRRELISEVEELKAERNAGSKKVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G      A+      + E++  L+++  EV + L  L+  +PN P + VP+G   +
Sbjct: 61  AKAKG--EDPTAIMERMKAIGEEIKALDQKVAEVDAGLDDLMLQVPNRPHDSVPVGVDED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G           H+++GE LG++DF R  KL+ +RF+V+ G  A LERAL  
Sbjct: 119 DNVEVRKWGDPREFDFEPLPHWDLGENLGILDFKRGVKLAQSRFTVMAGPGARLERALLN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-TDGRWLIPTSEVSLTNL 239
           FM+DLH   HGY E++ P +V    M GTGQ+PKFADD++    D  WLIPT+EV LTNL
Sbjct: 179 FMLDLHVDRHGYKEINPPFMVNSATMTGTGQLPKFADDLYRIADDDLWLIPTAEVPLTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +  EI+E   LPL +T   P FR EAGS GRD RG++RQHQF K E+V ++  E+S+ E 
Sbjct: 239 HGGEIMEESDLPLYYTAYTPCFRKEAGSHGRDVRGIMRQHQFEKVEMVKLSTPENSYEEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++ S AEE+L+ L L YRV++LCTGD+GF A KTYD+EVWL  Q  YREISSCS C +F
Sbjct: 299 EKLTSNAEEVLQLLKLPYRVITLCTGDMGFGASKTYDIEVWLPSQGRYREISSCSNCEDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RRMN+RYR       +F HTLNGSG+A+GR LIA++ENY   DGS+ IP VL PYM  
Sbjct: 359 QARRMNTRYRPSQGGKPRFVHTLNGSGIAIGRALIAVMENYQRTDGSIEIPEVLVPYMGG 418

Query: 420 LAVIK 424
           L  I 
Sbjct: 419 LKEIT 423


>gi|297248235|ref|ZP_06931953.1| seryl-tRNA synthetase [Brucella abortus bv. 5 str. B3196]
 gi|297175404|gb|EFH34751.1| seryl-tRNA synthetase [Brucella abortus bv. 5 str. B3196]
          Length = 469

 Score =  460 bits (1184), Expect = e-127,   Method: Composition-based stats.
 Identities = 257/425 (60%), Positives = 321/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 43  MLDIKWIRENPETLDKALAKRGAAPLSSELIALDEKRREHVGKVQAAQERRNAASKEIGK 102

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LK+ L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 103 AMAAKDMGTAEKLKAEVGELKDFLAHAEEDERRLSKELSDALSTIPNIPLDDVPLGKDES 162

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 163 DNVELRRIGNPHNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 222

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 223 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 282

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAG+AGRDTRGMLRQHQF K E+VSIT  E S  EHE
Sbjct: 283 AEEIVDMKGLPLRFTALTPCFRSEAGAAGRDTRGMLRQHQFLKVEMVSITDAESSVAEHE 342

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 343 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 402

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSGVAVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 403 GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQQEDGSIHIPEALQPYMGGL 462

Query: 421 AVIKK 425
             I+K
Sbjct: 463 TRIEK 467


>gi|17983051|gb|AAL52263.1| seryl-tRNA synthetase [Brucella melitensis bv. 1 str. 16M]
          Length = 469

 Score =  460 bits (1183), Expect = e-127,   Method: Composition-based stats.
 Identities = 257/425 (60%), Positives = 320/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 43  MLDIKWIRENPETLDKALAKRGAAPLSSELIALDEKRREHVGKVQAAQERRNAASKEIGK 102

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LK+ L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 103 AMAAKDMGTAEKLKAEVGELKDFLAHAEEDERRLSKELSDALSTIPNIPLDDVPLGKDES 162

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 163 DNVELRRIGNPHNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 222

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 223 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 282

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K E+VSIT  E S  EHE
Sbjct: 283 AEEIVDMKGLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSITDAESSVAEHE 342

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 343 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 402

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSG AVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 403 GRRMNARYRPEGEKSTRFVHTLNGSGAAVGRALIAVMENYQQEDGSIHIPEALQPYMGGL 462

Query: 421 AVIKK 425
             I+K
Sbjct: 463 TRIEK 467


>gi|306837337|ref|ZP_07470218.1| seryl-tRNA synthetase [Brucella sp. NF 2653]
 gi|306407589|gb|EFM63787.1| seryl-tRNA synthetase [Brucella sp. NF 2653]
          Length = 469

 Score =  459 bits (1182), Expect = e-127,   Method: Composition-based stats.
 Identities = 257/425 (60%), Positives = 321/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 43  MLDIKWIRENPETLDKALAKRGAAPLSFELIALDEKRREHVGKVQAAQERRNAASKEIGK 102

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LK+ L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 103 AMAAKDMGTAEKLKAEVGELKDFLAHAEEDERRLSKELSDALSTIPNIPLDDVPLGKDES 162

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 163 DNVELRRIGNPHNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 222

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 223 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 282

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K E+VS+T  E S  EHE
Sbjct: 283 AEEIVDMKGLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSVTDAESSVAEHE 342

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 343 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 402

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSGVAVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 403 GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQQEDGSIHIPEALQPYMGGL 462

Query: 421 AVIKK 425
             I+K
Sbjct: 463 TRIEK 467


>gi|62289830|ref|YP_221623.1| seryl-tRNA synthetase [Brucella abortus bv. 1 str. 9-941]
 gi|82699755|ref|YP_414329.1| seryl-tRNA synthetase [Brucella melitensis biovar Abortus 2308]
 gi|189024071|ref|YP_001934839.1| seryl-tRNA synthetase [Brucella abortus S19]
 gi|254689135|ref|ZP_05152389.1| seryl-tRNA synthetase [Brucella abortus bv. 6 str. 870]
 gi|254697268|ref|ZP_05159096.1| seryl-tRNA synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701649|ref|ZP_05163477.1| seryl-tRNA synthetase [Brucella suis bv. 5 str. 513]
 gi|254706906|ref|ZP_05168734.1| seryl-tRNA synthetase [Brucella pinnipedialis M163/99/10]
 gi|254709987|ref|ZP_05171798.1| seryl-tRNA synthetase [Brucella pinnipedialis B2/94]
 gi|254713987|ref|ZP_05175798.1| seryl-tRNA synthetase [Brucella ceti M644/93/1]
 gi|254716954|ref|ZP_05178765.1| seryl-tRNA synthetase [Brucella ceti M13/05/1]
 gi|254730167|ref|ZP_05188745.1| seryl-tRNA synthetase [Brucella abortus bv. 4 str. 292]
 gi|256031480|ref|ZP_05445094.1| seryl-tRNA synthetase [Brucella pinnipedialis M292/94/1]
 gi|256060990|ref|ZP_05451148.1| seryl-tRNA synthetase [Brucella neotomae 5K33]
 gi|256159606|ref|ZP_05457368.1| seryl-tRNA synthetase [Brucella ceti M490/95/1]
 gi|256254886|ref|ZP_05460422.1| seryl-tRNA synthetase [Brucella ceti B1/94]
 gi|256369312|ref|YP_003106820.1| seryl-tRNA synthetase [Brucella microti CCM 4915]
 gi|260168614|ref|ZP_05755425.1| seryl-tRNA synthetase [Brucella sp. F5/99]
 gi|260545423|ref|ZP_05821164.1| seryl-tRNA synthetase [Brucella abortus NCTC 8038]
 gi|260754634|ref|ZP_05866982.1| seryl-tRNA synthetase [Brucella abortus bv. 6 str. 870]
 gi|260757857|ref|ZP_05870205.1| seryl-tRNA synthetase [Brucella abortus bv. 4 str. 292]
 gi|260761680|ref|ZP_05874023.1| seryl-tRNA synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|261218759|ref|ZP_05933040.1| seryl-tRNA synthetase [Brucella ceti M13/05/1]
 gi|261222070|ref|ZP_05936351.1| seryl-tRNA synthetase [Brucella ceti B1/94]
 gi|261314369|ref|ZP_05953566.1| seryl-tRNA synthetase [Brucella pinnipedialis M163/99/10]
 gi|261317535|ref|ZP_05956732.1| seryl-tRNA synthetase [Brucella pinnipedialis B2/94]
 gi|261321742|ref|ZP_05960939.1| seryl-tRNA synthetase [Brucella ceti M644/93/1]
 gi|261324992|ref|ZP_05964189.1| seryl-tRNA synthetase [Brucella neotomae 5K33]
 gi|261752202|ref|ZP_05995911.1| seryl-tRNA synthetase [Brucella suis bv. 5 str. 513]
 gi|261758088|ref|ZP_06001797.1| seryl-tRNA synthetase [Brucella sp. F5/99]
 gi|265988570|ref|ZP_06101127.1| seryl-tRNA synthetase [Brucella pinnipedialis M292/94/1]
 gi|265998035|ref|ZP_06110592.1| seryl-tRNA synthetase [Brucella ceti M490/95/1]
 gi|81309426|sp|Q57DM2|SYS_BRUAB RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|123546686|sp|Q2YNM6|SYS_BRUA2 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|238689362|sp|B2S5B8|SYS_BRUA1 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|62195962|gb|AAX74262.1| SerS, seryl-tRNA synthetase [Brucella abortus bv. 1 str. 9-941]
 gi|82615856|emb|CAJ10860.1| tRNA synthetases, class-II (G, H, P and S):Seryl-tRNA synthetase,
           class IIa:Aminoacyl-transfer RNA synthetase, class II
           [Brucella melitensis biovar Abortus 2308]
 gi|189019643|gb|ACD72365.1| seryl-tRNA synthetase [Brucella abortus S19]
 gi|255999472|gb|ACU47871.1| seryl-tRNA synthetase [Brucella microti CCM 4915]
 gi|260096830|gb|EEW80705.1| seryl-tRNA synthetase [Brucella abortus NCTC 8038]
 gi|260668175|gb|EEX55115.1| seryl-tRNA synthetase [Brucella abortus bv. 4 str. 292]
 gi|260672112|gb|EEX58933.1| seryl-tRNA synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674742|gb|EEX61563.1| seryl-tRNA synthetase [Brucella abortus bv. 6 str. 870]
 gi|260920654|gb|EEX87307.1| seryl-tRNA synthetase [Brucella ceti B1/94]
 gi|260923848|gb|EEX90416.1| seryl-tRNA synthetase [Brucella ceti M13/05/1]
 gi|261294432|gb|EEX97928.1| seryl-tRNA synthetase [Brucella ceti M644/93/1]
 gi|261296758|gb|EEY00255.1| seryl-tRNA synthetase [Brucella pinnipedialis B2/94]
 gi|261300972|gb|EEY04469.1| seryl-tRNA synthetase [Brucella neotomae 5K33]
 gi|261303395|gb|EEY06892.1| seryl-tRNA synthetase [Brucella pinnipedialis M163/99/10]
 gi|261738072|gb|EEY26068.1| seryl-tRNA synthetase [Brucella sp. F5/99]
 gi|261741955|gb|EEY29881.1| seryl-tRNA synthetase [Brucella suis bv. 5 str. 513]
 gi|262552503|gb|EEZ08493.1| seryl-tRNA synthetase [Brucella ceti M490/95/1]
 gi|264660767|gb|EEZ31028.1| seryl-tRNA synthetase [Brucella pinnipedialis M292/94/1]
          Length = 427

 Score =  459 bits (1181), Expect = e-127,   Method: Composition-based stats.
 Identities = 258/425 (60%), Positives = 321/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 1   MLDIKWIRENPETLDKALAKRGAAPLSSELIALDEKRREHVGKVQAAQERRNAASKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LK+ L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 61  AMAAKDMGTAEKLKAEVGELKDFLAHAEEDERRLSKELSDALSTIPNIPLDDVPLGKDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 121 DNVELRRIGNPHNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 181 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K E+VSIT  E S  EHE
Sbjct: 241 AEEIVDMKGLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSITDAESSVAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 301 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSGVAVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 361 GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQQEDGSIHIPEALQPYMGGL 420

Query: 421 AVIKK 425
             I+K
Sbjct: 421 TRIEK 425


>gi|254693618|ref|ZP_05155446.1| seryl-tRNA synthetase [Brucella abortus bv. 3 str. Tulya]
 gi|261213884|ref|ZP_05928165.1| seryl-tRNA synthetase [Brucella abortus bv. 3 str. Tulya]
 gi|260915491|gb|EEX82352.1| seryl-tRNA synthetase [Brucella abortus bv. 3 str. Tulya]
          Length = 427

 Score =  458 bits (1179), Expect = e-127,   Method: Composition-based stats.
 Identities = 258/425 (60%), Positives = 321/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 1   MLDIKWIRENPETLDKALAKRGAAPLSSELITLDEKRREHVGKVQAAQERRNAASKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LK+ L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 61  AMAAKDMGTAEKLKAEVGELKDFLAHAEEDERRLSKELSDALSTIPNIPLDDVPLGKDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 121 DNVELRRIGNPHNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 181 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K E+VSIT  E S  EHE
Sbjct: 241 AEEIVDMKGLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSITDAESSVAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 301 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSGVAVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 361 GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQQEDGSIHIPEALQPYMGGL 420

Query: 421 AVIKK 425
             I+K
Sbjct: 421 TRIEK 425


>gi|256257384|ref|ZP_05462920.1| seryl-tRNA synthetase [Brucella abortus bv. 9 str. C68]
 gi|260883661|ref|ZP_05895275.1| seryl-tRNA synthetase [Brucella abortus bv. 9 str. C68]
 gi|260873189|gb|EEX80258.1| seryl-tRNA synthetase [Brucella abortus bv. 9 str. C68]
          Length = 427

 Score =  458 bits (1178), Expect = e-127,   Method: Composition-based stats.
 Identities = 257/425 (60%), Positives = 321/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 1   MLDIKWIRENPETLDKALAKRGAAPLSSELIALDEKRREHVGKVQAAQERRNAASKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LK+ L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 61  AMAAKDMGTAEKLKAEVGELKDFLAHAEEDERRLSKELSDALSTIPNIPLDDVPLGKDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 121 DNVELRRIGNPHNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 181 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAG+AGRDTRGMLRQHQF K E+VSIT  E S  EHE
Sbjct: 241 AEEIVDMKGLPLRFTALTPCFRSEAGAAGRDTRGMLRQHQFLKVEMVSITDAESSVAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 301 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSGVAVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 361 GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQQEDGSIHIPEALQPYMGGL 420

Query: 421 AVIKK 425
             I+K
Sbjct: 421 TRIEK 425


>gi|161511138|ref|NP_539999.2| seryl-tRNA synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|225852397|ref|YP_002732630.1| seryl-tRNA synthetase [Brucella melitensis ATCC 23457]
 gi|256044558|ref|ZP_05447462.1| seryl-tRNA synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256113431|ref|ZP_05454272.1| seryl-tRNA synthetase [Brucella melitensis bv. 3 str. Ether]
 gi|256264105|ref|ZP_05466637.1| seryl-tRNA synthetase [Brucella melitensis bv. 2 str. 63/9]
 gi|260563911|ref|ZP_05834397.1| seryl-tRNA synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|265990984|ref|ZP_06103541.1| seryl-tRNA synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994821|ref|ZP_06107378.1| seryl-tRNA synthetase [Brucella melitensis bv. 3 str. Ether]
 gi|30173191|sp|Q8YGS6|SYS_BRUME RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|254783011|sp|C0RIL8|SYS_BRUMB RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|225640762|gb|ACO00676.1| seryl-tRNA synthetase [Brucella melitensis ATCC 23457]
 gi|260153927|gb|EEW89019.1| seryl-tRNA synthetase [Brucella melitensis bv. 1 str. 16M]
 gi|262765934|gb|EEZ11723.1| seryl-tRNA synthetase [Brucella melitensis bv. 3 str. Ether]
 gi|263001768|gb|EEZ14343.1| seryl-tRNA synthetase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094323|gb|EEZ18168.1| seryl-tRNA synthetase [Brucella melitensis bv. 2 str. 63/9]
 gi|326408903|gb|ADZ65968.1| seryl-tRNA synthetase [Brucella melitensis M28]
 gi|326538622|gb|ADZ86837.1| seryl-tRNA synthetase [Brucella melitensis M5-90]
          Length = 427

 Score =  458 bits (1177), Expect = e-126,   Method: Composition-based stats.
 Identities = 257/425 (60%), Positives = 320/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 1   MLDIKWIRENPETLDKALAKRGAAPLSSELIALDEKRREHVGKVQAAQERRNAASKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LK+ L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 61  AMAAKDMGTAEKLKAEVGELKDFLAHAEEDERRLSKELSDALSTIPNIPLDDVPLGKDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 121 DNVELRRIGNPHNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 181 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K E+VSIT  E S  EHE
Sbjct: 241 AEEIVDMKGLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSITDAESSVAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 301 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSG AVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 361 GRRMNARYRPEGEKSTRFVHTLNGSGAAVGRALIAVMENYQQEDGSIHIPEALQPYMGGL 420

Query: 421 AVIKK 425
             I+K
Sbjct: 421 TRIEK 425


>gi|254718989|ref|ZP_05180800.1| seryl-tRNA synthetase [Brucella sp. 83/13]
 gi|265983979|ref|ZP_06096714.1| seryl-tRNA synthetase [Brucella sp. 83/13]
 gi|264662571|gb|EEZ32832.1| seryl-tRNA synthetase [Brucella sp. 83/13]
          Length = 427

 Score =  457 bits (1176), Expect = e-126,   Method: Composition-based stats.
 Identities = 257/425 (60%), Positives = 321/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 1   MLDIKWIRENPETLDKALAKRGAAPLSFELIALDEKRREHVGKVQAAQERRNAASKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LK+ L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 61  AMAAKDMGTAEKLKAEVGELKDFLAHAEEDERRLSKELSDALSTIPNIPLDDVPLGKDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 121 DNVELRRIGNPHNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 181 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K E+VS+T  E S  EHE
Sbjct: 241 AEEIVDMKGLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSVTDAESSVAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 301 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSGVAVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 361 GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQQEDGSIHIPEALQPYMGGL 420

Query: 421 AVIKK 425
             I+K
Sbjct: 421 TRIEK 425


>gi|23501771|ref|NP_697898.1| seryl-tRNA synthetase [Brucella suis 1330]
 gi|161618845|ref|YP_001592732.1| seryl-tRNA synthetase [Brucella canis ATCC 23365]
 gi|163843156|ref|YP_001627560.1| seryl-tRNA synthetase [Brucella suis ATCC 23445]
 gi|254704192|ref|ZP_05166020.1| seryl-tRNA synthetase [Brucella suis bv. 3 str. 686]
 gi|260566558|ref|ZP_05837028.1| seryl-tRNA synthetase [Brucella suis bv. 4 str. 40]
 gi|261754861|ref|ZP_05998570.1| seryl-tRNA synthetase [Brucella suis bv. 3 str. 686]
 gi|30173166|sp|Q8G139|SYS_BRUSU RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|189083559|sp|A9MAQ8|SYS_BRUC2 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|189083560|sp|B0CLL0|SYS_BRUSI RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|23347700|gb|AAN29813.1| seryl-tRNA synthetase [Brucella suis 1330]
 gi|161335656|gb|ABX61961.1| seryl-tRNA synthetase [Brucella canis ATCC 23365]
 gi|163673879|gb|ABY37990.1| seryl-tRNA synthetase [Brucella suis ATCC 23445]
 gi|260156076|gb|EEW91156.1| seryl-tRNA synthetase [Brucella suis bv. 4 str. 40]
 gi|261744614|gb|EEY32540.1| seryl-tRNA synthetase [Brucella suis bv. 3 str. 686]
          Length = 427

 Score =  456 bits (1173), Expect = e-126,   Method: Composition-based stats.
 Identities = 257/425 (60%), Positives = 321/425 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR   P S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 1   MLDIKWIRENPETLDKALAKRGAAPLSSELIALDEKRREHVGKVQAAQERRNAASKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  ++   + LK E   LK+ L   E++E  +   L   +S IPN+PL++VP+G   +
Sbjct: 61  AMAAKDMGTAEKLKAEVGELKDFLAHAEEDERRLSKELSDALSTIPNIPLDDVPLGKDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R +G   +     +EHFE+GEALG MDF+RA KL+GARF+VL G LA LERALGQ
Sbjct: 121 DNVELRRIGNPHNFSFQPKEHFELGEALGYMDFERAAKLAGARFTVLKGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTEV  PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 181 FMLDLHTTEHGYTEVMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++ K LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K E+VSIT  E S  EHE
Sbjct: 241 AEEIVDMKGLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSITDAESSVAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A +TYD+EVWL GQN YREISSCSTCG+FQ
Sbjct: 301 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQRTYDIEVWLPGQNTYREISSCSTCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSGVAVGR LIA++ENY   DGS+ IP  L+PY+  L
Sbjct: 361 GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQQEDGSIHIPEALQPYIGGL 420

Query: 421 AVIKK 425
             I+K
Sbjct: 421 TRIEK 425


>gi|78355243|ref|YP_386692.1| seryl-tRNA synthetase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|123768909|sp|Q316Z9|SYS_DESDG RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|78217648|gb|ABB36997.1| seryl-tRNA synthetase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 427

 Score =  454 bits (1169), Expect = e-126,   Method: Composition-based stats.
 Identities = 203/428 (47%), Positives = 284/428 (66%), Gaps = 4/428 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++ ++ NPE +  AL KR+         +LD++ R L+ ++E +++ RN  S  + +
Sbjct: 1   MLDLKLLQNNPEVVAEALAKRNSGIDITLFTALDQRRRELLLEVEALKSERNKASGDVAR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G     DAL  +   L +++  L+ E   V + + + +  +PN+P E VP G   N
Sbjct: 61  MKRAG--ENADALIEKLGALSDRIKTLDAETETVKAEVHQWLISLPNIPHESVPAGADEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ + + G+KPS     +EH+EIG ALG +DF+R ++L+G+RF+VL    A LERAL  
Sbjct: 119 DNVFLHAWGEKPSFDFTPKEHWEIGPALG-LDFERGSRLTGSRFTVLWHWAAKLERALTA 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-GRWLIPTSEVSLTNL 239
           F +D+HT EHGY EV  P +V  + M GTGQ+PKF +D+F   D   +LIPT+EV LTNL
Sbjct: 178 FFLDVHTREHGYMEVYPPAMVNAQTMTGTGQLPKFEEDLFKLRDSEYYLIPTAEVPLTNL 237

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +S E++  + LP+ +T     FRSEAGS G+DT+G +RQHQF K E+V     E SF E 
Sbjct: 238 HSGEVVPEEKLPIAYTAQTQCFRSEAGSYGKDTKGFIRQHQFTKVEMVRFAHPEKSFEEL 297

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++ S AE +L++L LHYRVV+LC+GD+GFSA KTYDLEVWL GQ+ YREISSCS C +F
Sbjct: 298 EKLRSHAEVLLQKLGLHYRVVTLCSGDMGFSAAKTYDLEVWLPGQDKYREISSCSNCTDF 357

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N R R  ++K   F HTLNGSG+AVGR L+AILENY  ADGSV +P VLRPYM  
Sbjct: 358 QARRANIRTRLADAKKPVFLHTLNGSGLAVGRTLVAILENYQQADGSVVVPEVLRPYMGG 417

Query: 420 LAVIKKEH 427
           +A++  + 
Sbjct: 418 VALLTPDG 425


>gi|227821937|ref|YP_002825907.1| seryl-tRNA synthetase [Sinorhizobium fredii NGR234]
 gi|254783042|sp|C3MBU2|SYS_RHISN RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|227340936|gb|ACP25154.1| seryl-tRNA synthetase [Sinorhizobium fredii NGR234]
          Length = 427

 Score =  454 bits (1169), Expect = e-126,   Method: Composition-based stats.
 Identities = 262/425 (61%), Positives = 328/425 (77%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+N   LD AL KR  EP S  +++LDE+ R +++ ++++++RRN+ S +IG 
Sbjct: 1   MLDIKWIRENAGVLDNALAKRGAEPLSASLIALDERRRTVLQSLQEMQSRRNAASKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ N  L + LK E + LK+ LP  E+E   + + L  ++S IPNVPLE+VP+G   +
Sbjct: 61  AMAQKNSELAEKLKAEVAELKDALPAAEEESRRMEAELTDILSRIPNVPLEDVPVGPDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N++ R VG KP+  H   EHFEIGE LG MDF+ A +++G+RF++L G LA LERALGQ
Sbjct: 121 GNVVKRLVGSKPTWNHKPLEHFEIGEGLGFMDFEGAARIAGSRFTILKGQLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT EHGY EV  PLLVRD+AMYGTGQ+PKFA+D+F TTDGRWLIPT+EV LTN+ 
Sbjct: 181 FMLDLHTQEHGYIEVQPPLLVRDDAMYGTGQLPKFAEDLFRTTDGRWLIPTAEVPLTNMV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             +I+E + LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K ELVS+T  E S  EHE
Sbjct: 241 REQILEGEKLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFNKVELVSLTDAETSVDEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL LHYRV++LCTGD+GF A KTYDLEVWL GQ+ YREISSCS CG+FQ
Sbjct: 301 RMTACAEEVLKRLGLHYRVMTLCTGDMGFGARKTYDLEVWLPGQDAYREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR    K  KF HTLNGSGVAVGR LIA++ENYLN DGSV++P VL PYM  L
Sbjct: 361 ARRMNARYRSKEEKGTKFVHTLNGSGVAVGRALIAVIENYLNEDGSVSVPEVLVPYMGGL 420

Query: 421 AVIKK 425
             ++K
Sbjct: 421 RRVEK 425


>gi|15965285|ref|NP_385638.1| seryl-tRNA synthetase [Sinorhizobium meliloti 1021]
 gi|307307875|ref|ZP_07587600.1| seryl-tRNA synthetase [Sinorhizobium meliloti BL225C]
 gi|307317049|ref|ZP_07596490.1| seryl-tRNA synthetase [Sinorhizobium meliloti AK83]
 gi|30173198|sp|Q92Q22|SYS_RHIME RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|15074465|emb|CAC46111.1| Probable seryl-tRNA synthetase (serine--tRNA ligase) [Sinorhizobium
           meliloti 1021]
 gi|306897137|gb|EFN27882.1| seryl-tRNA synthetase [Sinorhizobium meliloti AK83]
 gi|306901491|gb|EFN32094.1| seryl-tRNA synthetase [Sinorhizobium meliloti BL225C]
          Length = 427

 Score =  454 bits (1169), Expect = e-126,   Method: Composition-based stats.
 Identities = 264/425 (62%), Positives = 326/425 (76%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+N + LD AL KR  EP S  +++LDE+ R +++ ++D+++RRN+ S +IG 
Sbjct: 1   MLDIKWIRENADALDEALAKRGAEPLSASLIALDERRRAVLQSLQDMQSRRNAASKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ N  L D LK E + LK  LP  E+E   + + L   +S IPN PL +VP+G   +
Sbjct: 61  AMAQKNSELADRLKAEVADLKNALPAAEEESRRIEAELSDALSRIPNTPLADVPVGADES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N++ R VG KP   H   EHFEIGEALGLMDF+ A +++G+RF++L G LA LERALGQ
Sbjct: 121 ANVVTRVVGAKPGWNHKPLEHFEIGEALGLMDFEGAARIAGSRFTILKGQLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT EHGY EV  PLLVRD+AMYGTGQ+PKF+DD+F TTDGRWLIPT+EV LTN+ 
Sbjct: 181 FMLDLHTGEHGYIEVQPPLLVRDDAMYGTGQLPKFSDDLFRTTDGRWLIPTAEVPLTNMV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             +I++ + LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K ELVSIT  E S  EHE
Sbjct: 241 REQILDGEKLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFNKVELVSITDAESSIDEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL LHYRV++LCTGD+GF A KTYDLEVWL GQ+ YREISSCS CG+FQ
Sbjct: 301 RMTACAEEVLKRLGLHYRVMTLCTGDMGFGARKTYDLEVWLPGQDAYREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR    K  KF HTLNGSGVA+GR LIA++ENYLN DGS+T+P VL PYM  L
Sbjct: 361 ARRMNARYRGKEEKGTKFVHTLNGSGVALGRALIAVIENYLNDDGSITVPDVLVPYMGGL 420

Query: 421 AVIKK 425
             I+K
Sbjct: 421 RRIEK 425


>gi|90419386|ref|ZP_01227296.1| seryl-tRNA synthetase [Aurantimonas manganoxydans SI85-9A1]
 gi|90336323|gb|EAS50064.1| seryl-tRNA synthetase [Aurantimonas manganoxydans SI85-9A1]
          Length = 427

 Score =  454 bits (1167), Expect = e-125,   Method: Composition-based stats.
 Identities = 239/426 (56%), Positives = 316/426 (74%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR NP+ LD AL +R   P +E +L LDE+ R  + +++ ++ RRN  S  IG+
Sbjct: 1   MLDIKWIRDNPDKLDAALARRGAAPLAEQLLKLDEERRAHLTRLQTLQGRRNEASKAIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G+ +  + L  E   +KE +   E+ E  +  SL+  ++ IPN+PL++VP G    
Sbjct: 61  AKGTGDEAGAEELIREIGEIKEAIQDGEETERRIDKSLEDALARIPNIPLDDVPEGADET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ IR  G+ P+     +EH+E+GE LGLMDF++A K+SG+RF++L G LA +ERALGQ
Sbjct: 121 DNVEIRRHGEAPNFGFAPKEHYELGEGLGLMDFEQAAKISGSRFTILKGQLARMERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT EHGY E +APLLVRDEA++GTGQ+PKF++D+F T++GRWLIPT+EV LTN+ 
Sbjct: 181 FMLDLHTGEHGYQETAAPLLVRDEALFGTGQLPKFSEDLFHTSEGRWLIPTAEVPLTNMV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             +++ +  LPLRFT L P FRSEAGSAGRDTRGMLRQHQF+K ELVS+T E  S  EHE
Sbjct: 241 REQMLGAGDLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFYKVELVSVTDEGSSIAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM + AEE+LKRL L YRVV+LC GD+GF A KTYD+EVWL GQ+ +REISSCS CG+FQ
Sbjct: 301 RMTAAAEEVLKRLGLSYRVVTLCAGDMGFGARKTYDIEVWLPGQDAFREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM +RYR    K+ ++ HTLNGSGVAVGR LIA++ENY N DGS+T+P  LRPYM  L
Sbjct: 361 ARRMGTRYRVEGEKAARYVHTLNGSGVAVGRALIAVMENYQNEDGSITVPEALRPYMGGL 420

Query: 421 AVIKKE 426
             I++ 
Sbjct: 421 ERIERT 426


>gi|87198872|ref|YP_496129.1| seryl-tRNA synthetase [Novosphingobium aromaticivorans DSM 12444]
 gi|123736268|sp|Q2GA28|SYS_NOVAD RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|87134553|gb|ABD25295.1| seryl-tRNA synthetase [Novosphingobium aromaticivorans DSM 12444]
          Length = 426

 Score =  453 bits (1165), Expect = e-125,   Method: Composition-based stats.
 Identities = 230/427 (53%), Positives = 296/427 (69%), Gaps = 1/427 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+N E  D AL +R + P ++ ILSLD + R +  ++++++ARRN  S  IG 
Sbjct: 1   MHDIRLIRENAEAFDAALARRGVGPVAQSILSLDSRRREIATRMQEVQARRNEASKAIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+ +G+    +ALK E + LK +LP LE+EE ++ +     ++  PN P  +VP G    
Sbjct: 61  AMGKGDKDTAEALKAEVAALKVELPALEEEERQLTAQQNAALAAYPNTPAADVPEGADEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         +EH ++G ALG +DF+    +SGARF+ L G +A L RAL Q
Sbjct: 121 DNVEVSRWGTPRDFAFAPKEHADLGPALG-LDFETGALISGARFTFLKGQMARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D  T E+GY E   PLLV+DEA++GTGQ+PKFA+D+F TTDGRWLIPT+EVSLTN  
Sbjct: 180 FMLDRQTGENGYMECIPPLLVKDEAVFGTGQLPKFAEDLFRTTDGRWLIPTAEVSLTNAV 239

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             +I+    LPLR T L P FRSEAG+AGRDTRG +RQHQF K ELVSITR EDS +EHE
Sbjct: 240 QGQILGEAQLPLRMTALTPCFRSEAGAAGRDTRGFIRQHQFEKVELVSITRPEDSESEHE 299

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE IL+ L L YR V LCTGD+GF+A KTYDLEVWL GQ  YREISSCS CG+FQ
Sbjct: 300 RMTQCAEGILQALGLPYRKVLLCTGDMGFTARKTYDLEVWLPGQGAYREISSCSNCGDFQ 359

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR   +K  +F HTLNGSG+AVGR L+A+LENY   DGSV +P VL PYM  L
Sbjct: 360 ARRMNARYRPEGAKGTEFVHTLNGSGLAVGRTLVAVLENYQQEDGSVAVPEVLLPYMGGL 419

Query: 421 AVIKKEH 427
           A +  + 
Sbjct: 420 ARLTPQG 426


>gi|317154684|ref|YP_004122732.1| seryl-tRNA synthetase [Desulfovibrio aespoeensis Aspo-2]
 gi|316944935|gb|ADU63986.1| seryl-tRNA synthetase [Desulfovibrio aespoeensis Aspo-2]
          Length = 425

 Score =  452 bits (1163), Expect = e-125,   Method: Composition-based stats.
 Identities = 199/427 (46%), Positives = 288/427 (67%), Gaps = 3/427 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++ +++ P+ +  +LKKR  +   +  L+LDE+ + LI + E ++A RN+   +I +
Sbjct: 1   MLDLKLMQKTPDLVRESLKKRGSKIDVQEFLTLDERRKSLIAEGETLKAERNAAGPEIAK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G      AL    + + E++  L+ E  EV ++ +  +  +PN+P E VP+G S  
Sbjct: 61  CKKSGQ--DASALLARMAEVSERVKTLDAELTEVETAERDWLMSVPNMPHESVPVGASEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N ++RS G+KP      +EH+E+G ALG +DF+RA KL+G+RF++  G  A LERAL Q
Sbjct: 119 DNPVVRSWGEKPVMDFEPKEHWELGTALGGLDFERAAKLAGSRFALSFGWCARLERALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-TTDGRWLIPTSEVSLTNL 239
           FM+D  T+ HGYTEV  P +V    M GTGQ+PKF +D+F       +LIPT+EV LTN+
Sbjct: 179 FMLDTQTTLHGYTEVIPPYIVNRRTMTGTGQLPKFEEDLFKLEGVDSFLIPTAEVPLTNI 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y+ E+I+  +LP++F    P FRSEAGS G+DT+G++R HQF K E+V+    + S+   
Sbjct: 239 YAGEVIDEAALPVKFCAHTPCFRSEAGSYGKDTKGLIRLHQFHKVEMVNFAHPDTSYEAL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E M + AE+IL+ L +HYRV+ LCTGD+GF A KTYD+EVWL GQN YREISSCS CG+F
Sbjct: 299 EAMTAAAEKILQLLGIHYRVIELCTGDMGFGATKTYDIEVWLPGQNQYREISSCSNCGDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR + R+R P SK  ++ HTLNGSG+AVGRCL+A++EN   ADGS+ IP  L+PYM  
Sbjct: 359 QARRADIRFRSPGSKKNQYVHTLNGSGLAVGRCLVAVMENGQRADGSIVIPDALKPYMGG 418

Query: 420 LAVIKKE 426
           L V++ +
Sbjct: 419 LEVVEAK 425


>gi|282857769|ref|ZP_06266978.1| serine--tRNA ligase [Pyramidobacter piscolens W5455]
 gi|282584439|gb|EFB89798.1| serine--tRNA ligase [Pyramidobacter piscolens W5455]
          Length = 428

 Score =  452 bits (1162), Expect = e-125,   Method: Composition-based stats.
 Identities = 190/426 (44%), Positives = 278/426 (65%), Gaps = 3/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI  IR++ E +   LK R+ +   + +L+LD++ + L+  +E+++ARRN+ S ++G+
Sbjct: 1   MLDIHMIREDTEAVKAYLKARNNDFDVDKVLALDDERKKLLASVEEVKARRNAGSKEVGR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
             A G      A+ +E   L EQ+   +    E+   L++L+  IPN P   VP+G    
Sbjct: 61  IKAAGG--DAAAVMDEMRRLGEQIKADDARVAEIDEELRELMLQIPNRPDATVPVGKDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G         + H+++ EA GL+DF+R  +++ +RF+V  G  A LERA+  
Sbjct: 119 ENVEVRRWGAPRRFDFEPKAHWDVAEACGLLDFERGPRMAQSRFTVFKGLGARLERAIMN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-TDGRWLIPTSEVSLTNL 239
           +M+D+HT +HGYTE + P++V  E+M GTGQ+PKFA+D++    D  W+IPT+EV LTN+
Sbjct: 179 YMLDMHTQKHGYTEFNVPVMVNSESMLGTGQLPKFAEDLYKVEKDDLWMIPTAEVPLTNM 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           ++ E++    LP  +T   P FR E+GS GRD RG++R HQF K E+V I   E S+ E 
Sbjct: 239 HNGEMLSESELPKYYTAYTPCFRRESGSYGRDVRGIMRLHQFDKVEMVKICTPESSWDEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++   AEE+L+ L L YRV+ LCTGD+GF + KTYD+EVWL  QN YREISSCS C +F
Sbjct: 299 EKLTGNAEEVLQGLGLPYRVIVLCTGDMGFGSAKTYDVEVWLPSQNCYREISSCSNCVDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RRMN+RYR  +    ++ HTLNGSG+A+GR LIA+LEN  NADGSV +P  L PYM  
Sbjct: 359 QARRMNTRYRPADGGKPRYVHTLNGSGLAIGRTLIAVLENCQNADGSVDLPEALVPYMGG 418

Query: 420 LAVIKK 425
           +  I+ 
Sbjct: 419 VKHIEP 424


>gi|242280836|ref|YP_002992965.1| seryl-tRNA synthetase [Desulfovibrio salexigens DSM 2638]
 gi|259511664|sp|C6BS43|SYS_DESAD RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|242123730|gb|ACS81426.1| seryl-tRNA synthetase [Desulfovibrio salexigens DSM 2638]
          Length = 425

 Score =  451 bits (1161), Expect = e-125,   Method: Composition-based stats.
 Identities = 189/427 (44%), Positives = 281/427 (65%), Gaps = 3/427 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD+++++ N + +  +L+KR  +        LD + + L++++E ++A RNS S +I +
Sbjct: 1   MLDLKFVQNNLDVVRESLEKRGSKLDVNEFSDLDSRRKSLLQEVESLKAERNSTSGEIAK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG       +      +  ++  L+++  ++ ++ ++ +S +PN+P E VP G + +
Sbjct: 61  IKREGG--DASEIIARMGEVSGKIKALDEDLKDIEAAEREWLSSVPNMPDESVPFGKTED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N +IR  G+KP      REH+++   LG +DF+RA KL+GARF VL    A LERAL  
Sbjct: 119 DNPVIRHWGEKPEFDFTPREHWDLAVELGGVDFERAAKLTGARFVVLKKWGARLERALTS 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-TTDGRWLIPTSEVSLTNL 239
           FM+D+ T +HGYTEV  P +V  ++++GTGQ+PKF +D+F       ++IPT+EV LTNL
Sbjct: 179 FMVDVQTMDHGYTEVIPPYIVNRDSLFGTGQLPKFEEDLFKLKNWEYYMIPTAEVPLTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +  E++    L + +    P FRSEAGS G+DT+G++RQHQF K E+V     + SF + 
Sbjct: 239 HRDEVLSEDDLSIAYCAPTPCFRSEAGSYGKDTKGLIRQHQFHKVEMVRFAHPDKSFEDL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E+M   AEEILKRL LHYRV++LCTGD+GF + KTYD+EVWL GQ+ YREISSCS C +F
Sbjct: 299 EKMTGHAEEILKRLGLHYRVITLCTGDMGFGSAKTYDIEVWLPGQDKYREISSCSNCVDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N +++  +SK  +F HTLNGSG+AVGR  +A++ENY   DGS+ IP  LRPYM  
Sbjct: 359 QARRANIKFQPKDSKKKQFVHTLNGSGLAVGRTFVAVVENYQQKDGSIVIPEALRPYMGG 418

Query: 420 LAVIKKE 426
           L VI  E
Sbjct: 419 LEVITAE 425


>gi|221195108|ref|ZP_03568164.1| seryl-tRNA synthetase [Atopobium rimae ATCC 49626]
 gi|221185011|gb|EEE17402.1| seryl-tRNA synthetase [Atopobium rimae ATCC 49626]
          Length = 427

 Score =  451 bits (1161), Expect = e-125,   Method: Composition-based stats.
 Identities = 196/428 (45%), Positives = 276/428 (64%), Gaps = 2/428 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKR-HLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+++R+NP+ +D A   R +     E    LD + R +I ++E ++A RN+ S QIG
Sbjct: 1   MLDIKFVRENPDVIDAACASRQNAHWDREKFFELDAERRSVIAEVESLQAERNAISKQIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
             + EG     +A K + S  KE++  L++    V   L  L++ IPN+P E VP G   
Sbjct: 61  LFMREGKKDEAEAAKQQVSANKERIAELDQRRGSVEEELTALVAAIPNIPDESVPYGVDD 120

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N  +R  G         + H+++G  LG++DFDR  KL+G RF +L G  A +ERAL 
Sbjct: 121 SDNPEVRRWGTPTEFDFEPKAHWDLGVDLGIIDFDRGVKLAGTRFYLLGGLGARMERALI 180

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNL 239
            FMID H ++ G+ E   P++   ++++GTGQ+PKF DD++      +LIPT+EV LTN+
Sbjct: 181 NFMIDQH-NKAGFKEFWPPVITNHDSLFGTGQLPKFEDDLYHVQPDLYLIPTAEVQLTNI 239

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +  EI+++  LPL +T   P FR EAGSAGRDTRG++R H+F K E+V  ++ EDS  + 
Sbjct: 240 HRGEILDADQLPLLYTAFTPCFREEAGSAGRDTRGIIRVHEFDKVEMVKFSKPEDSMNQL 299

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E M++ AE+IL+ L L Y VV+LCTGDLGFSA K YD+EVWL   N Y+EISSCS C +F
Sbjct: 300 ESMVTEAEKILQLLKLPYHVVTLCTGDLGFSAAKCYDIEVWLPSYNNYKEISSCSNCKDF 359

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR   R++DP  K  +  HTLNGSG+AVGR + AILENY N DGSVT+P  L PYM  
Sbjct: 360 QARRAGIRFKDPAVKGTQLVHTLNGSGLAVGRTMAAILENYQNEDGSVTVPEALVPYMGG 419

Query: 420 LAVIKKEH 427
           + VI+ E 
Sbjct: 420 VEVIRPED 427


>gi|86357454|ref|YP_469346.1| seryl-tRNA synthetase [Rhizobium etli CFN 42]
 gi|123512164|sp|Q2K967|SYS_RHIEC RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|86281556|gb|ABC90619.1| seryl-tRNA synthetase (serine-tRNA ligase) protein [Rhizobium etli
           CFN 42]
          Length = 427

 Score =  451 bits (1160), Expect = e-124,   Method: Composition-based stats.
 Identities = 275/425 (64%), Positives = 337/425 (79%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR  EP ++ +++LDEK R  ++K +D+ +RRN+ S +IG 
Sbjct: 1   MLDIKWIRENPEALDAALAKRGAEPLAQTLVALDEKRRSAVQKTQDLLSRRNAASKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ N  L + LK E + +KE LP  E+EE  + + L   +S IPNVP ++VP+G   +
Sbjct: 61  AMAQKNAELAEKLKAEVAEIKETLPAAEEEERTLSAELIDALSRIPNVPFDDVPVGKDEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N + R VG+KP   H  REHFEIGEALG MDF+RA KLSG+RF+VLTG LA LERALGQ
Sbjct: 121 DNAVARIVGEKPRWNHTPREHFEIGEALGYMDFERAAKLSGSRFTVLTGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMIDLHT EHGYTEVS+PL+VR EA++GTG +PKF +D+F TTDGR+LIPT+EV+LTNL 
Sbjct: 181 FMIDLHTREHGYTEVSSPLMVRAEAVFGTGSLPKFEEDLFKTTDGRYLIPTAEVTLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ + LPLRFT L PSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT  E S  EHE
Sbjct: 241 REEILDQEKLPLRFTALTPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITDAESSIAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL LH+R ++LCTGD+GF + KTYDLEVWL GQN +REISSCS CG+FQ
Sbjct: 301 RMTACAEEVLKRLGLHFRTMTLCTGDMGFGSRKTYDLEVWLPGQNAFREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR  + K+ KF HTLNGSG AVGRCLIA+LENYLN DGSVTIP VL PYM  L
Sbjct: 361 ARRMNARYRGKDDKNNKFVHTLNGSGTAVGRCLIAVLENYLNEDGSVTIPDVLLPYMGGL 420

Query: 421 AVIKK 425
             I++
Sbjct: 421 TKIER 425


>gi|254503029|ref|ZP_05115180.1| seryl-tRNA synthetase [Labrenzia alexandrii DFL-11]
 gi|222439100|gb|EEE45779.1| seryl-tRNA synthetase [Labrenzia alexandrii DFL-11]
          Length = 426

 Score =  450 bits (1158), Expect = e-124,   Method: Composition-based stats.
 Identities = 236/425 (55%), Positives = 307/425 (72%), Gaps = 2/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+WIR+N +  D AL KR  EP +  +++LD+  R  I K+++ + RRN+ S +IG+
Sbjct: 1   MFDIKWIRENADAFDKALAKRGYEPSAANLIALDDSRRSHITKLQEAQERRNAASKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G+      L +E + +K  +   E+EE ++ ++L++ ++ IPN+P ++VP G    
Sbjct: 61  AKGSGDDVRAQELIDEVAQIKAFIQSGEEEERKLIAALEEAMAVIPNLPHDDVPEGADEA 120

Query: 121 ENILIRSVGKKPSAIHL--SREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
            N+L ++ G+KP+       +EH+E+GE LG MDF  A KLSG+RF VL G +A LERAL
Sbjct: 121 GNVLYKTHGEKPAFTFNEAPKEHYELGEELGGMDFSTAAKLSGSRFVVLKGQIARLERAL 180

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTN 238
           GQFMID+HT E+GYTEVS PLLV  + +YGTGQ+PKF +D+F T    +LIPT+EV LTN
Sbjct: 181 GQFMIDMHTQENGYTEVSPPLLVHSDPLYGTGQLPKFEEDLFKTATDHYLIPTAEVPLTN 240

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L + EI+    LPLR T L   FRSEAGSAGRDTRGMLRQHQF KCELVS+T  E+S  E
Sbjct: 241 LVAGEIMSEDQLPLRVTALTYCFRSEAGSAGRDTRGMLRQHQFQKCELVSVTTPEESLNE 300

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            ERML CAE IL++L LHYRV++LCTGD+GF A KTYD+EVWL GQ+ +REISSCS CG+
Sbjct: 301 LERMLGCAEMILQKLGLHYRVMTLCTGDMGFGARKTYDIEVWLPGQDTFREISSCSVCGD 360

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRMN+R+R   SK     HTLNGSG+AVGR LIA+LENY NADGS+T+P VLRPYM 
Sbjct: 361 FQARRMNARFRPAGSKQPVHVHTLNGSGIAVGRALIAVLENYQNADGSITVPDVLRPYMG 420

Query: 419 NLAVI 423
            L  I
Sbjct: 421 GLEKI 425


>gi|296131564|ref|YP_003638811.1| seryl-tRNA synthetase [Thermincola sp. JR]
 gi|296030142|gb|ADG80910.1| seryl-tRNA synthetase [Thermincola potens JR]
          Length = 423

 Score =  450 bits (1157), Expect = e-124,   Method: Composition-based stats.
 Identities = 200/424 (47%), Positives = 275/424 (64%), Gaps = 4/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI++IR NPE +  AL KR      +  L LDE+ R L+ ++E ++ +RN  S +IG+
Sbjct: 1   MLDIKFIRSNPEAVKEALSKRGAVLGLDNFLKLDEQRRELLVEVEQLKNKRNVVSEEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G     + +  E   + +++  L+++  EV  +L   +  IPN+P E VP+G S  
Sbjct: 61  LKKQGQHP--EEMILEMRQVSQKIKELDEKVKEVEENLAGALLTIPNIPHESVPVGASDA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N  IR  G+        + H++IGE L ++DF+RA K++GARF+   G  A LERA+  
Sbjct: 119 DNQEIRRWGEPRQFAFEPKAHWDIGENLDILDFERAAKIAGARFTFYKGLGARLERAVIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTNL 239
           FM+DLHT EHGYTE+  P LV  ++M GTGQ+PKF +DMF      +  IPT+EV +TN+
Sbjct: 179 FMLDLHTREHGYTEIFPPFLVNRDSMIGTGQLPKFEEDMFRIDSVDYFLIPTAEVPVTNI 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y  EI++   LPL     +  FR+EAG+ GRDTRG++RQHQF K ELV  T+ EDSF E 
Sbjct: 239 YRGEILDGAQLPLYHVAYSACFRAEAGAHGRDTRGLIRQHQFNKVELVKFTKPEDSFEEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++ + AE++L+ L L YRVV+LCTGDLGFS+ KTYD+EVWL     Y+EISSCS   +F
Sbjct: 299 EKLTANAEKVLQLLGLPYRVVTLCTGDLGFSSAKTYDIEVWLPSYQAYKEISSCSNFLDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N R+R       +F HTLNGSG+AVGR + AILENY   DGSV +P VLRPYM  
Sbjct: 359 QARRANIRFRREAGSKPEFVHTLNGSGLAVGRTVAAILENYQQEDGSVVVPEVLRPYM-G 417

Query: 420 LAVI 423
           +  I
Sbjct: 418 VDKI 421


>gi|149186947|ref|ZP_01865256.1| SerS, seryl-tRNA synthetase [Erythrobacter sp. SD-21]
 gi|148829456|gb|EDL47898.1| SerS, seryl-tRNA synthetase [Erythrobacter sp. SD-21]
          Length = 426

 Score =  449 bits (1156), Expect = e-124,   Method: Composition-based stats.
 Identities = 223/426 (52%), Positives = 292/426 (68%), Gaps = 1/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI +IR NP+  D ALK+R  EP ++ I++LD K R    ++++ ++RRN  S  IGQ
Sbjct: 1   MHDIAFIRANPDAFDAALKRRGAEPVADRIVALDAKKREAQTRVQEAQSRRNEASKAIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+ +G+    +ALK E + +K  +P  E+ E E  S L  L++ +PN+P ++VP G   +
Sbjct: 61  AMGQGDKEKAEALKAEVADIKASMPAWEEAEQEAASELTDLLARLPNMPADDVPDGADES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ + + G+K +     +EH +IG ALG MDF+    LSGARF+ L G +A L RAL Q
Sbjct: 121 DNVEVATWGEKRAFAFEPKEHADIGPALG-MDFETGASLSGARFTFLRGDIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D  T ++GY E + P+LV DEAMYGT ++PKFA+D F TTDGRWL+PTSEV LT   
Sbjct: 180 FMLDTQTRKNGYAECNPPVLVHDEAMYGTDKLPKFAEDSFQTTDGRWLVPTSEVPLTASV 239

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + +I++    P+R T     FRSEAGSAGRDTRG +RQHQF K ELVSI R EDS  EHE
Sbjct: 240 AGQILDEPVQPIRLTAHTLCFRSEAGSAGRDTRGFIRQHQFEKVELVSICRPEDSEAEHE 299

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAE IL+ L L YR V LC GD+GF A KTYDLEVWL GQ  YREISSCS  G FQ
Sbjct: 300 RMTACAEGILQALGLPYRKVLLCVGDMGFGAKKTYDLEVWLPGQGAYREISSCSNTGEFQ 359

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR    K  +F HTLNGSG+AVGR L+A++ENY   DGSVT+P  L PYM  +
Sbjct: 360 ARRMNARYRPEGEKKTRFVHTLNGSGLAVGRTLVAVMENYQEEDGSVTVPECLAPYMGGV 419

Query: 421 AVIKKE 426
           A ++ +
Sbjct: 420 AKLEPQ 425


>gi|326386512|ref|ZP_08208135.1| seryl-tRNA synthetase [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209173|gb|EGD59967.1| seryl-tRNA synthetase [Novosphingobium nitrogenifigens DSM 19370]
          Length = 426

 Score =  449 bits (1156), Expect = e-124,   Method: Composition-based stats.
 Identities = 227/425 (53%), Positives = 296/425 (69%), Gaps = 1/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NPE  D A+ +R L P ++ ILS D   R L+ ++++ +ARRN  S  IG 
Sbjct: 1   MHDIRLIRENPEAFDAAMARRGLAPAAQAILSADADRRDLLTRMQEAQARRNEASKAIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+ +G+    +ALK E ++LK+ LP +E++E  +   L  +++ +PN P ++VP G   +
Sbjct: 61  AMGKGDKDTAEALKAEVASLKDALPAMEEDERRLTGELNAVLAALPNRPADDVPAGEDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +   G         REH +IG ALG +DF+    +SGARF+ L G +A L RAL Q
Sbjct: 121 ANVEVLRWGTPREFAFTPREHADIGPALG-LDFETGALISGARFTFLRGQMARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D  T  +GYTE + PL+VRDEA++GTGQ+PKFA+D+F TTDGRWLIPT+EVSLTN  
Sbjct: 180 FMLDFQTGTNGYTECATPLMVRDEAVFGTGQLPKFAEDLFRTTDGRWLIPTAEVSLTNSV 239

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             +I+   +LPLR T L P FRSEAG+AGRDTRG +RQHQF K ELVSITR EDS  EHE
Sbjct: 240 REQILTDAALPLRMTALTPCFRSEAGAAGRDTRGFIRQHQFEKVELVSITRPEDSEAEHE 299

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM   A+ +L+ LDL YR V LC GD+GF+A KTYDLEVWL GQN YREISSCS CG+FQ
Sbjct: 300 RMTGAAQAVLEALDLPYRKVVLCEGDMGFTARKTYDLEVWLPGQNTYREISSCSNCGDFQ 359

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR   +K  +F HTLNGSG+AVGR L+A+LENY   DGSV +P  L PYM  +
Sbjct: 360 ARRMNARYRPEGAKGTEFVHTLNGSGLAVGRTLVAVLENYQQEDGSVEVPAALAPYMGGI 419

Query: 421 AVIKK 425
             +  
Sbjct: 420 TRLVP 424


>gi|326794640|ref|YP_004312460.1| Seryl-tRNA synthetase [Marinomonas mediterranea MMB-1]
 gi|326545404|gb|ADZ90624.1| Seryl-tRNA synthetase [Marinomonas mediterranea MMB-1]
          Length = 432

 Score =  449 bits (1155), Expect = e-124,   Method: Composition-based stats.
 Identities = 202/430 (46%), Positives = 277/430 (64%), Gaps = 7/430 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+ +R +P+ +   LKK+  E       SL+E+ + +  + E+++  RNS S QIGQ
Sbjct: 1   MLDIKALRTDPDAIAAKLKKKGFELDVAAFSSLEERRKAIQVETENLQQSRNSVSKQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+  G+ +  D LK +T+TL + L   ++  ++V + L+ L+  IPN+P E VP G S +
Sbjct: 61  AMKSGDKAKADELKAQTATLGDDLTKAKEALNQVQTDLELLLEGIPNIPHESVPEGVSED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +NI IR  G+  +    +++H ++GEALG +DF+ A K++G+RF+V+   LA L RAL Q
Sbjct: 121 DNIEIRRWGEPRTFDFEAKDHVDLGEALGGLDFELAVKITGSRFAVMRADLARLHRALTQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-------TDGRWLIPTSE 233
           FMI+ H  EHGY+EV  P LV   ++ GTGQ+PKF  D+F             +LIPT+E
Sbjct: 181 FMINTHADEHGYSEVYVPYLVNAHSLKGTGQLPKFEKDLFKVPVDKDSGNSDLYLIPTAE 240

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V +TN+   EI     L  ++    P FRSEAGS GRDTRGM+RQHQF K ELV I R +
Sbjct: 241 VPVTNIARDEIFNDSDLHHKYVAHTPCFRSEAGSYGRDTRGMIRQHQFEKVELVHICRPD 300

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S    E ++  AE IL++L L YR V LC GDLGFSA KTYD+EVWL GQ  YREISSC
Sbjct: 301 RSTEILEELVGHAETILQKLGLPYRTVILCGGDLGFSAHKTYDIEVWLPGQGKYREISSC 360

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY N DGS+ IP VL
Sbjct: 361 SNMWDFQARRMQARWRNPETGKPELAHTLNGSGLAVGRTLVAVLENYQNEDGSIDIPDVL 420

Query: 414 RPYMNNLAVI 423
            PYM     +
Sbjct: 421 VPYMGGKTKL 430


>gi|83311620|ref|YP_421884.1| seryl-tRNA synthetase [Magnetospirillum magneticum AMB-1]
 gi|123541738|sp|Q2W4A0|SYS_MAGSA RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|82946461|dbj|BAE51325.1| Seryl-tRNA synthetase [Magnetospirillum magneticum AMB-1]
          Length = 422

 Score =  449 bits (1155), Expect = e-124,   Method: Composition-based stats.
 Identities = 229/423 (54%), Positives = 296/423 (69%), Gaps = 2/423 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M D++ IR NP+  D  LK+R LEP++  IL LD + R      ++++ARRN  S QIG 
Sbjct: 1   MHDLKSIRDNPDGFDAGLKRRGLEPKAAAILDLDTRRRAAQTAFQEMQARRNDASKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G      AL +E ++LKE++P  E+E+  + + ++ +++ IPN+P  +VP G   +
Sbjct: 61  LKKSGG--DASALMDEVASLKERMPAAEEEDKALGAEIESILASIPNLPASDVPDGPDED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G   S    + +H  IG  LGLMDFD A KLSGARF VL G LA L+RA+GQ
Sbjct: 119 HNVELRKWGTPKSFAFTALDHDAIGAKLGLMDFDGAAKLSGARFVVLKGQLARLQRAIGQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DL T EHGYTE+  PL+V+D A +GTGQ+PKF +D+F T  G WLIPT+EV LTNL 
Sbjct: 179 FMLDLQTVEHGYTEMDPPLMVKDGAAFGTGQLPKFGEDLFKTNTGHWLIPTAEVPLTNLV 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           S EI++ K+LPLR T L P FRSEAG+AG+DTRGM+RQHQF K E+VSI   + S  EHE
Sbjct: 239 SDEILDEKALPLRMTALTPCFRSEAGAAGKDTRGMIRQHQFHKVEMVSIAHPDASGAEHE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE +L+RL L YRV+ LCTGD+GFSA KTYD+EVWL GQ  YREISSCS CG+FQ
Sbjct: 299 RMTQCAETVLQRLGLAYRVIVLCTGDMGFSAQKTYDIEVWLPGQQRYREISSCSNCGDFQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM +R+R    K  +F HTLNGSG+AVGR LIA++ENY   DG++ +P  LRPYM  L
Sbjct: 359 ARRMKARFRPEGEKGTRFVHTLNGSGLAVGRTLIAVMENYQREDGTIEVPEALRPYMGGL 418

Query: 421 AVI 423
            VI
Sbjct: 419 EVI 421


>gi|152969482|ref|YP_001334591.1| seryl-tRNA synthetase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|238893954|ref|YP_002918688.1| seryl-tRNA synthetase [Klebsiella pneumoniae NTUH-K2044]
 gi|166222736|sp|A6T6Z0|SYS_KLEP7 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|150954331|gb|ABR76361.1| seryl-tRNA synthetase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|238546270|dbj|BAH62621.1| seryl-tRNA synthetase [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 430

 Score =  448 bits (1153), Expect = e-124,   Method: Composition-based stats.
 Identities = 203/431 (47%), Positives = 272/431 (63%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRTEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVQTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L EQL   + E   + + ++ +   IPN+P ++VP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEQLDAAKSELETLLAEIRDIALAIPNIPHDDVPVGRDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE  G +DF  A KL+G+RF V+ G LA L RAL Q
Sbjct: 119 DNVEVSRWGTPRQFDFEVRDHVTLGEMHGGLDFAAAVKLTGSRFVVMKGQLARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR V+LCTGD+GFSACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKVALCTGDMGFSACKTYDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + IP V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVALMENYQQADGRIEIPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMRGLEYI 429


>gi|308186248|ref|YP_003930379.1| Seryl-tRNA synthetase [Pantoea vagans C9-1]
 gi|308056758|gb|ADO08930.1| Seryl-tRNA synthetase [Pantoea vagans C9-1]
          Length = 430

 Score =  448 bits (1152), Expect = e-124,   Method: Composition-based stats.
 Identities = 204/431 (47%), Positives = 272/431 (63%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   E + SL+E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGYKLDVETLRSLEERRKVLQVETENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E  E+ + ++     +PN+P +EVP+G   +
Sbjct: 61  AKARG--EDIEPLRQEVNALGERLDAAKAELDELQNQIRDFALALPNIPADEVPLGKDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN  +   G         ++H E+GEA   +DF  A KL+G+RF V+ G +A L RAL Q
Sbjct: 119 ENQEVSRWGTPREFSFQVKDHVELGEAAKGLDFAAAVKLTGSRFVVMQGQIARLHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FMIDLHT +HGY E   P LV  E +YGTGQ+PKF +D+F T             LIPT+
Sbjct: 179 FMIDLHTEQHGYLETYVPYLVNHETLYGTGQLPKFGEDLFHTRPLEEQSDSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI+E  SLP++ T   P FRSEAGS GRDTRG++R HQF K E+V I   
Sbjct: 239 EVPLTNLMRDEIVEEDSLPVKLTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVTP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E S    E +   AE++L+ L+L YR V LCTGD+GF + KTYDLEVWL  QN YREISS
Sbjct: 299 EQSMDALEELTGHAEKVLQLLNLPYRKVLLCTGDMGFGSTKTYDLEVWLPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS  G+FQ+RRM +RYR+   K  +  HTLNGSG+AVGR L+A+LENY   DG +T+P V
Sbjct: 359 CSNMGDFQARRMQARYRNKQEKKPRLVHTLNGSGLAVGRTLVAVLENYQQEDGRITVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN + VI
Sbjct: 419 LRPYMNGVDVI 429


>gi|152997258|ref|YP_001342093.1| seryl-tRNA synthetase [Marinomonas sp. MWYL1]
 gi|189083573|sp|A6W0C9|SYS_MARMS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|150838182|gb|ABR72158.1| seryl-tRNA synthetase [Marinomonas sp. MWYL1]
          Length = 433

 Score =  448 bits (1152), Expect = e-124,   Method: Composition-based stats.
 Identities = 201/432 (46%), Positives = 274/432 (63%), Gaps = 7/432 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+ +R +PE +   LKK+  E       SL+E+ + +  + E ++  RNS S +IGQ
Sbjct: 1   MLDIKALRADPEAIAAQLKKKGYELDVATFSSLEERRKAIQVETEQLQQARNSVSKEIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+  G+      LK +T+TL + L   + +  +V   L+ L+  IPN+P   VP G + +
Sbjct: 61  AMKSGDKDKAAELKAQTATLGDDLEAAKTQLTQVQEELESLLEGIPNLPHASVPEGKTED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ IR  G         ++H ++GEA+ ++DF+ A K++G+RF+V+   LA L RAL Q
Sbjct: 121 DNVEIRRWGTPKQFDFEPKDHVDLGEAMEMLDFEAAVKITGSRFAVMHSDLARLHRALTQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-------TDGRWLIPTSE 233
           FMI+ H   HGYTEV  P LV   ++ GTGQ+PKF  D+F          +  +LIPT+E
Sbjct: 181 FMINTHADLHGYTEVYVPYLVNAHSLKGTGQLPKFEADLFKVPVDKDSGNNDLYLIPTAE 240

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V +TNL   EI+    L  +F    P FRSEAGS GRDTRGM+RQHQF K ELV + R +
Sbjct: 241 VPVTNLVRDEILNDADLHKKFVAHTPCFRSEAGSYGRDTRGMIRQHQFEKVELVHVCRPD 300

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S    E ++  AE IL++L+L YR V LC GDLGFSA KTYD+EVWL GQ  YREISSC
Sbjct: 301 ISEQVLEELVGHAEVILQKLELPYRTVILCGGDLGFSAHKTYDIEVWLPGQGKYREISSC 360

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY NADGSV +P VL
Sbjct: 361 SNMWDFQARRMQARWRNPETGRPELAHTLNGSGLAVGRTLVAVLENYQNADGSVRVPDVL 420

Query: 414 RPYMNNLAVIKK 425
            PYM    V+KK
Sbjct: 421 VPYMGGKTVLKK 432


>gi|82777585|ref|YP_403934.1| seryl-tRNA synthetase [Shigella dysenteriae Sd197]
 gi|309784010|ref|ZP_07678654.1| seryl-tRNA synthetase [Shigella dysenteriae 1617]
 gi|123769580|sp|Q32E12|SYS_SHIDS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|81241733|gb|ABB62443.1| serine tRNA synthetase; also charges selenocystein tRNA with serine
           [Shigella dysenteriae Sd197]
 gi|308928153|gb|EFP73616.1| seryl-tRNA synthetase [Shigella dysenteriae 1617]
          Length = 430

 Score =  448 bits (1152), Expect = e-124,   Method: Composition-based stats.
 Identities = 199/431 (46%), Positives = 270/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSCWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|262041004|ref|ZP_06014225.1| serine-tRNA ligase [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|259041639|gb|EEW42689.1| serine-tRNA ligase [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
          Length = 430

 Score =  448 bits (1151), Expect = e-123,   Method: Composition-based stats.
 Identities = 202/431 (46%), Positives = 271/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRTEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVQTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L EQL   + E   + + ++ +   IPN+P ++VP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEQLDAAKSELETLLAEIRDIALAIPNIPHDDVPVGRDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE  G +DF  A KL+G+RF V+ G LA L RAL Q
Sbjct: 119 DNVEVSRWGTPRQFDFEVRDHVTLGEMHGGLDFAAAVKLTGSRFVVMKGQLARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLH  +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHIEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR V+LCTGD+GFSACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKVALCTGDMGFSACKTYDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + IP V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVALMENYQQADGRIEIPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMRGLEYI 429


>gi|333008793|gb|EGK28253.1| seryl-tRNA synthetase [Shigella flexneri K-272]
 gi|333020323|gb|EGK39589.1| seryl-tRNA synthetase [Shigella flexneri K-227]
          Length = 430

 Score =  448 bits (1151), Expect = e-123,   Method: Composition-based stats.
 Identities = 199/431 (46%), Positives = 270/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLAEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|159184878|ref|NP_354691.2| seryl-tRNA synthetase [Agrobacterium tumefaciens str. C58]
 gi|30173186|sp|Q8UEQ2|SYS_AGRT5 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|159140158|gb|AAK87476.2| seryl-tRNA synthetase [Agrobacterium tumefaciens str. C58]
          Length = 427

 Score =  448 bits (1151), Expect = e-123,   Method: Composition-based stats.
 Identities = 277/425 (65%), Positives = 344/425 (80%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+WIR+NPE  D AL +R +EP +  +++LDEK R +I+ ++D+++RRN+ S +IG 
Sbjct: 1   MHDIKWIRENPEAFDAALARRSVEPAAAGLIALDEKRRSVIQSLQDMQSRRNAASKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ N+ L + LK E + +KE +P  E+E+ +V + L   +S +PN+P ++VP G   +
Sbjct: 61  AMAQKNMELAEKLKAEVADIKENMPRAEEEDRQVSAELNDALSRLPNMPFDDVPDGKDEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N++ R  G+KP   H ++EHFEIGEALG MDF+RA KLSG+RF+VLT  LA LERALGQ
Sbjct: 121 DNVVARVTGQKPGWNHAAKEHFEIGEALGYMDFERAAKLSGSRFTVLTSQLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMIDLHTSEHGYTEVS+PL+VRDEAM+GTGQ+PKFA+D+F TTDGRWLIPT+EV+LTNL 
Sbjct: 181 FMIDLHTSEHGYTEVSSPLMVRDEAMFGTGQLPKFAEDLFRTTDGRWLIPTAEVTLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           S EI+E + LPLRFT L PSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT  E +  EHE
Sbjct: 241 SGEILEQEKLPLRFTALTPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITDAESAVAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL LH+R ++LCTGD+GFSA KTYDLEVWL GQN YREISSCS CG+FQ
Sbjct: 301 RMTACAEEVLKRLGLHFRTLTLCTGDMGFSARKTYDLEVWLPGQNTYREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR  + K+ KF HTLNGSG AVGRCLIA+LENYLN DGSVTIP VL PYM  L
Sbjct: 361 ARRMNARYRGKDDKATKFVHTLNGSGTAVGRCLIAVLENYLNDDGSVTIPDVLLPYMGGL 420

Query: 421 AVIKK 425
             I+K
Sbjct: 421 TRIEK 425


>gi|329998190|ref|ZP_08303002.1| serine--tRNA ligase [Klebsiella sp. MS 92-3]
 gi|328538805|gb|EGF64880.1| serine--tRNA ligase [Klebsiella sp. MS 92-3]
          Length = 430

 Score =  448 bits (1151), Expect = e-123,   Method: Composition-based stats.
 Identities = 203/431 (47%), Positives = 271/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRTEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVQTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L EQL   + E   + + ++ +   IPN+P ++VP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEQLDAAKSELETLLAEIRDIALAIPNIPHDDVPVGRDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE  G +DF  A KL+G+RF V+ G LA L RAL Q
Sbjct: 119 DNVEVSRWGTPRQFDFEVRDHVTLGEMHGGLDFAAAVKLTGSRFVVMKGQLARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII    LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIINEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR V+LCTGD+GFSACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKVALCTGDMGFSACKTYDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + IP V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVALMENYQQADGRIEIPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMRGLEYI 429


>gi|118589124|ref|ZP_01546531.1| seryl-tRNA synthetase [Stappia aggregata IAM 12614]
 gi|118438453|gb|EAV45087.1| seryl-tRNA synthetase [Stappia aggregata IAM 12614]
          Length = 426

 Score =  448 bits (1151), Expect = e-123,   Method: Composition-based stats.
 Identities = 233/425 (54%), Positives = 310/425 (72%), Gaps = 2/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+WIR+N    D AL KR  E  +  +++LD+  R  I K+++ + RRN+ S +IG+
Sbjct: 1   MFDIRWIRENAAAFDQALAKRGYEASAAKLIALDDSRRSHITKLQEAQERRNAASKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G+ +    L +E + +K  +   E+EE ++ + L+  ++ IPN+P ++VP+G    
Sbjct: 61  AKGSGDDARAQELIDEVAQIKAFIQSGEEEERKLIADLEAAMAVIPNLPHDDVPVGEDET 120

Query: 121 ENILIRSVGKKPSAIHL--SREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
           +N+L+++ G+KP        +EH+E+GE LG MDF +A KLSG+RF +L G +A LERAL
Sbjct: 121 DNVLLKTHGEKPVFTFNEAPKEHYELGEDLGGMDFAKAAKLSGSRFVILKGQIARLERAL 180

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTN 238
           GQFMIDLHT E+GYTEVS PLLV  E +YGTGQ+PKF +D+F TT   +LIPT+E+ LTN
Sbjct: 181 GQFMIDLHTQENGYTEVSPPLLVHSEPLYGTGQLPKFEEDLFKTTTDHYLIPTAEIPLTN 240

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L + EI+    LPLR T L   FRSEAGSAGRDTRGMLRQHQF KCELVS+T+ E+S  E
Sbjct: 241 LVAGEILPEDQLPLRVTALTYCFRSEAGSAGRDTRGMLRQHQFQKCELVSVTKPEESLDE 300

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            ERML CAE++L++L LHYRV++LC+GD+GF A KTYD+EVWL GQ+ YREISSCS CG+
Sbjct: 301 LERMLGCAEKVLQKLGLHYRVMTLCSGDMGFGARKTYDIEVWLPGQDTYREISSCSVCGD 360

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRMN+R+R  +SK     HTLNGSG+AVGR LIA+LENY N DG++T+P VLRPYM 
Sbjct: 361 FQARRMNARFRPADSKQPVHVHTLNGSGIAVGRALIAVLENYQNGDGTITVPEVLRPYMG 420

Query: 419 NLAVI 423
            L  I
Sbjct: 421 GLEKI 425


>gi|241204418|ref|YP_002975514.1| seryl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240858308|gb|ACS55975.1| seryl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 427

 Score =  447 bits (1150), Expect = e-123,   Method: Composition-based stats.
 Identities = 277/425 (65%), Positives = 340/425 (80%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR  EP ++ +++LDEK R  ++K +D+ +RRN  S +IG 
Sbjct: 1   MLDIKWIRENPEALDAALAKRGAEPLAQSLVALDEKRRSAVQKAQDLLSRRNLASKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ N  L + LK E S LK  LP +E+E+ ++ + L   +S IPN+P ++VP+G   +
Sbjct: 61  AMAQKNGELAEKLKAEVSELKTLLPAIEEEDRQLTAELNDALSRIPNIPFDDVPVGKDEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N++ R+VG+KP   H  +EHFEIGEALG MDF+RA KLSG+RF+VLTG LA LERALGQ
Sbjct: 121 DNVVTRTVGEKPRWNHAPKEHFEIGEALGYMDFERAAKLSGSRFTVLTGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMIDLHTSEHGY+EVS+PL+VRDEA+YGT Q+PKFADD+F TTDGRWLIPT+EV+LTNL 
Sbjct: 181 FMIDLHTSEHGYSEVSSPLMVRDEAVYGTAQLPKFADDLFRTTDGRWLIPTAEVTLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ + LPLRFT L PSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT  E +  EHE
Sbjct: 241 REEILDQEKLPLRFTALTPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITDAESAVAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL LH+R ++LCTGD+GF + KTYDLEVWL GQN +REISSCS CG+FQ
Sbjct: 301 RMTACAEEVLKRLGLHFRTMTLCTGDMGFGSRKTYDLEVWLPGQNAFREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    K+ KF HTLNGSG AVGRCLIA+LENYLN DGSVTIP VL PYM  L
Sbjct: 361 GRRMNARYRGKEDKNNKFVHTLNGSGTAVGRCLIAVLENYLNEDGSVTIPDVLLPYMGGL 420

Query: 421 AVIKK 425
             I++
Sbjct: 421 TKIER 425


>gi|187730384|ref|YP_001880909.1| seryl-tRNA synthetase [Shigella boydii CDC 3083-94]
 gi|238691690|sp|B2TUI5|SYS_SHIB3 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|187427376|gb|ACD06650.1| seryl-tRNA synthetase [Shigella boydii CDC 3083-94]
          Length = 430

 Score =  447 bits (1150), Expect = e-123,   Method: Composition-based stats.
 Identities = 199/431 (46%), Positives = 271/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    +++L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIESLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|325293088|ref|YP_004278952.1| Seryl-tRNA synthetase [Agrobacterium sp. H13-3]
 gi|325060941|gb|ADY64632.1| Seryl-tRNA synthetase [Agrobacterium sp. H13-3]
          Length = 427

 Score =  447 bits (1150), Expect = e-123,   Method: Composition-based stats.
 Identities = 277/425 (65%), Positives = 343/425 (80%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+WIR+NPE  D AL +R  EP +  +++LDEK R +I+ ++D+++RRN+ S  IG 
Sbjct: 1   MHDIKWIRENPEAFDAALARRGAEPAASSLIALDEKRRSVIQSLQDMQSRRNAASKDIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ N+ L + LK E + +KE +P  E+E+ +V + L   +S +PN+P ++VP G   +
Sbjct: 61  AMAQKNMELAEKLKAEVADIKENMPRAEEEDRQVTAELNDALSRLPNIPFDDVPDGKDEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N++ R VG+KP   H ++EHFEIGEALG MDF+RA KLSG+RF+VLT  LA LERALGQ
Sbjct: 121 DNVVTRVVGQKPGWNHEAKEHFEIGEALGYMDFERAAKLSGSRFTVLTSQLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMIDLHTSEHGYTEVS+PL+VRDEAM+GTGQ+PKF++D+F TTDGRWLIPT+EV+LTNL 
Sbjct: 181 FMIDLHTSEHGYTEVSSPLMVRDEAMFGTGQLPKFSEDLFKTTDGRWLIPTAEVTLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           S EI+E + LPLRFT L PSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT  E +  EHE
Sbjct: 241 SGEILEQEKLPLRFTALTPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITDAESAVAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL LH+R ++LCTGD+GFSA KTYDLEVWL GQN YREISSCS CG+FQ
Sbjct: 301 RMTACAEEVLKRLGLHFRTMTLCTGDMGFSARKTYDLEVWLPGQNTYREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR  + K+ KF HTLNGSG AVGRCLIA+LENYLN DGSVTIP VL PYM  L
Sbjct: 361 ARRMNARYRGKDDKATKFVHTLNGSGTAVGRCLIAVLENYLNDDGSVTIPNVLLPYMGGL 420

Query: 421 AVIKK 425
             I+K
Sbjct: 421 KRIEK 425


>gi|170769264|ref|ZP_02903717.1| seryl-tRNA synthetase [Escherichia albertii TW07627]
 gi|170121916|gb|EDS90847.1| seryl-tRNA synthetase [Escherichia albertii TW07627]
          Length = 430

 Score =  447 bits (1150), Expect = e-123,   Method: Composition-based stats.
 Identities = 199/431 (46%), Positives = 270/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPRKFDFEIRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|193070743|ref|ZP_03051678.1| seryl-tRNA synthetase [Escherichia coli E110019]
 gi|192955936|gb|EDV86404.1| seryl-tRNA synthetase [Escherichia coli E110019]
          Length = 430

 Score =  447 bits (1150), Expect = e-123,   Method: Composition-based stats.
 Identities = 199/431 (46%), Positives = 270/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDALQTEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|254449273|ref|ZP_05062720.1| seryl-tRNA synthetase [gamma proteobacterium HTCC5015]
 gi|198261128|gb|EDY85426.1| seryl-tRNA synthetase [gamma proteobacterium HTCC5015]
          Length = 427

 Score =  447 bits (1150), Expect = e-123,   Method: Composition-based stats.
 Identities = 205/429 (47%), Positives = 274/429 (63%), Gaps = 7/429 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R + + +  AL KR      +    L+ + +    + +D++  RN+ S  IGQ
Sbjct: 1   MLDPKRLRSDLDAVADALTKRGFTLDKDQFSQLEARRKSEQTRTQDLQNERNTRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ LK   + L ++L   E E   + S L +L+  IPN P E VP G   +
Sbjct: 61  AKAAG--EDIEPLKAAVAELGKELAQSEGELKTIQSELDELVLGIPNEPHETVPEGKDES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G+  S     ++H  +GE  G MDF+ A+K++G+RF VL G +  L RAL Q
Sbjct: 119 DNVEVSRWGEPKSFEFDVKDHVALGEHKGWMDFEEASKITGSRFVVLRGAMCRLHRALTQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-----TDGRWLIPTSEVS 235
           FM+D H  +HGY EV  P +V  +++YGTGQ+PKF +D+F        +  +LIPT+EV 
Sbjct: 179 FMLDTHADQHGYQEVYVPYIVNQDSLYGTGQLPKFGEDLFKIEREGEDNSFYLIPTAEVP 238

Query: 236 LTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDS 295
           +TN+    I E K LPL+     P FRSEAGS GRDTRGM+RQHQF K ELV + + EDS
Sbjct: 239 VTNMARDVIYEEKDLPLKRVAHTPCFRSEAGSYGRDTRGMIRQHQFEKVELVQLVKPEDS 298

Query: 296 FTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCST 355
           +   E +   AE IL++L+L YR V LC GDLGFSA KTYDLEVWL GQ+ YREISSCS 
Sbjct: 299 WQALEELCGHAETILQKLELPYRKVVLCGGDLGFSAAKTYDLEVWLPGQSAYREISSCSN 358

Query: 356 CGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
             +FQ+RRM +RYR P+SK  +  HTLNGSG+AVGR LIA+LENY NADGSVT+P VLRP
Sbjct: 359 FVDFQARRMKARYRSPDSKKPELLHTLNGSGLAVGRALIAVLENYQNADGSVTVPEVLRP 418

Query: 416 YMNNLAVIK 424
           YM  L V+K
Sbjct: 419 YMGGLDVLK 427


>gi|116251809|ref|YP_767647.1| seryl-tRNA synthetase [Rhizobium leguminosarum bv. viciae 3841]
 gi|166223278|sp|Q1MHM2|SYS_RHIL3 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|115256457|emb|CAK07541.1| putative seryl-tRNA synthetase [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 427

 Score =  447 bits (1149), Expect = e-123,   Method: Composition-based stats.
 Identities = 278/425 (65%), Positives = 340/425 (80%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR  EP ++ +++LDEK R  ++K +D+ +RRN  S +IG 
Sbjct: 1   MLDIKWIRENPEALDAALAKRGAEPLAQSLVALDEKRRSAVQKAQDLLSRRNLASKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ N  L + LK E S LK  LP +E+E+ ++ + L   +S IPN+P ++VP+G   +
Sbjct: 61  AMAQKNSELAEKLKAEVSELKTLLPAIEEEDRQLTAELNDALSRIPNIPFDDVPVGKDEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +NI+ R+VG+KP   H  +EHFEIGEALG MDF+RA KLSG+RF+VLTG LA LERALGQ
Sbjct: 121 DNIVTRTVGEKPRWNHAPKEHFEIGEALGYMDFERAAKLSGSRFTVLTGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMIDLHTSEHGY EVS+PL+VRDEA+YGT Q+PKFA+D+F TTDGRWLIPT+EV+LTNL 
Sbjct: 181 FMIDLHTSEHGYIEVSSPLMVRDEAVYGTAQLPKFAEDLFRTTDGRWLIPTAEVTLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ + LPLRFT L PSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT  E +  EHE
Sbjct: 241 REEILDQEKLPLRFTALTPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITDAESAVAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL LH+R ++LCTGD+GF + KTYDLEVWL GQN +REISSCS CG+FQ
Sbjct: 301 RMTACAEEVLKRLGLHFRTMTLCTGDMGFGSRKTYDLEVWLPGQNAFREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR  + KS KF HTLNGSG AVGRCLIA+LENYLN DGSVTIP VL PYM  L
Sbjct: 361 GRRMNARYRGKDDKSNKFVHTLNGSGTAVGRCLIAVLENYLNEDGSVTIPDVLLPYMGGL 420

Query: 421 AVIKK 425
             I++
Sbjct: 421 TKIER 425


>gi|218548415|ref|YP_002382206.1| seryl-tRNA synthetase [Escherichia fergusonii ATCC 35469]
 gi|226701416|sp|B7LN61|SYS_ESCF3 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|218355956|emb|CAQ88572.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia fergusonii ATCC 35469]
 gi|324113810|gb|EGC07785.1| seryl-tRNA synthetase [Escherichia fergusonii B253]
 gi|325496838|gb|EGC94697.1| seryl-tRNA synthetase [Escherichia fergusonii ECD227]
          Length = 430

 Score =  447 bits (1149), Expect = e-123,   Method: Composition-based stats.
 Identities = 199/431 (46%), Positives = 270/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|15830232|ref|NP_309005.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. Sakai]
 gi|16128860|ref|NP_415413.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli str. K-12 substr. MG1655]
 gi|24112268|ref|NP_706778.1| seryl-tRNA synthetase [Shigella flexneri 2a str. 301]
 gi|26246919|ref|NP_752959.1| seryl-tRNA synthetase [Escherichia coli CFT073]
 gi|30062380|ref|NP_836551.1| seryl-tRNA synthetase [Shigella flexneri 2a str. 2457T]
 gi|74311451|ref|YP_309870.1| seryl-tRNA synthetase [Shigella sonnei Ss046]
 gi|82543379|ref|YP_407326.1| seryl-tRNA synthetase [Shigella boydii Sb227]
 gi|89107743|ref|AP_001523.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli str. K-12 substr. W3110]
 gi|91209938|ref|YP_539924.1| seryl-tRNA synthetase [Escherichia coli UTI89]
 gi|110641093|ref|YP_668823.1| seryl-tRNA synthetase [Escherichia coli 536]
 gi|110804894|ref|YP_688414.1| seryl-tRNA synthetase [Shigella flexneri 5 str. 8401]
 gi|117623077|ref|YP_851990.1| seryl-tRNA synthetase [Escherichia coli APEC O1]
 gi|157157556|ref|YP_001462091.1| seryl-tRNA synthetase [Escherichia coli E24377A]
 gi|157160416|ref|YP_001457734.1| seryl-tRNA synthetase [Escherichia coli HS]
 gi|168752125|ref|ZP_02777147.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4113]
 gi|168756984|ref|ZP_02781991.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4401]
 gi|168762973|ref|ZP_02787980.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4501]
 gi|168769886|ref|ZP_02794893.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4486]
 gi|168776256|ref|ZP_02801263.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4196]
 gi|168783803|ref|ZP_02808810.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4076]
 gi|168787321|ref|ZP_02812328.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC869]
 gi|168801425|ref|ZP_02826432.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC508]
 gi|170020705|ref|YP_001725659.1| seryl-tRNA synthetase [Escherichia coli ATCC 8739]
 gi|170080551|ref|YP_001729871.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli str. K-12 substr. DH10B]
 gi|170683015|ref|YP_001744277.1| seryl-tRNA synthetase [Escherichia coli SMS-3-5]
 gi|188492608|ref|ZP_02999878.1| seryl-tRNA synthetase [Escherichia coli 53638]
 gi|191167614|ref|ZP_03029425.1| seryl-tRNA synthetase [Escherichia coli B7A]
 gi|191172133|ref|ZP_03033677.1| seryl-tRNA synthetase [Escherichia coli F11]
 gi|193064674|ref|ZP_03045753.1| seryl-tRNA synthetase [Escherichia coli E22]
 gi|194428395|ref|ZP_03060936.1| seryl-tRNA synthetase [Escherichia coli B171]
 gi|194438706|ref|ZP_03070793.1| seryl-tRNA synthetase [Escherichia coli 101-1]
 gi|195939556|ref|ZP_03084938.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4024]
 gi|208808989|ref|ZP_03251326.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4206]
 gi|208815536|ref|ZP_03256715.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4045]
 gi|208822033|ref|ZP_03262352.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4042]
 gi|209396596|ref|YP_002269566.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4115]
 gi|209918142|ref|YP_002292226.1| seryl-tRNA synthetase [Escherichia coli SE11]
 gi|215486023|ref|YP_002328454.1| seryl-tRNA synthetase [Escherichia coli O127:H6 str. E2348/69]
 gi|217326397|ref|ZP_03442481.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. TW14588]
 gi|218553479|ref|YP_002386392.1| seryl-tRNA synthetase [Escherichia coli IAI1]
 gi|218557801|ref|YP_002390714.1| seryl-tRNA synthetase [Escherichia coli S88]
 gi|218688681|ref|YP_002396893.1| seryl-tRNA synthetase [Escherichia coli ED1a]
 gi|218694366|ref|YP_002402033.1| seryl-tRNA synthetase [Escherichia coli 55989]
 gi|218700589|ref|YP_002408218.1| seryl-tRNA synthetase [Escherichia coli IAI39]
 gi|218704322|ref|YP_002411841.1| seryl-tRNA synthetase [Escherichia coli UMN026]
 gi|227884140|ref|ZP_04001945.1| seryl-tRNA synthetase [Escherichia coli 83972]
 gi|237707117|ref|ZP_04537598.1| seryl-tRNA synthetase [Escherichia sp. 3_2_53FAA]
 gi|238900151|ref|YP_002925947.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli BW2952]
 gi|253774078|ref|YP_003036909.1| seryl-tRNA synthetase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254161007|ref|YP_003044115.1| seryl-tRNA synthetase [Escherichia coli B str. REL606]
 gi|254792093|ref|YP_003076930.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. TW14359]
 gi|256020979|ref|ZP_05434844.1| seryl-tRNA synthetase [Shigella sp. D9]
 gi|256023406|ref|ZP_05437271.1| seryl-tRNA synthetase [Escherichia sp. 4_1_40B]
 gi|260843143|ref|YP_003220921.1| seryl-tRNA synthetase [Escherichia coli O103:H2 str. 12009]
 gi|260854184|ref|YP_003228075.1| seryl-tRNA synthetase [Escherichia coli O26:H11 str. 11368]
 gi|260867065|ref|YP_003233467.1| seryl-tRNA synthetase [Escherichia coli O111:H- str. 11128]
 gi|261227398|ref|ZP_05941679.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli O157:H7 str. FRIK2000]
 gi|261256179|ref|ZP_05948712.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. FRIK966]
 gi|291281896|ref|YP_003498714.1| Seryl-tRNA synthetase [Escherichia coli O55:H7 str. CB9615]
 gi|293404200|ref|ZP_06648194.1| seryl-tRNA synthetase [Escherichia coli FVEC1412]
 gi|293409271|ref|ZP_06652847.1| seryl-tRNA synthetase [Escherichia coli B354]
 gi|293414175|ref|ZP_06656824.1| seryl-tRNA synthetase [Escherichia coli B185]
 gi|293433190|ref|ZP_06661618.1| seryl-tRNA synthetase [Escherichia coli B088]
 gi|297518813|ref|ZP_06937199.1| seryl-tRNA synthetase [Escherichia coli OP50]
 gi|298379981|ref|ZP_06989586.1| seryl-tRNA synthetase [Escherichia coli FVEC1302]
 gi|300817005|ref|ZP_07097224.1| seryl-tRNA synthetase [Escherichia coli MS 107-1]
 gi|300823632|ref|ZP_07103759.1| seryl-tRNA synthetase [Escherichia coli MS 119-7]
 gi|300896500|ref|ZP_07115024.1| seryl-tRNA synthetase [Escherichia coli MS 198-1]
 gi|300902950|ref|ZP_07120894.1| seryl-tRNA synthetase [Escherichia coli MS 84-1]
 gi|300921073|ref|ZP_07137457.1| seryl-tRNA synthetase [Escherichia coli MS 115-1]
 gi|300926531|ref|ZP_07142320.1| seryl-tRNA synthetase [Escherichia coli MS 182-1]
 gi|300929586|ref|ZP_07145049.1| seryl-tRNA synthetase [Escherichia coli MS 187-1]
 gi|300937613|ref|ZP_07152422.1| seryl-tRNA synthetase [Escherichia coli MS 21-1]
 gi|300949747|ref|ZP_07163724.1| seryl-tRNA synthetase [Escherichia coli MS 116-1]
 gi|300954716|ref|ZP_07167151.1| seryl-tRNA synthetase [Escherichia coli MS 175-1]
 gi|300978543|ref|ZP_07174296.1| seryl-tRNA synthetase [Escherichia coli MS 45-1]
 gi|300983196|ref|ZP_07176475.1| seryl-tRNA synthetase [Escherichia coli MS 200-1]
 gi|301022878|ref|ZP_07186711.1| seryl-tRNA synthetase [Escherichia coli MS 69-1]
 gi|301024412|ref|ZP_07188097.1| seryl-tRNA synthetase [Escherichia coli MS 196-1]
 gi|301047849|ref|ZP_07194899.1| seryl-tRNA synthetase [Escherichia coli MS 185-1]
 gi|301302500|ref|ZP_07208631.1| seryl-tRNA synthetase [Escherichia coli MS 124-1]
 gi|301325784|ref|ZP_07219232.1| seryl-tRNA synthetase [Escherichia coli MS 78-1]
 gi|301646338|ref|ZP_07246226.1| seryl-tRNA synthetase [Escherichia coli MS 146-1]
 gi|306812651|ref|ZP_07446844.1| seryl-tRNA synthetase [Escherichia coli NC101]
 gi|307137521|ref|ZP_07496877.1| seryl-tRNA synthetase [Escherichia coli H736]
 gi|307311720|ref|ZP_07591360.1| seryl-tRNA synthetase [Escherichia coli W]
 gi|309795298|ref|ZP_07689716.1| seryl-tRNA synthetase [Escherichia coli MS 145-7]
 gi|312969039|ref|ZP_07783246.1| seryl-tRNA synthetase [Escherichia coli 2362-75]
 gi|312971020|ref|ZP_07785199.1| seryl-tRNA synthetase [Escherichia coli 1827-70]
 gi|331641414|ref|ZP_08342549.1| serine--tRNA ligase [Escherichia coli H736]
 gi|331646160|ref|ZP_08347263.1| serine--tRNA ligase [Escherichia coli M605]
 gi|331651912|ref|ZP_08352931.1| serine--tRNA ligase [Escherichia coli M718]
 gi|331656965|ref|ZP_08357927.1| serine--tRNA ligase [Escherichia coli TA206]
 gi|331662308|ref|ZP_08363231.1| serine--tRNA ligase [Escherichia coli TA143]
 gi|331667267|ref|ZP_08368132.1| serine--tRNA ligase [Escherichia coli TA271]
 gi|331672434|ref|ZP_08373224.1| serine--tRNA ligase [Escherichia coli TA280]
 gi|331676680|ref|ZP_08377376.1| serine--tRNA ligase [Escherichia coli H591]
 gi|331682402|ref|ZP_08383021.1| serine--tRNA ligase [Escherichia coli H299]
 gi|332282204|ref|ZP_08394617.1| seryl-tRNA synthetase [Shigella sp. D9]
 gi|67473027|sp|P0A8L1|SYS_ECOLI RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|67473028|sp|P0A8L2|SYS_ECOL6 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|67473029|sp|P0A8L3|SYS_ECO57 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|67473030|sp|P0A8L4|SYS_SHIFL RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|122424423|sp|Q1RE21|SYS_ECOUT RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|122957696|sp|Q0T8M9|SYS_SHIF8 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|123049332|sp|Q0TJF7|SYS_ECOL5 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|123617600|sp|Q3Z3M7|SYS_SHISS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|123755624|sp|Q323L0|SYS_SHIBS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|166221437|sp|A1A9D6|SYS_ECOK1 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|166987311|sp|A7ZJW2|SYS_ECO24 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|166987312|sp|A7ZYJ7|SYS_ECOHS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|189083568|sp|B1IWN0|SYS_ECOLC RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|226701391|sp|B7MHK5|SYS_ECO45 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|226701392|sp|B7NM82|SYS_ECO7I RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|226701393|sp|B7M821|SYS_ECO8A RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|226701394|sp|B7NAP4|SYS_ECOLU RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|226701395|sp|B1LJX0|SYS_ECOSM RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|229559900|sp|B1X833|SYS_ECODH RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|238065099|sp|B5YT28|SYS_ECO5E RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|238065100|sp|B6I8W4|SYS_ECOSE RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|254783025|sp|B7UMY4|SYS_ECO27 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|254783026|sp|B7LD85|SYS_ECO55 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|254783027|sp|B7MRV6|SYS_ECO81 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|259511667|sp|C4ZQ19|SYS_ECOBW RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|26107319|gb|AAN79502.1|AE016758_106 Seryl-tRNA synthetase [Escherichia coli CFT073]
 gi|42950|emb|CAA28673.1| unnamed protein product [Escherichia coli]
 gi|1651420|dbj|BAA35625.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli str. K12 substr. W3110]
 gi|1787120|gb|AAC73979.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli str. K-12 substr. MG1655]
 gi|13360437|dbj|BAB34401.1| serine tRNA synthetase [Escherichia coli O157:H7 str. Sakai]
 gi|24051120|gb|AAN42485.1| serine tRNA synthetase [Shigella flexneri 2a str. 301]
 gi|30040626|gb|AAP16357.1| serine tRNA synthetase [Shigella flexneri 2a str. 2457T]
 gi|73854928|gb|AAZ87635.1| serine tRNA synthetase [Shigella sonnei Ss046]
 gi|81244790|gb|ABB65498.1| serine tRNA synthetase [Shigella boydii Sb227]
 gi|91071512|gb|ABE06393.1| seryl-tRNA synthetase [Escherichia coli UTI89]
 gi|110342685|gb|ABG68922.1| seryl-tRNA synthetase [Escherichia coli 536]
 gi|110614442|gb|ABF03109.1| serine tRNA synthetase [Shigella flexneri 5 str. 8401]
 gi|115512201|gb|ABJ00276.1| seryl-tRNA synthetase [Escherichia coli APEC O1]
 gi|157066096|gb|ABV05351.1| seryl-tRNA synthetase [Escherichia coli HS]
 gi|157079586|gb|ABV19294.1| seryl-tRNA synthetase [Escherichia coli E24377A]
 gi|169755633|gb|ACA78332.1| seryl-tRNA synthetase [Escherichia coli ATCC 8739]
 gi|169888386|gb|ACB02093.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli str. K-12 substr. DH10B]
 gi|170520733|gb|ACB18911.1| seryl-tRNA synthetase [Escherichia coli SMS-3-5]
 gi|187768390|gb|EDU32234.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4196]
 gi|188013954|gb|EDU52076.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4113]
 gi|188487807|gb|EDU62910.1| seryl-tRNA synthetase [Escherichia coli 53638]
 gi|188998912|gb|EDU67898.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4076]
 gi|189355936|gb|EDU74355.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4401]
 gi|189361156|gb|EDU79575.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4486]
 gi|189366796|gb|EDU85212.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4501]
 gi|189372720|gb|EDU91136.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC869]
 gi|189376450|gb|EDU94866.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC508]
 gi|190902375|gb|EDV62113.1| seryl-tRNA synthetase [Escherichia coli B7A]
 gi|190907660|gb|EDV67255.1| seryl-tRNA synthetase [Escherichia coli F11]
 gi|192927731|gb|EDV82346.1| seryl-tRNA synthetase [Escherichia coli E22]
 gi|194413610|gb|EDX29891.1| seryl-tRNA synthetase [Escherichia coli B171]
 gi|194422338|gb|EDX38338.1| seryl-tRNA synthetase [Escherichia coli 101-1]
 gi|208728790|gb|EDZ78391.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4206]
 gi|208732184|gb|EDZ80872.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4045]
 gi|208737518|gb|EDZ85201.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4042]
 gi|209157996|gb|ACI35429.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC4115]
 gi|209775018|gb|ACI85821.1| serine tRNA synthetase [Escherichia coli]
 gi|209775020|gb|ACI85822.1| serine tRNA synthetase [Escherichia coli]
 gi|209775022|gb|ACI85823.1| serine tRNA synthetase [Escherichia coli]
 gi|209775024|gb|ACI85824.1| serine tRNA synthetase [Escherichia coli]
 gi|209775026|gb|ACI85825.1| serine tRNA synthetase [Escherichia coli]
 gi|209911401|dbj|BAG76475.1| seryl-tRNA synthase [Escherichia coli SE11]
 gi|215264095|emb|CAS08437.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli O127:H6 str. E2348/69]
 gi|217322618|gb|EEC31042.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. TW14588]
 gi|218351098|emb|CAU96802.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli 55989]
 gi|218360247|emb|CAQ97797.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli IAI1]
 gi|218364570|emb|CAR02256.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli S88]
 gi|218370575|emb|CAR18382.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli IAI39]
 gi|218426245|emb|CAR07070.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli ED1a]
 gi|218431419|emb|CAR12297.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli UMN026]
 gi|222032627|emb|CAP75366.1| Seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli LF82]
 gi|226898327|gb|EEH84586.1| seryl-tRNA synthetase [Escherichia sp. 3_2_53FAA]
 gi|227838892|gb|EEJ49358.1| seryl-tRNA synthetase [Escherichia coli 83972]
 gi|238863546|gb|ACR65544.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli BW2952]
 gi|242376708|emb|CAQ31421.1| seryl-tRNA synthetase [Escherichia coli BL21(DE3)]
 gi|253325122|gb|ACT29724.1| seryl-tRNA synthetase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253972908|gb|ACT38579.1| seryl-tRNA synthetase [Escherichia coli B str. REL606]
 gi|253977122|gb|ACT42792.1| seryl-tRNA synthetase [Escherichia coli BL21(DE3)]
 gi|254591493|gb|ACT70854.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli O157:H7 str. TW14359]
 gi|257752833|dbj|BAI24335.1| seryl-tRNA synthetase [Escherichia coli O26:H11 str. 11368]
 gi|257758290|dbj|BAI29787.1| seryl-tRNA synthetase [Escherichia coli O103:H2 str. 12009]
 gi|257763421|dbj|BAI34916.1| seryl-tRNA synthetase [Escherichia coli O111:H- str. 11128]
 gi|260449961|gb|ACX40383.1| seryl-tRNA synthetase [Escherichia coli DH1]
 gi|281178027|dbj|BAI54357.1| seryl-tRNA synthetase [Escherichia coli SE15]
 gi|281600221|gb|ADA73205.1| Seryl-tRNA synthetase [Shigella flexneri 2002017]
 gi|284920746|emb|CBG33809.1| seryl-tRNA synthetase [Escherichia coli 042]
 gi|290761769|gb|ADD55730.1| Seryl-tRNA synthetase [Escherichia coli O55:H7 str. CB9615]
 gi|291324009|gb|EFE63431.1| seryl-tRNA synthetase [Escherichia coli B088]
 gi|291428786|gb|EFF01811.1| seryl-tRNA synthetase [Escherichia coli FVEC1412]
 gi|291434233|gb|EFF07206.1| seryl-tRNA synthetase [Escherichia coli B185]
 gi|291469739|gb|EFF12223.1| seryl-tRNA synthetase [Escherichia coli B354]
 gi|294493263|gb|ADE92019.1| seryl-tRNA synthetase [Escherichia coli IHE3034]
 gi|298279679|gb|EFI21187.1| seryl-tRNA synthetase [Escherichia coli FVEC1302]
 gi|299880384|gb|EFI88595.1| seryl-tRNA synthetase [Escherichia coli MS 196-1]
 gi|300300277|gb|EFJ56662.1| seryl-tRNA synthetase [Escherichia coli MS 185-1]
 gi|300306960|gb|EFJ61480.1| seryl-tRNA synthetase [Escherichia coli MS 200-1]
 gi|300318327|gb|EFJ68111.1| seryl-tRNA synthetase [Escherichia coli MS 175-1]
 gi|300359649|gb|EFJ75519.1| seryl-tRNA synthetase [Escherichia coli MS 198-1]
 gi|300397340|gb|EFJ80878.1| seryl-tRNA synthetase [Escherichia coli MS 69-1]
 gi|300405011|gb|EFJ88549.1| seryl-tRNA synthetase [Escherichia coli MS 84-1]
 gi|300409622|gb|EFJ93160.1| seryl-tRNA synthetase [Escherichia coli MS 45-1]
 gi|300411924|gb|EFJ95234.1| seryl-tRNA synthetase [Escherichia coli MS 115-1]
 gi|300417448|gb|EFK00759.1| seryl-tRNA synthetase [Escherichia coli MS 182-1]
 gi|300450861|gb|EFK14481.1| seryl-tRNA synthetase [Escherichia coli MS 116-1]
 gi|300457343|gb|EFK20836.1| seryl-tRNA synthetase [Escherichia coli MS 21-1]
 gi|300462474|gb|EFK25967.1| seryl-tRNA synthetase [Escherichia coli MS 187-1]
 gi|300523832|gb|EFK44901.1| seryl-tRNA synthetase [Escherichia coli MS 119-7]
 gi|300530357|gb|EFK51419.1| seryl-tRNA synthetase [Escherichia coli MS 107-1]
 gi|300842339|gb|EFK70099.1| seryl-tRNA synthetase [Escherichia coli MS 124-1]
 gi|300847427|gb|EFK75187.1| seryl-tRNA synthetase [Escherichia coli MS 78-1]
 gi|301075441|gb|EFK90247.1| seryl-tRNA synthetase [Escherichia coli MS 146-1]
 gi|305853414|gb|EFM53853.1| seryl-tRNA synthetase [Escherichia coli NC101]
 gi|306908275|gb|EFN38774.1| seryl-tRNA synthetase [Escherichia coli W]
 gi|307552735|gb|ADN45510.1| serine tRNA synthetase [Escherichia coli ABU 83972]
 gi|307627677|gb|ADN71981.1| seryl-tRNA synthetase [Escherichia coli UM146]
 gi|308120948|gb|EFO58210.1| seryl-tRNA synthetase [Escherichia coli MS 145-7]
 gi|309701169|emb|CBJ00469.1| seryl-tRNA synthetase [Escherichia coli ETEC H10407]
 gi|310336781|gb|EFQ01948.1| seryl-tRNA synthetase [Escherichia coli 1827-70]
 gi|312286441|gb|EFR14354.1| seryl-tRNA synthetase [Escherichia coli 2362-75]
 gi|312945416|gb|ADR26243.1| seryl-tRNA synthetase [Escherichia coli O83:H1 str. NRG 857C]
 gi|313650195|gb|EFS14607.1| seryl-tRNA synthetase [Shigella flexneri 2a str. 2457T]
 gi|315060178|gb|ADT74505.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Escherichia coli W]
 gi|315135541|dbj|BAJ42700.1| seryl-tRNA synthetase [Escherichia coli DH1]
 gi|315257933|gb|EFU37901.1| seryl-tRNA synthetase [Escherichia coli MS 85-1]
 gi|315287520|gb|EFU46931.1| seryl-tRNA synthetase [Escherichia coli MS 110-3]
 gi|315291252|gb|EFU50612.1| seryl-tRNA synthetase [Escherichia coli MS 153-1]
 gi|315296139|gb|EFU55448.1| seryl-tRNA synthetase [Escherichia coli MS 16-3]
 gi|315619205|gb|EFU99784.1| seryl-tRNA synthetase [Escherichia coli 3431]
 gi|320180610|gb|EFW55539.1| Seryl-tRNA synthetase [Shigella boydii ATCC 9905]
 gi|320183168|gb|EFW58026.1| Seryl-tRNA synthetase [Shigella flexneri CDC 796-83]
 gi|320192620|gb|EFW67261.1| Seryl-tRNA synthetase [Escherichia coli O157:H7 str. EC1212]
 gi|320196611|gb|EFW71234.1| Seryl-tRNA synthetase [Escherichia coli WV_060327]
 gi|320202288|gb|EFW76859.1| Seryl-tRNA synthetase [Escherichia coli EC4100B]
 gi|320637763|gb|EFX07555.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. G5101]
 gi|320642887|gb|EFX12088.1| seryl-tRNA synthetase [Escherichia coli O157:H- str. 493-89]
 gi|320648344|gb|EFX16999.1| seryl-tRNA synthetase [Escherichia coli O157:H- str. H 2687]
 gi|320654182|gb|EFX22250.1| seryl-tRNA synthetase [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320659806|gb|EFX27362.1| seryl-tRNA synthetase [Escherichia coli O55:H7 str. USDA 5905]
 gi|320664275|gb|EFX31426.1| seryl-tRNA synthetase [Escherichia coli O157:H7 str. LSU-61]
 gi|323157221|gb|EFZ43344.1| seryl-tRNA synthetase [Escherichia coli EPECa14]
 gi|323159518|gb|EFZ45498.1| seryl-tRNA synthetase [Escherichia coli E128010]
 gi|323165354|gb|EFZ51141.1| seryl-tRNA synthetase [Shigella sonnei 53G]
 gi|323172135|gb|EFZ57773.1| seryl-tRNA synthetase [Escherichia coli LT-68]
 gi|323175485|gb|EFZ61080.1| seryl-tRNA synthetase [Escherichia coli 1180]
 gi|323185142|gb|EFZ70507.1| seryl-tRNA synthetase [Escherichia coli 1357]
 gi|323190715|gb|EFZ75984.1| seryl-tRNA synthetase [Escherichia coli RN587/1]
 gi|323379265|gb|ADX51533.1| seryl-tRNA synthetase [Escherichia coli KO11]
 gi|323937999|gb|EGB34261.1| seryl-tRNA synthetase [Escherichia coli E1520]
 gi|323942809|gb|EGB38974.1| seryl-tRNA synthetase [Escherichia coli E482]
 gi|323947318|gb|EGB43326.1| seryl-tRNA synthetase [Escherichia coli H120]
 gi|323953397|gb|EGB49263.1| seryl-tRNA synthetase [Escherichia coli H252]
 gi|323958200|gb|EGB53909.1| seryl-tRNA synthetase [Escherichia coli H263]
 gi|323962941|gb|EGB58514.1| seryl-tRNA synthetase [Escherichia coli H489]
 gi|323967140|gb|EGB62564.1| seryl-tRNA synthetase [Escherichia coli M863]
 gi|323969605|gb|EGB64892.1| seryl-tRNA synthetase [Escherichia coli TA007]
 gi|323976720|gb|EGB71808.1| seryl-tRNA synthetase [Escherichia coli TW10509]
 gi|324009812|gb|EGB79031.1| seryl-tRNA synthetase [Escherichia coli MS 57-2]
 gi|324012983|gb|EGB82202.1| seryl-tRNA synthetase [Escherichia coli MS 60-1]
 gi|324116106|gb|EGC10030.1| seryl-tRNA synthetase [Escherichia coli E1167]
 gi|326338211|gb|EGD62040.1| Seryl-tRNA synthetase [Escherichia coli O157:H7 str. 1125]
 gi|326346188|gb|EGD69926.1| Seryl-tRNA synthetase [Escherichia coli O157:H7 str. 1044]
 gi|327253681|gb|EGE65310.1| seryl-tRNA synthetase [Escherichia coli STEC_7v]
 gi|330910675|gb|EGH39185.1| seryl-tRNA synthetase [Escherichia coli AA86]
 gi|331038212|gb|EGI10432.1| serine--tRNA ligase [Escherichia coli H736]
 gi|331044912|gb|EGI17039.1| serine--tRNA ligase [Escherichia coli M605]
 gi|331050190|gb|EGI22248.1| serine--tRNA ligase [Escherichia coli M718]
 gi|331055213|gb|EGI27222.1| serine--tRNA ligase [Escherichia coli TA206]
 gi|331060730|gb|EGI32694.1| serine--tRNA ligase [Escherichia coli TA143]
 gi|331065623|gb|EGI37516.1| serine--tRNA ligase [Escherichia coli TA271]
 gi|331070340|gb|EGI41705.1| serine--tRNA ligase [Escherichia coli TA280]
 gi|331075369|gb|EGI46667.1| serine--tRNA ligase [Escherichia coli H591]
 gi|331080033|gb|EGI51212.1| serine--tRNA ligase [Escherichia coli H299]
 gi|332097143|gb|EGJ02126.1| seryl-tRNA synthetase [Shigella boydii 3594-74]
 gi|332104556|gb|EGJ07902.1| seryl-tRNA synthetase [Shigella sp. D9]
 gi|332342282|gb|AEE55616.1| seryl-tRNA synthetase SerS [Escherichia coli UMNK88]
 gi|332760582|gb|EGJ90871.1| seryl-tRNA synthetase [Shigella flexneri 2747-71]
 gi|332762948|gb|EGJ93198.1| seryl-tRNA synthetase [Shigella flexneri K-671]
 gi|332768071|gb|EGJ98257.1| seryl-tRNA synthetase [Shigella flexneri 2930-71]
 gi|333006696|gb|EGK26195.1| seryl-tRNA synthetase [Shigella flexneri VA-6]
 gi|333021000|gb|EGK40258.1| seryl-tRNA synthetase [Shigella flexneri K-304]
          Length = 430

 Score =  447 bits (1149), Expect = e-123,   Method: Composition-based stats.
 Identities = 199/431 (46%), Positives = 270/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|311280197|ref|YP_003942428.1| seryl-tRNA synthetase [Enterobacter cloacae SCF1]
 gi|308749392|gb|ADO49144.1| seryl-tRNA synthetase [Enterobacter cloacae SCF1]
          Length = 430

 Score =  447 bits (1149), Expect = e-123,   Method: Composition-based stats.
 Identities = 199/431 (46%), Positives = 273/431 (63%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVQTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P + VP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDQAKAELDVLQAEIRDIALAIPNIPDDSVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ ++  G         R+H  +GE    +DF  A KL+G+RF V+ G +AHL RAL Q
Sbjct: 119 DNVEVKRWGTPREFDFDVRDHVTLGEMHAGLDFAAAVKLTGSRFVVMKGQIAHLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSETYVPYLVNHDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI++   LP++ T  +P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEILDEDDLPIKLTAHSPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M S AE++L+ L L YR V+LCTGD+GF ACKT+DLEVW+  QN YREISS
Sbjct: 299 EDSMDALEEMTSHAEKVLELLGLPYRRVALCTGDMGFGACKTFDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + IP V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIAIPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMKGLEFI 429


>gi|15800756|ref|NP_286770.1| seryl-tRNA synthetase [Escherichia coli O157:H7 EDL933]
 gi|12514055|gb|AAG55380.1|AE005278_6 serine tRNA synthetase; also charges selenocystein tRNA with serine
           [Escherichia coli O157:H7 str. EDL933]
          Length = 430

 Score =  447 bits (1149), Expect = e-123,   Method: Composition-based stats.
 Identities = 200/431 (46%), Positives = 271/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  +A+YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDALYGTGQLPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|260597297|ref|YP_003209868.1| seryl-tRNA synthetase [Cronobacter turicensis z3032]
 gi|260216474|emb|CBA29619.1| Seryl-tRNA synthetase [Cronobacter turicensis z3032]
          Length = 430

 Score =  447 bits (1149), Expect = e-123,   Method: Composition-based stats.
 Identities = 202/431 (46%), Positives = 273/431 (63%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + +++L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRTEPDAVAEKLARRGFKLDVDKLVALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   +PN+P ++VP+G   +
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDTAKNELDALLAEIRDIALTLPNLPDDDVPLGKDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +   G         R+H  +GE LG MDF  A KL+G+RF V+ G +A L RAL Q
Sbjct: 119 ENVEVSRWGTPRKFDFEIRDHVTLGETLGGMDFASAVKLTGSRFVVMKGQIARLHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT EHGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEEHGYSENYVPYLVNHDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+ ++LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIIDEETLPVKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR V LC+GD+GF A KTYDLEVWL  Q+ YREISS
Sbjct: 299 EDSMQALEEMTGHAEKVLQLLGLPYRKVLLCSGDMGFGARKTYDLEVWLPAQDTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A+LENY  ADG + IP V
Sbjct: 359 CSNMWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVLENYQQADGRIEIPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMKGLEFI 429


>gi|332091134|gb|EGI96224.1| seryl-tRNA synthetase [Shigella dysenteriae 155-74]
          Length = 430

 Score =  446 bits (1148), Expect = e-123,   Method: Composition-based stats.
 Identities = 199/431 (46%), Positives = 269/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R    K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKPDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|103486215|ref|YP_615776.1| seryl-tRNA synthetase [Sphingopyxis alaskensis RB2256]
 gi|123253474|sp|Q1GV79|SYS_SPHAL RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|98976292|gb|ABF52443.1| seryl-tRNA synthetase [Sphingopyxis alaskensis RB2256]
          Length = 426

 Score =  446 bits (1148), Expect = e-123,   Method: Composition-based stats.
 Identities = 229/425 (53%), Positives = 281/425 (66%), Gaps = 1/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP   D  L +R L P S  IL+ D + R L   I+   ARRN  S  IGQ
Sbjct: 1   MHDIRLIRDNPHAFDAGLARRGLAPLSAEILAADAELRALQTDIQAALARRNEASKLIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A G+    +ALK E + LK  LP  E+ E    ++L   ++ +PN+P ++VP G    
Sbjct: 61  AMAAGDKDKAEALKAEVAALKAALPAREEAERAQLAALHDRLAALPNLPADDVPDGEDEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +   G   S      EH +   ALG +DF+ A K+SGARF+ L G +A LERALGQ
Sbjct: 121 GNVELSRWGTPRSFDFTPLEHADFAPALG-LDFETAAKMSGARFAFLKGPMARLERALGQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D  T E GYTE + PLLVRD+A +GT Q+PKF +D+F TTDG WLI TSE+SLTN  
Sbjct: 180 FMLDRQTIEAGYTECATPLLVRDDAAFGTTQLPKFREDLFQTTDGLWLISTSEMSLTNAV 239

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             +I+    LP+R T L P FRSEAGSAGRDTRG +RQHQFWK ELVSITR EDS  E E
Sbjct: 240 REQILAEADLPIRMTALTPCFRSEAGSAGRDTRGYIRQHQFWKVELVSITRPEDSDAELE 299

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           R    AE IL+ L+L YR + LC GD+GF+A KTYDLEVWL GQN YREISSCS CG+FQ
Sbjct: 300 RKTRAAESILEALELPYRKMLLCAGDMGFAARKTYDLEVWLPGQNAYREISSCSNCGDFQ 359

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R+R    K  +F HTLNGSG+AVGR L+AILENY  ADGSV IP  L PYM  +
Sbjct: 360 ARRMNARFRREGGKGNEFVHTLNGSGLAVGRTLVAILENYQQADGSVDIPAALLPYMGGI 419

Query: 421 AVIKK 425
             +  
Sbjct: 420 TRLTP 424


>gi|156934612|ref|YP_001438528.1| seryl-tRNA synthetase [Cronobacter sakazakii ATCC BAA-894]
 gi|166221438|sp|A7MER7|SYS_ENTS8 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|156532866|gb|ABU77692.1| hypothetical protein ESA_02446 [Cronobacter sakazakii ATCC BAA-894]
          Length = 430

 Score =  446 bits (1148), Expect = e-123,   Method: Composition-based stats.
 Identities = 202/431 (46%), Positives = 273/431 (63%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + +++L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRTEPDAVAEKLARRGFKLDVDKLVALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   +PN+P +EVP+G   +
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKNELDALLAEIRDIALTLPNLPDDEVPLGKDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +   G         R+H  +GE LG +DF  A KL+G+RF V+ G +A L RAL Q
Sbjct: 119 ENVEVSRWGTPRKFDFEIRDHVTLGETLGGLDFASAVKLTGSRFVVMKGQIARLHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT EHGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEEHGYSENYVPYLVNHDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+ +SLP++ T   P FRSEAGS GRDTRG++R HQF K E+V + R 
Sbjct: 239 EVPLTNLVRDEIIDEESLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQVVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR V LC+GD+GF A KTYDLEVWL  Q+ YREISS
Sbjct: 299 EDSMQALEEMTGHAEKVLQLLGLPYRKVLLCSGDMGFGARKTYDLEVWLPAQDTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A+LENY  ADG + IP V
Sbjct: 359 CSNMWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVLENYQQADGRIEIPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMKGLEFI 429


>gi|206577361|ref|YP_002239454.1| seryl-tRNA synthetase [Klebsiella pneumoniae 342]
 gi|238065104|sp|B5XY99|SYS_KLEP3 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|206566419|gb|ACI08195.1| seryl-tRNA synthetase [Klebsiella pneumoniae 342]
          Length = 430

 Score =  446 bits (1148), Expect = e-123,   Method: Composition-based stats.
 Identities = 202/431 (46%), Positives = 272/431 (63%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRTEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVQTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L EQL   + E   + + ++ +   IPN+P ++VP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEQLDAAKSELETLLAEIRDIALAIPNIPHDDVPVGRDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE  G +DF  A KL+G+RF V+ G LA L RAL Q
Sbjct: 119 DNVEVSRWGTPRQFDFEVRDHVTLGEMHGGLDFAAAVKLTGSRFVVMKGQLARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR V+LCTGD+GFSACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMVALEEMTGHAEKVLQLLGLPYRKVALCTGDMGFSACKTYDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + IP +
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVALMENYQQADGRIEIPEI 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMRGLEYI 429


>gi|222148967|ref|YP_002549924.1| seryl-tRNA synthetase [Agrobacterium vitis S4]
 gi|254782999|sp|B9JXD8|SYS_AGRVS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|221735953|gb|ACM36916.1| seryl-tRNA synthetase [Agrobacterium vitis S4]
          Length = 427

 Score =  446 bits (1148), Expect = e-123,   Method: Composition-based stats.
 Identities = 275/425 (64%), Positives = 346/425 (81%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR  EP S+ +++LDE+ R +++ ++D+++RRNS S +IG 
Sbjct: 1   MLDIKWIRENPELLDQALAKRGAEPLSQSLIALDEQRRAVVQDMQDMQSRRNSASKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ +++L + LK E ++LK+ LP  E++E  + + L   +S IPN+PL++VP+G   +
Sbjct: 61  AMAQKDMALAEKLKAEVASLKDTLPAAEEDERRLSAELTDALSRIPNIPLDDVPVGADEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N++ R VG+KP   H + EH EIGEALG MDFDRA KLSGARF+VLTG LA LERALGQ
Sbjct: 121 DNVVARVVGQKPGWNHTAIEHPEIGEALGYMDFDRAAKLSGARFTVLTGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMIDLHTSEHGYTEVS+PL+VRDEAMYGTGQ+PKF++++F TTDGRWLIPT+EV+LTNL 
Sbjct: 181 FMIDLHTSEHGYTEVSSPLMVRDEAMYGTGQLPKFSEELFKTTDGRWLIPTAEVTLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           S EI++ + LPLRFT L PSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT  + +  EHE
Sbjct: 241 SGEILDQEKLPLRFTALTPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITDAQSALAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL LH+R ++LCTGD+GF A KTYDLEVWL GQN +REISSCS CG+FQ
Sbjct: 301 RMTACAEEVLKRLGLHFRTMTLCTGDMGFGAAKTYDLEVWLPGQNTFREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR+ + K   F HTLNGSG AVGRCLIA++ENYLN DGS+T+P VL PYM  L
Sbjct: 361 GRRMNARYRNKDGKGTTFVHTLNGSGTAVGRCLIAVMENYLNEDGSITVPDVLLPYMGGL 420

Query: 421 AVIKK 425
             I+K
Sbjct: 421 TRIEK 425


>gi|294011256|ref|YP_003544716.1| seryl-tRNA synthetase [Sphingobium japonicum UT26S]
 gi|292674586|dbj|BAI96104.1| seryl-tRNA synthetase [Sphingobium japonicum UT26S]
          Length = 425

 Score =  446 bits (1148), Expect = e-123,   Method: Composition-based stats.
 Identities = 226/424 (53%), Positives = 302/424 (71%), Gaps = 1/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+++R+NP   D  L +R LEP S  +L+LDE++R +   ++  +ARRN  S  IGQ
Sbjct: 1   MHDIRFLRENPAAFDAGLARRGLEPLSAELLALDERSRAIKTALQQGQARRNEASKAIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ +++  +ALK E + LKE+LP LE E+ E+  +L   ++ IPN+P ++VP G    
Sbjct: 61  AMAQKDMATAEALKAEVAALKEKLPALEAEDREIGEALAARLAAIPNLPADDVPPGEDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G+  S     ++H + G ALG +DF+    LSGARF+ L G +A L RAL Q
Sbjct: 121 QNVEVARWGEPRSFPFTPQDHADFGPALG-LDFEGGAALSGARFTALRGQMARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D  + E+GY EV+ PLLV+DEA++GTGQ+PKFA+D+F TTDGRWLIPT+EVSLTNL 
Sbjct: 180 FMLDRQSRENGYEEVNPPLLVKDEALFGTGQLPKFAEDLFRTTDGRWLIPTAEVSLTNLV 239

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             +I+ ++SLPLR T L P FRSEAGSAGRDTRG +RQHQF K ELV+I + E+S  EHE
Sbjct: 240 REQIVPTESLPLRLTALTPCFRSEAGSAGRDTRGFIRQHQFEKVELVAICKPEESEAEHE 299

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM + AE +L+ L L YR + LCTGD+GF A KT+DLEVWL  Q  YREISS S CG+FQ
Sbjct: 300 RMCAAAEGVLQALGLPYRKMLLCTGDMGFGARKTWDLEVWLPSQQTYREISSVSNCGDFQ 359

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RY+    K  +F HTLNGSG+AVGR L+A+LENY   DGSV +P VL PYM  L
Sbjct: 360 ARRMNARYKPEGEKQTRFLHTLNGSGLAVGRTLVAVLENYQQEDGSVIVPEVLAPYMGGL 419

Query: 421 AVIK 424
             ++
Sbjct: 420 TRLR 423


>gi|288936304|ref|YP_003440363.1| seryl-tRNA synthetase [Klebsiella variicola At-22]
 gi|290510641|ref|ZP_06550011.1| seryl-tRNA synthetase [Klebsiella sp. 1_1_55]
 gi|288891013|gb|ADC59331.1| seryl-tRNA synthetase [Klebsiella variicola At-22]
 gi|289777357|gb|EFD85355.1| seryl-tRNA synthetase [Klebsiella sp. 1_1_55]
          Length = 430

 Score =  446 bits (1147), Expect = e-123,   Method: Composition-based stats.
 Identities = 202/431 (46%), Positives = 272/431 (63%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRTEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVQTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L EQL   + E   + + ++ +   IPN+P ++VP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEQLDAAKSELETLLAEIRDIALAIPNIPHDDVPVGRDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE  G +DF  A KL+G+RF V+ G LA L RAL Q
Sbjct: 119 DNVEVSRWGTPRQFDFEVRDHVTLGEMHGGLDFAAAVKLTGSRFVVMKGQLARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR V+LCTGD+GFSACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKVALCTGDMGFSACKTYDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + IP +
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVALMENYQQADGRIEIPEI 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMRGLEYI 429


>gi|222085788|ref|YP_002544318.1| seryl-tRNA synthetase (serine-tRNA ligase) protein [Agrobacterium
           radiobacter K84]
 gi|254782998|sp|B9JEH1|SYS_AGRRK RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|221723236|gb|ACM26392.1| seryl-tRNA synthetase (serine-tRNA ligase) protein [Agrobacterium
           radiobacter K84]
          Length = 427

 Score =  446 bits (1147), Expect = e-123,   Method: Composition-based stats.
 Identities = 272/425 (64%), Positives = 336/425 (79%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+N E LD AL KR  EP S+ +++LDEK R +I+ ++D+++RRN+ S +IG 
Sbjct: 1   MLDIKWIRENAEVLDAALAKRGAEPLSQGLIALDEKRRSIIQSVQDMQSRRNAASKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ N  L + LK E + +K  LP  E+EE  + + L   +S IPN+PL++VP+G   +
Sbjct: 61  AMAQKNTELAEKLKGEVADIKTSLPAAEEEERVLTAELNDALSRIPNIPLDDVPVGKDEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N++  S G KP+  H  +EH+EIGE LG MDF+RA KLSG+RF+VLT  LA LERALGQ
Sbjct: 121 DNVVKHSWGAKPAWNHKPKEHYEIGEELGYMDFERAAKLSGSRFTVLTSQLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHTSEHGYTEVS+PL+VRDEAM+GTGQ+PKFA+D F TT G WLIPT+EV+LTNL 
Sbjct: 181 FMLDLHTSEHGYTEVSSPLMVRDEAMFGTGQLPKFAEDSFRTTGGHWLIPTAEVTLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           S +I++ + LPLRFT L PSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT  E S  EHE
Sbjct: 241 SGDILDQEKLPLRFTALTPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITDAESSIAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL LHYRV++L TGD+GF A KTYDLEVWL GQ+ YREISSCS CG+FQ
Sbjct: 301 RMTACAEEVLKRLGLHYRVMTLSTGDMGFGARKTYDLEVWLPGQDTYREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR  + K  KF HTLNGSG AVGRCLIA+LENYLN DGSVT+P  L PYM  L
Sbjct: 361 ARRMNARYRGKDDKGTKFVHTLNGSGTAVGRCLIAVLENYLNDDGSVTVPDALLPYMGGL 420

Query: 421 AVIKK 425
             I++
Sbjct: 421 KRIER 425


>gi|307294312|ref|ZP_07574156.1| seryl-tRNA synthetase [Sphingobium chlorophenolicum L-1]
 gi|306880463|gb|EFN11680.1| seryl-tRNA synthetase [Sphingobium chlorophenolicum L-1]
          Length = 425

 Score =  446 bits (1147), Expect = e-123,   Method: Composition-based stats.
 Identities = 223/426 (52%), Positives = 298/426 (69%), Gaps = 1/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+++R+NP   D  L +R LEP S  +L+LDE++R +   ++  +ARRN  S  IGQ
Sbjct: 1   MHDIRFLRENPAAFDAGLARRGLEPLSAELLALDERSRAIKTALQQGQARRNEASKAIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ +++  +ALK E + LK+ +P LE E+ EV  +L   ++ +PN+P ++VP G    
Sbjct: 61  AMAQKDMATAEALKAEVAALKDSMPALEAEDREVGEALNARLAAVPNLPADDVPPGEDEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G+  S     ++H + G ALG +DF+    LSGARF+ L G +A L RAL Q
Sbjct: 121 QNVEVARWGEPRSFPFTPQDHADFGPALG-LDFEGGAALSGARFTALRGQMARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D  + E+GY EV+ PLLV+D+A++GTGQ+PKFA+D+F TTDGRWLIPT+EVSLTNL 
Sbjct: 180 FMLDRQSGENGYEEVNPPLLVKDDALFGTGQLPKFAEDLFRTTDGRWLIPTAEVSLTNLV 239

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
              I+   SLPLR T L P FRSEAGSAGRDTRG +RQHQF K ELV+I + E+S  EHE
Sbjct: 240 RERIVPVDSLPLRLTALTPCFRSEAGSAGRDTRGFIRQHQFEKVELVAICKPEESEAEHE 299

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM + AE +L+ L L YR + LCTGD+GF A KT+DLEVWL  Q  YREISS S CG+FQ
Sbjct: 300 RMCAAAEGVLQALGLPYRKMLLCTGDMGFGARKTWDLEVWLPSQQTYREISSVSNCGDFQ 359

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RY+    K+ +F HTLNGSG+AVGR L+A+LENY   DGSV +P VL PYM  L
Sbjct: 360 ARRMNARYKPEGEKNTRFLHTLNGSGLAVGRTLVAVLENYQQEDGSVIVPEVLAPYMGGL 419

Query: 421 AVIKKE 426
             +   
Sbjct: 420 TRLSPR 425


>gi|23014252|ref|ZP_00054079.1| COG0172: Seryl-tRNA synthetase [Magnetospirillum magnetotacticum
           MS-1]
          Length = 422

 Score =  446 bits (1147), Expect = e-123,   Method: Composition-based stats.
 Identities = 227/420 (54%), Positives = 294/420 (70%), Gaps = 2/420 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M D++ IR NPE  D  L +R LEP++  IL LD + R      ++++ARRN  S QIG 
Sbjct: 1   MHDLKSIRDNPEGFDAGLARRGLEPKAAAILDLDTRRRAAQTAFQEMQARRNEASKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G      AL +E +++KE++P  E+E+  + + ++ +++ IPN+P  +VP G    
Sbjct: 61  LKKSGG--DASALMDEVASMKERMPASEEEDRLLGAEIEDILASIPNLPAADVPDGPDEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G        + +H  IG  LGLMDFD A KLSGARF VL G LA L+RA+GQ
Sbjct: 119 HNVEVRKWGAPKEFAFTALDHDAIGAKLGLMDFDGAAKLSGARFVVLKGQLARLQRAIGQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DL T+EHGYTE+  PL+V+D A +GTGQ+PKF++D+F T  G WLIPT+EV LTNL 
Sbjct: 179 FMLDLQTTEHGYTEMDPPLMVKDGAAFGTGQLPKFSEDLFKTNTGHWLIPTAEVPLTNLV 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           S EI++ KSLPLR T L P FRSEAGSAG+DTRGM+RQHQF K E+VSI   + S  EHE
Sbjct: 239 SDEILDEKSLPLRMTALTPCFRSEAGSAGKDTRGMIRQHQFHKVEMVSIAHPDKSDEEHE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE +L+RL L YRV+ LCTGD+GFS+ KTYD+EVWL GQ  YREISSCS CG+FQ
Sbjct: 299 RMTKCAETVLQRLGLAYRVIVLCTGDMGFSSRKTYDIEVWLPGQQRYREISSCSNCGDFQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM +R+R    K  +F HTLNGSG+AVGR LIA++ENY   DG++ +P VLRPYM  L
Sbjct: 359 ARRMKARFRPEGEKGTRFVHTLNGSGLAVGRTLIAVMENYQREDGTIEVPEVLRPYMGGL 418


>gi|323137658|ref|ZP_08072734.1| seryl-tRNA synthetase [Methylocystis sp. ATCC 49242]
 gi|322396955|gb|EFX99480.1| seryl-tRNA synthetase [Methylocystis sp. ATCC 49242]
          Length = 427

 Score =  446 bits (1146), Expect = e-123,   Method: Composition-based stats.
 Identities = 235/425 (55%), Positives = 293/425 (68%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+WIR+N E  D   K+R LEP S  +L+ D+  R  I +++  + RRN+ S +IG 
Sbjct: 1   MYDIKWIRENAELFDNGRKRRGLEPLSAQLLAFDDARRAAIAQLQVAQERRNAASREIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+  G+ +  +ALK E + +KE  P LE+ E    + L   ++ IPN PL+ VP G   N
Sbjct: 61  AMKAGDSAKAEALKAEVAQIKENWPALEEAERYAVAELDAALAAIPNTPLDAVPDGADEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G+        +EHFEIGE LGLMDF+ A KLSGARF V  G LA LERAL Q
Sbjct: 121 DNVEVSRWGEPRKFDFAPKEHFEIGEGLGLMDFETAAKLSGARFVVNKGPLARLERALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT  HGY EV+ PLLVRD+AM+GT Q+PKF +D F   DG WLIPT+EV LTNL 
Sbjct: 181 FMLDLHTGAHGYVEVNPPLLVRDDAMFGTAQLPKFREDQFAAGDGYWLIPTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
              I++   LP+R T     FR+EAG+AG+DTRGM+RQHQF+K ELVSIT  E S  EHE
Sbjct: 241 RESILDETQLPIRMTAGTYCFRAEAGAAGKDTRGMIRQHQFYKVELVSITTPEQSLEEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE +L+ L L YR V LCTGD+GF++ KTYDLEVWL GQ  YREISSCS CG+FQ
Sbjct: 301 RMTGCAERVLQTLGLPYRKVVLCTGDMGFASQKTYDLEVWLPGQGKYREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM +RYR   SK  +F HTLNGSGVAVGR ++A+LENY  ADGSVTIP  LRPYM  +
Sbjct: 361 ARRMGARYRPAESKGPRFVHTLNGSGVAVGRAMVAVLENYQEADGSVTIPQALRPYMGGM 420

Query: 421 AVIKK 425
             I +
Sbjct: 421 ERIAR 425


>gi|302336512|ref|YP_003801719.1| seryl-tRNA synthetase [Olsenella uli DSM 7084]
 gi|301320352|gb|ADK68839.1| seryl-tRNA synthetase [Olsenella uli DSM 7084]
          Length = 428

 Score =  446 bits (1146), Expect = e-123,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 280/427 (65%), Gaps = 3/427 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKR-HLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+++R++P+ +D +   R +     E    LDE+ R +I ++E ++A RN+ S Q+G
Sbjct: 1   MLDIKFVREHPDAVDESCASRQNAHWDRERFFDLDEERRSVIVEVEKLQAERNAISKQVG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           Q + EG     ++ K + S  K ++  LE+    V   L  L+S IPN+P   VP G   
Sbjct: 61  QLMREGKRDEAESAKAQVSANKSRIAGLEERRGVVEKELLDLLSAIPNIPDSSVPYGKDD 120

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N  +R+ G+        + H+++G A G++DFDR  KL+G+RF +L G  A +ERAL 
Sbjct: 121 SDNPEVRAWGEPRRFGFDPKAHWDLGPATGMIDFDRGVKLAGSRFYLLGGMGARMERALI 180

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNL 239
            F ID+H    G+ E   P++   ++++GTGQ+PKF +D+F  + G +LIPT+EV LTN+
Sbjct: 181 NFFIDMHV-RAGFKEWWPPVITNYDSLFGTGQLPKFDEDLFHVSGGMYLIPTAEVMLTNI 239

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +  E +++  LPL +T   P FR EAGSAGRDTRG++R H+F K E+V   + EDS ++ 
Sbjct: 240 HRDETLDASQLPLLYTAFTPCFREEAGSAGRDTRGIIRVHEFDKVEMVKFAKPEDSMSQL 299

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E M++ AE  LK L L Y VV+LCTGD+GFSACK YD+EVWL   N Y+EISSCS CG+F
Sbjct: 300 ESMVAEAELCLKTLGLPYHVVTLCTGDIGFSACKCYDIEVWLPSYNSYKEISSCSNCGDF 359

Query: 360 QSRRMNSRYRDPNS-KSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           Q+RR N +YRDP+  K  ++ HTLNGSG+AVGR + AI+EN  NADGS+T+P  L PYM 
Sbjct: 360 QARRANIKYRDPSEFKGARYVHTLNGSGLAVGRTMAAIMENCQNADGSITVPEALVPYMG 419

Query: 419 NLAVIKK 425
            + VI+ 
Sbjct: 420 GVDVIRP 426


>gi|261339231|ref|ZP_05967089.1| hypothetical protein ENTCAN_05465 [Enterobacter cancerogenus ATCC
           35316]
 gi|288319086|gb|EFC58024.1| serine--tRNA ligase [Enterobacter cancerogenus ATCC 35316]
          Length = 430

 Score =  446 bits (1146), Expect = e-123,   Method: Composition-based stats.
 Identities = 198/431 (45%), Positives = 272/431 (63%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVQTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P + VP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDQAKAELDVLLAEIRDIALAIPNIPDDSVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ ++  G         R+H  +GE    +DF  A KL+G+RF V+ G +AHL RAL Q
Sbjct: 119 DNVEVKRWGTPREFDFEVRDHVTLGEMHAGLDFAAAVKLTGSRFVVMKGQIAHLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSETYVPYLVNHDTLYGTGQLPKFAGDLFHTRPLDEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T  +P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIIDEDDLPIKLTAHSPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR ++LCTGD+GF ACKT+DLEVW+  QN YREISS
Sbjct: 299 EDSMDALEEMTGHAEKVLELLGLPYRRMALCTGDMGFGACKTFDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R+ + K  +  HTLNGSG+AVGR L+A+LENY  ADG + IP V
Sbjct: 359 CSNVWDFQARRMQARCRNKSDKKTRLVHTLNGSGLAVGRTLVAVLENYQQADGRIEIPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM     I
Sbjct: 419 LRPYMKGQQFI 429


>gi|302388768|ref|YP_003824589.1| seryl-tRNA synthetase [Thermosediminibacter oceani DSM 16646]
 gi|302199396|gb|ADL06966.1| seryl-tRNA synthetase [Thermosediminibacter oceani DSM 16646]
          Length = 426

 Score =  446 bits (1146), Expect = e-123,   Method: Composition-based stats.
 Identities = 196/428 (45%), Positives = 282/428 (65%), Gaps = 4/428 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+ IR NP+ +  AL+KR  +   E  L LDE+ R L+ ++E +++ RN  S +I +
Sbjct: 1   MLDIKMIRSNPDEVKRALEKRGTQANLEEFLKLDEERRNLLVEVEQLKSLRNRESEEIAR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G  +  D L  +   + +++  ++++  E+   L++++  IPN+P E VP+G S  
Sbjct: 61  RKKQGEPA--DDLIRQMREVSDRIKEMDEKVKEIEEKLEQILLMIPNIPDESVPVGESDA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G+        + H+E+GEAL ++DF+RA+K++G+RF V  G  A LERAL  
Sbjct: 119 DNVEMRRWGEPRKFDFEPKPHWELGEALDILDFERASKITGSRFVVYKGAGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF--CTTDGRWLIPTSEVSLTN 238
           FM+DLH  +HGY E+  P +V   +M GTGQ+PKF ++ F        +LIPT+EV +TN
Sbjct: 179 FMLDLHIEKHGYKEIFPPFIVNRASMTGTGQLPKFEEEAFKLFNNTDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L+++EI+E + LP+ +   +  FR+EAGSAGRDTRG++RQHQF K ELV  T  E S  E
Sbjct: 239 LHANEILEKEDLPIYYVAYSGCFRAEAGSAGRDTRGIIRQHQFNKVELVKFTEPEKSMEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++ + AEE+L+ L L YRVV+LCTGDLGF++ KTYD+EVW+   N Y EISSCS   +
Sbjct: 299 LEKLTADAEEVLQLLGLPYRVVALCTGDLGFASSKTYDIEVWMPSYNRYVEISSCSNFKD 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           +Q+RR N RYR       ++ HTLNGSG+AVGR   AILENY   DGSV IP VLRPYM 
Sbjct: 359 YQARRANIRYRPEKGAKPQYVHTLNGSGLAVGRTTAAILENYQQPDGSVVIPEVLRPYMG 418

Query: 419 NLAVIKKE 426
            + VI K+
Sbjct: 419 GMEVIAKK 426


>gi|144899900|emb|CAM76764.1| Seryl-tRNA synthetase [Magnetospirillum gryphiswaldense MSR-1]
          Length = 420

 Score =  446 bits (1146), Expect = e-123,   Method: Composition-based stats.
 Identities = 221/423 (52%), Positives = 294/423 (69%), Gaps = 4/423 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M D++WIR+NP+  D  L +R L+P+S  ++ LD + R    ++++++A RN  S QIG 
Sbjct: 1   MHDLKWIRENPDAFDAGLARRGLDPRSAALIRLDGERRAAQTRLQELQASRNETSKQIGI 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G    V A+ +E + LKE +P+LE +E  +   +  +++ IPN+P  +VP G    
Sbjct: 61  IKKQGG--DVSAIMDEIAKLKEDIPLLEAQEKSLSEEIDGILAAIPNLPGADVPDGPDEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ IR  G+  +      EH  IG  LGLMDFD A KLSGARF VL G LA LERAL Q
Sbjct: 119 HNVEIRRWGQPGAFDFQPLEHDAIGAKLGLMDFDGAAKLSGARFVVLKGKLARLERALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D+ T +HGYTE+S P LV+D A++GTGQ+PKF DD+F T  G WLIPT+EV LTNL 
Sbjct: 179 FMLDVQTEQHGYTEISPPTLVKDGALFGTGQLPKFGDDLFKTNTGHWLIPTAEVPLTNLV 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
              I++  +LP+R T L   +RSEAG+AG+DTRGM+RQHQFWK E+VSI   + S  EH+
Sbjct: 239 GDSIVDEAALPIRMTALTLCYRSEAGAAGKDTRGMIRQHQFWKVEMVSIAHPDQSEAEHQ 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAE IL++L+L YR + LCTGD+GFS+ KTYD+EVWL GQ  YREISSCS CG+FQ
Sbjct: 299 RMTACAETILQKLELPYRTIVLCTGDMGFSSQKTYDIEVWLPGQGRYREISSCSNCGDFQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM +R++       +F HTLNGSG+AVGR L+A+LENY  ADGSV +P  L+PYM  L
Sbjct: 359 ARRMKARFKGDKGN--RFVHTLNGSGLAVGRTLVAVLENYQQADGSVRVPEALKPYMGGL 416

Query: 421 AVI 423
            VI
Sbjct: 417 EVI 419


>gi|256830391|ref|YP_003159119.1| seryl-tRNA synthetase [Desulfomicrobium baculatum DSM 4028]
 gi|256579567|gb|ACU90703.1| seryl-tRNA synthetase [Desulfomicrobium baculatum DSM 4028]
          Length = 427

 Score =  446 bits (1146), Expect = e-123,   Method: Composition-based stats.
 Identities = 197/425 (46%), Positives = 278/425 (65%), Gaps = 3/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI++IR NP+ +   L+KR  +   E  L++D+K R L+ ++ED++ARRN  S ++ +
Sbjct: 1   MLDIKFIRSNPDEVKDGLRKRRSKLDLEQFLAIDQKRRDLLLEVEDLKARRNQASGEMAR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G     DAL  E   +  ++  L++E  ++       +  IPNVP   VP G    
Sbjct: 61  MKKAG--ENADALLLELGGMSTRIKALDEELKDIDQQTADWVMSIPNVPHSSVPEGVDEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N  +RS G+KP+     +EH+E+G AL  +DF+ A K++G+RF +L G  A +ERAL  
Sbjct: 119 DNREVRSWGEKPAMPFSPKEHWELGTALNGLDFETAAKITGSRFVILKGWAAKMERALIS 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-TTDGRWLIPTSEVSLTNL 239
           FM+D+ T ++GY EV  P++V  E++ GTGQ+PKF +D+F       +LIPT+EV +TN+
Sbjct: 179 FMLDVQTMQNGYDEVMPPVIVNRESLMGTGQLPKFEEDLFHLENTNYYLIPTAEVPVTNI 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y    +   +LP+        FRSEAGS G+DT+GM+RQHQF K ELV     + S+ E 
Sbjct: 239 YRDTTLAQSALPIAHCAYTACFRSEAGSYGKDTKGMIRQHQFDKVELVRFVHPDTSYDEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++L  AE IL++L LHYRVV+LC GDLGFS+ KTYD+EVWL GQ+ YREISSCS   +F
Sbjct: 299 EKLLGHAESILQKLGLHYRVVTLCAGDLGFSSAKTYDIEVWLPGQDKYREISSCSNFEDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR   R++  +SK  +  HTLNGSG+AVGR ++AILENY  ADGSV +P VLRPYMN 
Sbjct: 359 QARRAGIRFKPTDSKKSRLVHTLNGSGLAVGRTMVAILENYQQADGSVIVPEVLRPYMNG 418

Query: 420 LAVIK 424
           L  I+
Sbjct: 419 LDKIE 423


>gi|262274498|ref|ZP_06052309.1| seryl-tRNA synthetase [Grimontia hollisae CIP 101886]
 gi|262221061|gb|EEY72375.1| seryl-tRNA synthetase [Grimontia hollisae CIP 101886]
          Length = 428

 Score =  446 bits (1146), Expect = e-123,   Method: Composition-based stats.
 Identities = 193/429 (44%), Positives = 265/429 (61%), Gaps = 8/429 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   +     L +R  +   + + +L+EK + L  + E+++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRTELDATAEKLARRGFKLDVDTLRNLEEKRKSLQVRTEELQAERNARSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G    +  L      L ++L   + E  E+   L  +I  +PN+  + VP+G    
Sbjct: 61  AKAKG--EDIQPLLAAVENLGDELDKAKAELAELQEQLNSIIMGVPNIADDSVPVGKDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ I   G+  +     ++H ++GE  G +DF  A KLSG+RF V+ G +A L RA+ Q
Sbjct: 119 ENVEISVWGEPKTYDFEVKDHVDLGELTGGLDFASAVKLSGSRFIVMKGQMARLHRAIAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG------RWLIPTSEV 234
           FM+DLHT+EHGYTE+  P LV  ++++GTGQ+PKF +D+F T           LIPT+EV
Sbjct: 179 FMLDLHTTEHGYTEMYVPYLVNADSLFGTGQLPKFGEDLFHTKPATEEGVGMSLIPTAEV 238

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            LTN+    I+E   LP+R T   P FRSEAGS GRDTRG++R HQF K ELV I + ED
Sbjct: 239 PLTNMVRDTIVEEADLPIRMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQIVKPED 298

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCS 354
           S    E +   AE++L+ L L YR V LCTGD+GF + KTYDLEVW+  Q  YREISSCS
Sbjct: 299 SMAALEELTGHAEKVLQLLKLPYRKVILCTGDMGFGSAKTYDLEVWVPAQGTYREISSCS 358

Query: 355 TCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR 414
              +FQ+RRM +R+R    K  +  HTLNGSG+AVGR ++AILENY  ADG + +P VLR
Sbjct: 359 NMTDFQARRMQARFRRKGEKKPELLHTLNGSGLAVGRTMVAILENYQLADGRIEVPEVLR 418

Query: 415 PYMNNLAVI 423
           PYM  L  I
Sbjct: 419 PYMGGLTHI 427


>gi|295096401|emb|CBK85491.1| seryl-tRNA synthetase [Enterobacter cloacae subsp. cloacae NCTC
           9394]
          Length = 430

 Score =  446 bits (1146), Expect = e-123,   Method: Composition-based stats.
 Identities = 197/431 (45%), Positives = 271/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVQTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P + VP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDQAKAELDVLQAEIRDIALAIPNIPDDSVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ ++  G         R+H  +GE    +DF  A KL+G+RF V+ G +AHL RAL Q
Sbjct: 119 DNVEVKRWGTPREFDFEVRDHVTLGEMHAGLDFAAAVKLTGSRFVVMKGQIAHLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSETYVPYLVNHDTLYGTGQLPKFAGDLFHTRPLDEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T  +P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIIDEDDLPIKLTAHSPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E+S    E M   AE++L+ L L YR ++LCTGD+GF ACKT+DLEVW+  QN YREISS
Sbjct: 299 EESMDALEEMTGHAEKVLELLGLPYRRMALCTGDMGFGACKTFDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A+LENY  ADG + IP V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVLENYQQADGRIEIPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM     I
Sbjct: 419 LRPYMKGQQFI 429


>gi|209549091|ref|YP_002281008.1| seryl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|238065105|sp|B5ZMG0|SYS_RHILW RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|209534847|gb|ACI54782.1| seryl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 427

 Score =  446 bits (1146), Expect = e-123,   Method: Composition-based stats.
 Identities = 269/425 (63%), Positives = 339/425 (79%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR  EP ++ +++LDEK R  ++K +D+ +RRN  S +IG 
Sbjct: 1   MLDIKWIRENPEALDAALAKRGAEPLAQNLVALDEKRRSAVQKAQDLLSRRNLASKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+++ N  L + LK E + LK  LP +E+E+ ++ + L   +S IPN+P ++VP+G   +
Sbjct: 61  ALSQKNGELAEKLKVEVAELKAMLPAVEEEDRQLTAELNDALSRIPNIPFDDVPVGKDEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N++ R+VG+KP   H  +EHFEIGEALG MDF+RA KLSG+RF+VLTG LA LERALGQ
Sbjct: 121 DNVVTRTVGEKPRWNHTPKEHFEIGEALGYMDFERAAKLSGSRFTVLTGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMIDLHT EHGYTEVS+PL+VR EA++GTG +PKF +D+F TTDGR+LIPT+EV+LTNL 
Sbjct: 181 FMIDLHTREHGYTEVSSPLMVRAEALFGTGNLPKFEEDLFKTTDGRYLIPTAEVTLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ + LPLRFT L PSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT  E +  EHE
Sbjct: 241 REEILDQEKLPLRFTALTPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITDAESAVAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAE++LKRL LH+R ++LCTGD+GF + KTYDLEVWL GQN +REISSCS CG+FQ
Sbjct: 301 RMTACAEDVLKRLGLHFRTMTLCTGDMGFGSRKTYDLEVWLPGQNAFREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR  + KS +F HTLNGSG AVGRCLIA+LENYLN DGSVTIP VL PYM  L
Sbjct: 361 ARRMNARYRGKDDKSNRFVHTLNGSGTAVGRCLIAVLENYLNEDGSVTIPDVLLPYMGGL 420

Query: 421 AVIKK 425
             I++
Sbjct: 421 TKIER 425


>gi|294789503|ref|ZP_06754739.1| serine--tRNA ligase [Simonsiella muelleri ATCC 29453]
 gi|294482583|gb|EFG30274.1| serine--tRNA ligase [Simonsiella muelleri ATCC 29453]
          Length = 430

 Score =  445 bits (1145), Expect = e-123,   Method: Composition-based stats.
 Identities = 201/432 (46%), Positives = 285/432 (65%), Gaps = 9/432 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R + E +   L  R  E  +     LD + ++L  + E ++A+RN  S QIG 
Sbjct: 1   MLDIQLLRNDIEAVAQRLAARGFELDTTKFEQLDAQRKLLQTENEQLQAKRNQLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            + +G     DA KNE + +K Q+  +E++   + ++L  L+  +PN+P E VPIG    
Sbjct: 61  FMGQGKKDEADAAKNEVAQIKSQMDKIEQDLPNIQAALDDLLLRVPNLPHESVPIGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++G ALG +DF++A +LSGARFS++ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPRQFDFDIKDHVDLGAALG-LDFEKAAQLSGARFSLMKGKVARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM+D HT++HGYTE   P +V D  + GTGQ+PKF +D+F  T         ++LIPT+E
Sbjct: 180 FMLDTHTTQHGYTECYTPYIVSDSTLLGTGQLPKFGEDLFHVTRGGDETKLTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN    E++    LP++ T  +P FRSEAGS G+DTRG++RQHQF K E+V I + E
Sbjct: 240 VTLTNTVRDEVLSPHDLPMKLTAHSPCFRSEAGSHGKDTRGLIRQHQFDKVEMVQIVQPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYEALEEMVGHAENILKLLELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRALVAVLENHQNADGSINIPKAL 418

Query: 414 RPYMNNLAVIKK 425
           +PY+  +  ++ 
Sbjct: 419 QPYLGGVEKLEP 430


>gi|194435163|ref|ZP_03067396.1| seryl-tRNA synthetase [Shigella dysenteriae 1012]
 gi|194416601|gb|EDX32737.1| seryl-tRNA synthetase [Shigella dysenteriae 1012]
          Length = 430

 Score =  445 bits (1145), Expect = e-123,   Method: Composition-based stats.
 Identities = 199/431 (46%), Positives = 269/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQMPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R    K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKPDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|254780680|ref|YP_003065093.1| seryl-tRNA synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040357|gb|ACT57153.1| seryl-tRNA synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 430

 Score =  445 bits (1144), Expect = e-123,   Method: Composition-based stats.
 Identities = 430/430 (100%), Positives = 430/430 (100%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ
Sbjct: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN
Sbjct: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ
Sbjct: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY
Sbjct: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE
Sbjct: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ
Sbjct: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL
Sbjct: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420

Query: 421 AVIKKEHILE 430
           AVIKKEHILE
Sbjct: 421 AVIKKEHILE 430


>gi|332759807|gb|EGJ90110.1| seryl-tRNA synthetase [Shigella flexneri 4343-70]
          Length = 430

 Score =  445 bits (1144), Expect = e-123,   Method: Composition-based stats.
 Identities = 198/431 (45%), Positives = 269/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDTLQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++     P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMIAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|324019016|gb|EGB88235.1| seryl-tRNA synthetase [Escherichia coli MS 117-3]
          Length = 430

 Score =  445 bits (1144), Expect = e-123,   Method: Composition-based stats.
 Identities = 198/431 (45%), Positives = 269/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+   L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLRGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|332088847|gb|EGI93959.1| seryl-tRNA synthetase [Shigella boydii 5216-82]
          Length = 430

 Score =  445 bits (1144), Expect = e-123,   Method: Composition-based stats.
 Identities = 199/431 (46%), Positives = 269/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K     HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTCLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|83952360|ref|ZP_00961091.1| seryl-tRNA synthetase [Roseovarius nubinhibens ISM]
 gi|83836033|gb|EAP75331.1| seryl-tRNA synthetase [Roseovarius nubinhibens ISM]
          Length = 430

 Score =  445 bits (1144), Expect = e-123,   Method: Composition-based stats.
 Identities = 206/429 (48%), Positives = 280/429 (65%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP   D AL  R L+  S  IL+LDEK R LI   E  +A +N  S ++G 
Sbjct: 1   MHDIRAIRDNPAAFDAALALRGLDGASSQILALDEKRRALIHAAETAQAEQNRASKEVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+ +  + L+      K ++  ++ E  E+   L  L+  +PN+P ++VP G    
Sbjct: 61  AKAKGDEAEFERLRALVGEKKSEVAAMQAEAKELDQQLTDLLMGLPNLPFDDVPQGADEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I   G         +EH+E+   L  MDF+ A KLSG+RF VL+G +A + RAL Q
Sbjct: 121 DNVEIHRWGTPRVFDFTPKEHYELDGVLPGMDFETAAKLSGSRFVVLSGAVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMI+ H  E+G TE   P+LVR E MYGTGQ+PKF +D + TT+G WL+PT+EV+LTN+ 
Sbjct: 181 FMINTHIDENGLTETWTPVLVRPEMMYGTGQLPKFGEDSYETTNGWWLVPTAEVTLTNIV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           +   +E+  LP R+      FRSEAGSAGRDT GMLRQHQF K E+VS+T  ++S  E +
Sbjct: 241 NGLTVEADYLPRRYVAHTQCFRSEAGSAGRDTAGMLRQHQFEKVEMVSVTHPDESRAELD 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CA+ IL+RL L YR V LCTGD+GF A +T+D+EVWL GQ+ YREISS S CG+FQ
Sbjct: 301 RMTACAQGILERLGLPYRTVVLCTGDMGFGARRTHDIEVWLPGQDSYREISSVSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++  +    +F HTLNGSG+AVGRCLIA+LEN   ADGSV +P  L PY+   
Sbjct: 361 ARRMNARFKPADGGKPQFLHTLNGSGLAVGRCLIAVLENGQQADGSVALPEALHPYLGGK 420

Query: 421 AVIKKEHIL 429
            ++  +  L
Sbjct: 421 TILAADGTL 429


>gi|333006955|gb|EGK26450.1| seryl-tRNA synthetase [Shigella flexneri K-218]
          Length = 430

 Score =  445 bits (1144), Expect = e-123,   Method: Composition-based stats.
 Identities = 198/431 (45%), Positives = 269/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++     P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMIAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|294101987|ref|YP_003553845.1| seryl-tRNA synthetase [Aminobacterium colombiense DSM 12261]
 gi|293616967|gb|ADE57121.1| seryl-tRNA synthetase [Aminobacterium colombiense DSM 12261]
          Length = 423

 Score =  445 bits (1144), Expect = e-123,   Method: Composition-based stats.
 Identities = 201/425 (47%), Positives = 283/425 (66%), Gaps = 3/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           ML+I+WIR N E +   L  R+ +   + I+ LDE+ R L+ + E+++A+RN  S ++ +
Sbjct: 1   MLEIKWIRNNIEEVKAFLVNRNNDFDVDRIVILDEEKRSLLTETENLKAQRNEGSRKVAE 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G  + V  L  E   L + +   + +  E+   L+ L+  +PN P + VP+G   N
Sbjct: 61  AKASGQDADV--LMEEMKNLGQMVKEKDSKIAEIDQELQSLLLQMPNRPHDSVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G     +   + H++IGE LG++DF++   L+ +RF+VL G  A LERAL  
Sbjct: 119 DNMEVRKWGTPKEFVFEPQAHWDIGEKLGILDFEKGVSLAESRFTVLKGAGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGRWLIPTSEVSLTNL 239
           FM+DLHT  HGY E+  P +V  + M GTGQ+PKFA+D++ C  +  WLIPT+EV LTNL
Sbjct: 179 FMLDLHTEHHGYKEIQPPFMVSSQTMQGTGQLPKFAEDLYKCEGEDLWLIPTAEVPLTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +S EI+  + LPL +T   P FR EAGS GRD RGM+RQHQF K ELV I++ E+S+ E 
Sbjct: 239 HSGEILPEEVLPLYYTAYTPCFRKEAGSYGRDVRGMMRQHQFDKVELVKISKPENSYDEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++ + AEE+L++L L YRV++LCTGD+GF A KTYDLEVWL  Q+ YREISSCS C +F
Sbjct: 299 EKLTANAEEVLQKLGLPYRVITLCTGDMGFGASKTYDLEVWLPFQDKYREISSCSNCEDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RRM +RY+  +    ++ HTLNGSG+AVGR LIA+LENY   DGSV IP  L PYM  
Sbjct: 359 QARRMGTRYKPADGGRPRYVHTLNGSGIAVGRTLIAVLENYQREDGSVEIPEALVPYMGG 418

Query: 420 LAVIK 424
           +  I+
Sbjct: 419 MKEIR 423


>gi|190891515|ref|YP_001978057.1| seryl-tRNA synthetase [Rhizobium etli CIAT 652]
 gi|238692532|sp|B3PXU3|SYS_RHIE6 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|190696794|gb|ACE90879.1| seryl-tRNA synthetase protein [Rhizobium etli CIAT 652]
          Length = 427

 Score =  445 bits (1144), Expect = e-123,   Method: Composition-based stats.
 Identities = 270/425 (63%), Positives = 339/425 (79%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR  EPQ++ +++LDEK R  ++K +D+ +RRN  S +IG 
Sbjct: 1   MLDIKWIRENPEALDAALAKRGAEPQAQSLVALDEKRRSAVQKAQDMLSRRNLASKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ N  L + LK E + LK  LP +E+E+ ++ + L   +S IPN+P ++VP+G   +
Sbjct: 61  AMAQKNGELAEKLKAEVAELKTLLPAIEEEDRQLTAELNDALSRIPNIPFDDVPVGKDEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N++ R+VG+KP   H  +EHFEIGEALG MDF+RA KLSG+RF+VLTG LA LERALGQ
Sbjct: 121 DNVVTRTVGEKPRWNHTPKEHFEIGEALGYMDFERAAKLSGSRFTVLTGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMIDLHT EHGYTEVS+PL+VR EA++GTG +PKF +D+F TTD R+LIPT+EV+LTNL 
Sbjct: 181 FMIDLHTREHGYTEVSSPLMVRAEALFGTGNLPKFEEDLFKTTDDRYLIPTAEVTLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI+E + LPLRFT L PSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT  + +  EHE
Sbjct: 241 REEILEQEKLPLRFTALTPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITDADSAIAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL LH+R ++LCTGD+GF + KTYDLEVWL GQN +REISSCS CG+FQ
Sbjct: 301 RMTACAEEVLKRLGLHFRTMTLCTGDMGFGSRKTYDLEVWLPGQNAFREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR  + K+ +F HTLNGSG AVGRCLIA+LENYLN DGSVTIP VL PYM  L
Sbjct: 361 ARRMNARYRGKDDKTNRFVHTLNGSGTAVGRCLIAVLENYLNEDGSVTIPDVLLPYMGGL 420

Query: 421 AVIKK 425
             I++
Sbjct: 421 TKIER 425


>gi|327189128|gb|EGE56313.1| seryl-tRNA synthetase [Rhizobium etli CNPAF512]
          Length = 427

 Score =  444 bits (1143), Expect = e-123,   Method: Composition-based stats.
 Identities = 271/425 (63%), Positives = 339/425 (79%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR  EP ++ +++LDEK R  ++K +D+ +RRN  S +IG 
Sbjct: 1   MLDIKWIRENPEALDAALAKRGAEPLAQSLVALDEKRRSAVQKAQDMLSRRNLASKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ N  L + LK E + LK  LP +E+EE ++ + L   +S IPN+P ++VP+G   +
Sbjct: 61  AMAQRNGELAEKLKAEVAELKTLLPAIEEEERQLTAELNDALSRIPNIPFDDVPVGKDEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N++ R+VG+KP   H  +EHFEIGEALG MDF+RA KLSG+RF+VLTG LA LERALGQ
Sbjct: 121 DNVVTRTVGEKPRWNHTPKEHFEIGEALGYMDFERAAKLSGSRFTVLTGQLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMIDLHT EHGYTEVS+PL+VR EA++GTG +PKF +D+F TTDGR+LIPT+EV+LTNL 
Sbjct: 181 FMIDLHTREHGYTEVSSPLMVRAEALFGTGNLPKFEEDLFKTTDGRYLIPTAEVTLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ + LPLRFT L PSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT  E +  EHE
Sbjct: 241 REEILDQEKLPLRFTALTPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITDAESAIAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL LH+R ++LCTGD+GF + KTYDLEVWL GQN +REISSCS CG+FQ
Sbjct: 301 RMTACAEEVLKRLGLHFRTMTLCTGDMGFGSRKTYDLEVWLPGQNAFREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR  + K+ +F HTLNGSG AVGRCLIA+LENYLN DGSVTIP VL PYM  L
Sbjct: 361 ARRMNARYRGKDDKTNRFVHTLNGSGTAVGRCLIAVLENYLNEDGSVTIPDVLLPYMGGL 420

Query: 421 AVIKK 425
             I++
Sbjct: 421 TKIER 425


>gi|126461215|ref|YP_001042329.1| seryl-tRNA synthetase [Rhodobacter sphaeroides ATCC 17029]
 gi|126102879|gb|ABN75557.1| seryl-tRNA synthetase [Rhodobacter sphaeroides ATCC 17029]
          Length = 430

 Score =  444 bits (1143), Expect = e-123,   Method: Composition-based stats.
 Identities = 217/430 (50%), Positives = 279/430 (64%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+ P+  D AL +R L   S  IL++DE  R  I   E  +A +N  S ++G 
Sbjct: 1   MHDIRIIREFPDRFDTALSRRGLSALSGEILAIDEARRSKILAAETAQAEQNRASKEVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  + L+   +  K ++  L +E     + L+ ++  IPN+PL+EVP G   +
Sbjct: 61  AKARGDEAEFERLRALVAEKKAEVARLNEEAAAEDARLRDMLVAIPNLPLDEVPEGPDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ IR  G         +EHFEI      MDF  A KLSG+RF +L G +  + RAL Q
Sbjct: 121 ANVEIRRWGTPRGFNFAPKEHFEIAGVKPGMDFATAAKLSGSRFVMLKGAVIRVHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H +EHG TE   P+LV+DEAM+GTGQ+PKF++D + TT+G WLIPTSEV+LTN  
Sbjct: 181 FMLDTHVTEHGLTETWTPVLVKDEAMFGTGQLPKFSEDSYQTTNGWWLIPTSEVTLTNTV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           S EI++   LP+R T     FRSEAGSAG+DT GMLRQHQF K E+VSIT  E S  EHE
Sbjct: 241 SGEILDEAQLPVRMTAHTQCFRSEAGSAGKDTSGMLRQHQFEKVEMVSITTPETSLAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE IL++L L YR + LCTGD+GF A KT+DLEVWL GQN YREISS S CG+FQ
Sbjct: 301 RMTGCAEAILQKLGLPYRTIVLCTGDMGFGATKTHDLEVWLPGQNTYREISSVSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R+R       +F HTLNGSG+AVGRCLIA+LEN    DGSV +P  L PY+   
Sbjct: 361 ARRMNARFRPAGGGKPEFVHTLNGSGLAVGRCLIAVLENGQQEDGSVELPEALHPYLGGK 420

Query: 421 AVIKKEHILE 430
             I  +  LE
Sbjct: 421 TRISADGTLE 430


>gi|283833814|ref|ZP_06353555.1| serine--tRNA ligase [Citrobacter youngae ATCC 29220]
 gi|291070481|gb|EFE08590.1| serine--tRNA ligase [Citrobacter youngae ATCC 29220]
          Length = 430

 Score =  444 bits (1143), Expect = e-123,   Method: Composition-based stats.
 Identities = 198/431 (45%), Positives = 271/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L  R  +   + + +L+E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLASRGFKLDVDKLRALEERRKVLQVQTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    +++L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIESLRLEVNKLGEELDAAKAELDTLQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHTGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNHDTLYGTGQLPKFAGDLFHTRPLDEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+  +LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIIDEDALPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMEALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIQVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEFI 429


>gi|332560222|ref|ZP_08414544.1| seryl-tRNA synthetase [Rhodobacter sphaeroides WS8N]
 gi|332277934|gb|EGJ23249.1| seryl-tRNA synthetase [Rhodobacter sphaeroides WS8N]
          Length = 430

 Score =  444 bits (1143), Expect = e-123,   Method: Composition-based stats.
 Identities = 216/430 (50%), Positives = 279/430 (64%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+ P+  D AL +R L   S  IL++DE  R  I   E  +A +N  S ++G 
Sbjct: 1   MHDIRIIREFPDRFDTALSRRGLSALSGEILAIDEARRSKILAAETAQAEQNRASKEVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  + L+   +  K ++  L +E     + L+ ++  IPN+PL+EVP G   +
Sbjct: 61  AKARGDEAEFERLRALVAEKKAEVARLNEEAAAEDARLRDMLVAIPNLPLDEVPEGPDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ IR  G         +EHFEI      MDF  A KLSG+RF +L G +  + RAL Q
Sbjct: 121 ANVEIRRWGTPRGFNFAPKEHFEIAGVKPGMDFATAAKLSGSRFVMLKGAVIRVHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H +EHG TE   P+LV+DEAM+GTGQ+PKF++D + TT+G WLIPTSEV+LTN  
Sbjct: 181 FMLDTHVTEHGLTETWTPVLVKDEAMFGTGQLPKFSEDSYQTTNGWWLIPTSEVTLTNSV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++   LP+R T     FRSEAGSAG+DT GMLRQHQF K E+VSIT  E S  EHE
Sbjct: 241 AGEILDEAQLPIRMTAHTQCFRSEAGSAGKDTSGMLRQHQFEKVEMVSITTPETSLAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE IL++L L YR + LCTGD+GF A KT+DLEVWL GQN YREISS S CG+FQ
Sbjct: 301 RMTGCAEAILQKLGLPYRTIVLCTGDMGFGATKTHDLEVWLPGQNTYREISSVSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R+R       +F HTLNGSG+AVGRCLIA+LEN    DGSV +P  L PY+   
Sbjct: 361 ARRMNARFRPAGGGKPEFVHTLNGSGLAVGRCLIAVLENGQQEDGSVELPEALHPYLGGK 420

Query: 421 AVIKKEHILE 430
             I  +  LE
Sbjct: 421 TRISADGTLE 430


>gi|77462339|ref|YP_351843.1| seryl-tRNA synthetase [Rhodobacter sphaeroides 2.4.1]
 gi|77386757|gb|ABA77942.1| seryl-tRNA synthetase [Rhodobacter sphaeroides 2.4.1]
          Length = 430

 Score =  444 bits (1143), Expect = e-123,   Method: Composition-based stats.
 Identities = 216/430 (50%), Positives = 280/430 (65%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+ P+  D AL +R L   S  IL++DE  R  I   E  +A +N  S ++G 
Sbjct: 1   MHDIRIIREFPDRFDTALSRRGLSALSGEILAIDEARRSKILAAETAQAEQNRASKEVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  + L+   +  K ++  L +E     + L+ +++ IPN+PL+EVP G   +
Sbjct: 61  AKARGDEAEFERLRALVAEKKAEVARLNEEAAAEDARLRDMLAAIPNLPLDEVPEGPDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ IR  G         +EHFEI      MDF  A KLSG+RF +L G +  + RAL Q
Sbjct: 121 ANVEIRRWGTPRGFNFAPKEHFEIAGVKPGMDFATAAKLSGSRFVMLKGAVIRVHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H +EHG TE   P+LV+DEAM+GTGQ+PKF++D + TT+G WLIPTSEV+LTN  
Sbjct: 181 FMLDTHVTEHGLTETWTPVLVKDEAMFGTGQLPKFSEDSYQTTNGWWLIPTSEVTLTNSV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++   LP+R T     FRSEAGSAG+DT GMLRQHQF K E+VSIT  E S  EHE
Sbjct: 241 AGEILDEAQLPIRMTAHTQCFRSEAGSAGKDTSGMLRQHQFEKVEMVSITTPETSLAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE IL++L L YR + LCTGD+GF A KT+DLEVWL GQN YREISS S CG+FQ
Sbjct: 301 RMTGCAEAILQKLGLPYRTIVLCTGDMGFGATKTHDLEVWLPGQNTYREISSVSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R+R       +F HTLNGSG+AVGRCLIA+LEN    DGSV +P  L PY+   
Sbjct: 361 ARRMNARFRPAGGGKPEFVHTLNGSGLAVGRCLIAVLENGQQEDGSVELPEALHPYLGGK 420

Query: 421 AVIKKEHILE 430
             I  +  LE
Sbjct: 421 TRISADGTLE 430


>gi|298530167|ref|ZP_07017569.1| seryl-tRNA synthetase [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509541|gb|EFI33445.1| seryl-tRNA synthetase [Desulfonatronospira thiodismutans ASO3-1]
          Length = 425

 Score =  444 bits (1143), Expect = e-122,   Method: Composition-based stats.
 Identities = 193/426 (45%), Positives = 278/426 (65%), Gaps = 3/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+++R+NP+ +  ++K R      +  L L+++ R L ++++D++ RRN  S ++  
Sbjct: 1   MLDIKFVRKNPDLVAKSIKDRGAAQDLDDFLKLEQQRRELTQRVQDLKTRRNQASQEVAL 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A  EG            S L +++  L+ E   +   + + +  +PN+P  +VP+G+  +
Sbjct: 61  AKREGR--DAAQAMEGLSELSDKIKELDGELKGLDRQVHEWLLSVPNIPAGDVPVGSDED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N ++R+ G+KP      REH+++G  LG +DF+ A K++G+RF +  G  A LERAL  
Sbjct: 119 DNQVVRTWGEKPVMDFQPREHWDLGVELGGLDFEHAAKMTGSRFVMYVGWGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-TTDGRWLIPTSEVSLTNL 239
           FM+D+ T EHGY E   P++V  ++M  TGQ+PKFADD+F       +LIPT+EV LTN+
Sbjct: 179 FMLDVQTGEHGYMETMPPMIVNRDSMTATGQLPKFADDLFKLENWEYYLIPTAEVPLTNI 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +  E+++   LPL +T     FRSEAGS G+DTRG++RQHQF K ELV     +DSF + 
Sbjct: 239 HRGEVLQEDQLPLAYTAFTGCFRSEAGSHGKDTRGIIRQHQFNKVELVRFAHPDDSFKQL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E +L  AEEILKRL LHYRVV+LCTGDLGF A KTYD+EVWL GQ  YREISSCS   +F
Sbjct: 299 ELLLGHAEEILKRLGLHYRVVNLCTGDLGFGAAKTYDIEVWLPGQGKYREISSCSNFTDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR + R++    K  +  HTLNGSG+AVGR L+AI+EN    DGS+ IP VLRPY   
Sbjct: 359 QARRGDIRFKPAQEKKSRLVHTLNGSGLAVGRALVAIMENCQQKDGSIVIPEVLRPYTGG 418

Query: 420 LAVIKK 425
           + +I+K
Sbjct: 419 MDIIRK 424


>gi|296103101|ref|YP_003613247.1| seryl-tRNA synthetase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295057560|gb|ADF62298.1| seryl-tRNA synthetase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 430

 Score =  444 bits (1143), Expect = e-122,   Method: Composition-based stats.
 Identities = 197/431 (45%), Positives = 271/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVQTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P + VP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDQAKAELDVLQAEIRDIALAIPNIPDDSVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ ++  G         R+H  +GE    +DF  A KL+G+RF V+ G +AHL RAL Q
Sbjct: 119 DNVEVKRWGTPREFDFEVRDHVTLGEMHAGLDFAAAVKLTGSRFVVMKGQIAHLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSETYVPYLVNHDTLYGTGQLPKFAGDLFHTRPLDEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T  +P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIIDEDDLPIKLTAHSPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E+S    E M   AE++L+ L L YR ++LCTGD+GF ACKT+DLEVW+  QN YREISS
Sbjct: 299 EESMDALEEMTGHAEKVLELLGLPYRRMALCTGDMGFGACKTFDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A+LENY  ADG + IP V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVLENYQQADGRIEIPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM     I
Sbjct: 419 LRPYMKGQQYI 429


>gi|323701687|ref|ZP_08113359.1| seryl-tRNA synthetase [Desulfotomaculum nigrificans DSM 574]
 gi|323533460|gb|EGB23327.1| seryl-tRNA synthetase [Desulfotomaculum nigrificans DSM 574]
          Length = 424

 Score =  444 bits (1142), Expect = e-122,   Method: Composition-based stats.
 Identities = 200/425 (47%), Positives = 272/425 (64%), Gaps = 3/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+++R NPE +   L KR      +  L LD K R  +  +E ++  RN  S +IG+
Sbjct: 1   MLDIKFVRSNPELVKEGLAKRGANISLDEFLELDAKRREKLVVVEQLKNTRNVVSQEIGR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G  +    L  E   + +Q+  ++ E   +   L +++  IPN+P E VP+G   N
Sbjct: 61  LKKAGQDAEEKQL--EMRQVSQQIKDIDDEIRTIEERLGEILLAIPNLPHESVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G+        + H+E+GEAL ++DF+RA K++GARF+   G  A LERAL  
Sbjct: 119 DNLEVRRWGRPREFDFTPKPHWELGEALNILDFERAGKVTGARFTFYKGLGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-TTDGRWLIPTSEVSLTNL 239
           FM+DLHT EHGYTEV  P +V  ++M GTGQ+PKFADDMF       +LIPT+EV +TNL
Sbjct: 179 FMLDLHTREHGYTEVFPPFIVNSDSMVGTGQLPKFADDMFKLEGLNYYLIPTAEVPVTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y  EI+  + LP+     +  FR+EAG+AGRDTRG++RQHQF K ELV   + EDSF E 
Sbjct: 239 YREEILSGEQLPIYHCAYSACFRAEAGAAGRDTRGLIRQHQFNKVELVKFCKPEDSFDEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++   AE++L+ L L YRVV LC+GD+GF++ KTYDLEVWL   N Y+EISSCS   +F
Sbjct: 299 EKLTVNAEKVLQALGLPYRVVLLCSGDMGFASAKTYDLEVWLPSYNAYKEISSCSNFQDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N ++R       +F HTLNGSGVA+GR L AILENY  ADGS+T+P VL PYM  
Sbjct: 359 QARRANIKFRREPKSKPEFVHTLNGSGVAIGRALSAILENYQEADGSITVPPVLVPYMGG 418

Query: 420 LAVIK 424
           +  I 
Sbjct: 419 IEKIT 423


>gi|150396386|ref|YP_001326853.1| seryl-tRNA synthetase [Sinorhizobium medicae WSM419]
 gi|166223291|sp|A6U8N8|SYS_SINMW RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|150027901|gb|ABR60018.1| seryl-tRNA synthetase [Sinorhizobium medicae WSM419]
          Length = 427

 Score =  444 bits (1142), Expect = e-122,   Method: Composition-based stats.
 Identities = 261/425 (61%), Positives = 324/425 (76%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+N + LD AL KR   P S  +++LDE+ R +++ ++D+++RRN+ S +IG 
Sbjct: 1   MLDIKWIRENADVLDSALAKRGAGPLSASLIALDERRRTILQSLQDMQSRRNAASKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A+ N  L D LK E + LK  LP  E+E   + + L   +S IPN PL++VP+G   +
Sbjct: 61  AMAQKNSELADRLKAEVAELKTTLPAAEEESRRIEAELTDALSRIPNAPLDDVPVGADES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N++ R VG KP+  H   EHFEIGEALGLMDF+ A +++G+RF++L G LA LERALGQ
Sbjct: 121 ANVVTRVVGAKPTWNHKPLEHFEIGEALGLMDFEGAARIAGSRFTILKGQLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT EHGY EV  PLLVRD+AMYGTGQ+PKF DD+F TTDGRWLIPT+EV LTN+ 
Sbjct: 181 FMLDLHTGEHGYIEVQPPLLVRDDAMYGTGQLPKFTDDLFRTTDGRWLIPTAEVPLTNMV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             +I++ + LPLRFT L P FRSEAGSAGRDTRGMLRQHQF K ELVSIT  E +  EHE
Sbjct: 241 REQILDGEKLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFNKVELVSITDAESALDEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL LHYRV++LCTGD+GFSA KTYDLEVWL GQ+ YREISSCS CG+FQ
Sbjct: 301 RMTACAEEVLKRLGLHYRVMTLCTGDMGFSARKTYDLEVWLPGQDAYREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    K  KF HTLNGSGVA+GR LIA++ENYLN DGS+T+P  L  YM  L
Sbjct: 361 GRRMNARYRGKEEKGTKFAHTLNGSGVALGRALIAVIENYLNEDGSITVPDALIAYMGGL 420

Query: 421 AVIKK 425
             I+K
Sbjct: 421 RRIEK 425


>gi|237730858|ref|ZP_04561339.1| seryl-tRNA synthetase [Citrobacter sp. 30_2]
 gi|226906397|gb|EEH92315.1| seryl-tRNA synthetase [Citrobacter sp. 30_2]
          Length = 430

 Score =  444 bits (1142), Expect = e-122,   Method: Composition-based stats.
 Identities = 197/431 (45%), Positives = 271/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L  R  +   + + +L+E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLASRGFKLDVDKLRALEERRKVLQVQTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    +++L+ E + L E+L   + E   + + ++ +   IPN+P ++VP+G   N
Sbjct: 61  AKARG--EDIESLRLEVNKLGEELDAAKAELDTLQAEIRDIALTIPNLPADDVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHTGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNHDTLYGTGQLPKFAGDLFHTRPLDEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+  +LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIIDEDALPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMDALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIQVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLKFI 429


>gi|189426285|ref|YP_001953462.1| seryl-tRNA synthetase [Geobacter lovleyi SZ]
 gi|238692147|sp|B3EAQ9|SYS_GEOLS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|189422544|gb|ACD96942.1| seryl-tRNA synthetase [Geobacter lovleyi SZ]
          Length = 423

 Score =  444 bits (1142), Expect = e-122,   Method: Composition-based stats.
 Identities = 194/426 (45%), Positives = 270/426 (63%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD+++IR N +  + AL  R           LD + R L+ + E ++A +NS S +I +
Sbjct: 1   MLDVKFIRDNLDQAEAALATRGGAISLARFRELDAQRRKLLTESETLKALKNSVSEEIAK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
                + S V     E   +  ++   + E   V      L+  IPN+P    P+G S  
Sbjct: 61  VK---DKSTVKDKIAEMKEVSAKIKTFDDELKIVEEEFDTLLMTIPNLPHPTTPVGKSEE 117

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+++RS G  P      + H+++ E L ++DF+RATK++GARF +     A LERAL  
Sbjct: 118 ENVIVRSWGSLPEMAFEPKPHWDLAEDLDILDFERATKITGARFCLSKRAGARLERALIS 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTNL 239
           FM+DLH++EHGYTEV  P +V   +M GTGQ+PKF +D+F   D  +  IPT+EV +TN+
Sbjct: 178 FMLDLHSTEHGYTEVLPPFMVNRASMTGTGQLPKFEEDLFRLMDPEYFLIPTAEVPVTNI 237

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +  EI++   LP+ +T   P FR EAGS G+DTRG++RQHQF K ELV     ++S  E 
Sbjct: 238 HRDEILKKSDLPISYTAYTPCFRREAGSYGKDTRGLIRQHQFNKVELVKFVHPDESQAEL 297

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++   AE++L+ L+L YRV++LC+GD+GFSACKTYDLEVWL  QN YREISSCS+ G+F
Sbjct: 298 EKLTGHAEKVLQLLELPYRVMALCSGDIGFSACKTYDLEVWLPSQNTYREISSCSSFGDF 357

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR   R+R+      +F HTLNGSG+AVGR L+AILENY  ADGS+ IPT LRPYM  
Sbjct: 358 QARRAGIRFREDEKSKPEFVHTLNGSGLAVGRTLVAILENYQQADGSIIIPTALRPYMGG 417

Query: 420 LAVIKK 425
           +  I K
Sbjct: 418 IEKITK 423


>gi|16759834|ref|NP_455451.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|16764324|ref|NP_459939.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|29142393|ref|NP_805735.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|56413985|ref|YP_151060.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|62179487|ref|YP_215904.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161614806|ref|YP_001588771.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|167550365|ref|ZP_02344122.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|167994705|ref|ZP_02575796.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168230857|ref|ZP_02655915.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|168263551|ref|ZP_02685524.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|168466548|ref|ZP_02700410.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|168822936|ref|ZP_02834936.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|194445741|ref|YP_002040162.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194471358|ref|ZP_03077342.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|197249370|ref|YP_002145881.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197262813|ref|ZP_03162887.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197362908|ref|YP_002142545.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|198244710|ref|YP_002214887.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|200390080|ref|ZP_03216691.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|205352171|ref|YP_002225972.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207856355|ref|YP_002243006.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|213428591|ref|ZP_03361341.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Typhi str. E02-1180]
 gi|213580909|ref|ZP_03362735.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-0664]
 gi|213609744|ref|ZP_03369570.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-2068]
 gi|213851472|ref|ZP_03381370.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Typhi str. M223]
 gi|238913262|ref|ZP_04657099.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
 gi|289830102|ref|ZP_06547533.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-3139]
 gi|54039690|sp|P67564|SYS_SALTI RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|54042041|sp|P67563|SYS_SALTY RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|67461661|sp|Q5PGI6|SYS_SALPA RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|81309725|sp|Q57R38|SYS_SALCH RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|189083584|sp|A9N7X6|SYS_SALPB RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|238689928|sp|B5BBR2|SYS_SALPK RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|238690019|sp|B5F146|SYS_SALA4 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|238690350|sp|B5FQ36|SYS_SALDC RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|238690425|sp|B5QYP4|SYS_SALEP RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|238690487|sp|B5R8I1|SYS_SALG2 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|238693584|sp|B4T128|SYS_SALNS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|25293157|pir||AI0611 seryl-tRNA synthetase [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16419475|gb|AAL19898.1| serine tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|16502127|emb|CAD05363.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Typhi]
 gi|29138023|gb|AAO69584.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|56128242|gb|AAV77748.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|62127120|gb|AAX64823.1| serine tRNA synthetase ; also charges selenocystein tRNA with
           serine [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161364170|gb|ABX67938.1| hypothetical protein SPAB_02558 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194404404|gb|ACF64626.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194457722|gb|EDX46561.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|195631016|gb|EDX49602.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197094385|emb|CAR59900.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|197213073|gb|ACH50470.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197241068|gb|EDY23688.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197939226|gb|ACH76559.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|199602525|gb|EDZ01071.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|205271952|emb|CAR36796.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|205324587|gb|EDZ12426.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|205327478|gb|EDZ14242.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205334663|gb|EDZ21427.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|205340753|gb|EDZ27517.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205347703|gb|EDZ34334.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|206708158|emb|CAR32451.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|261246180|emb|CBG23984.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267992697|gb|ACY87582.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301157507|emb|CBW16997.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|312911951|dbj|BAJ35925.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|320085200|emb|CBY94986.1| Seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|321223287|gb|EFX48356.1| Seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|322713956|gb|EFZ05527.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
 gi|323129229|gb|ADX16659.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|326622640|gb|EGE28985.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
 gi|326627215|gb|EGE33558.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
 gi|332987855|gb|AEF06838.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 430

 Score =  444 bits (1142), Expect = e-122,   Method: Composition-based stats.
 Identities = 198/431 (45%), Positives = 269/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L    E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVNTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDTLLAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEIRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNHDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIIDEDQLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|283784715|ref|YP_003364580.1| seryl-tRNA synthetase [Citrobacter rodentium ICC168]
 gi|282948169|emb|CBG87736.1| seryl-tRNA synthetase [Citrobacter rodentium ICC168]
          Length = 430

 Score =  444 bits (1142), Expect = e-122,   Method: Composition-based stats.
 Identities = 197/431 (45%), Positives = 269/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L    E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVNTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P ++VP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDVLQAEIRDIALTIPNLPADDVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPRQFDFEVRDHVTLGEMHTGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNHDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIIDEDLLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIVLCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|157146419|ref|YP_001453738.1| seryl-tRNA synthetase [Citrobacter koseri ATCC BAA-895]
 gi|166219863|sp|A8AII9|SYS_CITK8 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|157083624|gb|ABV13302.1| hypothetical protein CKO_02178 [Citrobacter koseri ATCC BAA-895]
          Length = 430

 Score =  444 bits (1142), Expect = e-122,   Method: Composition-based stats.
 Identities = 196/431 (45%), Positives = 270/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L    E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVNTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P ++VP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELESLQAEIRDIALTIPNLPADDVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFDVRDHVTLGEMHAGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNHDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+  +LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIIDEDALPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E+S    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EESMDALEEMTGHAEKVLQLLGLPYRKIVLCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|260433300|ref|ZP_05787271.1| seryl-tRNA synthetase [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417128|gb|EEX10387.1| seryl-tRNA synthetase [Silicibacter lacuscaerulensis ITI-1157]
          Length = 430

 Score =  444 bits (1142), Expect = e-122,   Method: Composition-based stats.
 Identities = 210/429 (48%), Positives = 283/429 (65%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D AL +R   P S  +L LDE  R  I   E  +A +N  S ++G 
Sbjct: 1   MHDIRAIRENPAAFDAALARRGEAPISAELLRLDEARRAKILAAETAQAEQNKASKEVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +    L+   +  K ++  ++ E  ++ + L   +  IPN+P E+VP G   N
Sbjct: 61  AKARGDEAEFQRLRALVAEKKAEIARMQTEAKDLDALLTDQLIRIPNLPAEDVPDGKDEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G   +    ++EHFEI      MDF+ A KL+G+RF +L+G +A + RAL Q
Sbjct: 121 DNVEVNRWGTPRAFDFDAKEHFEIEAVQNGMDFETAAKLAGSRFVLLSGGVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H +E+G TEV+AP+LV  E M GTGQ+PKF +D + T +G WLIPTSEVSLTN+ 
Sbjct: 181 FMLDTHINENGLTEVNAPVLVLSEMMMGTGQLPKFGEDSYQTREGWWLIPTSEVSLTNIV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           +  +IE   LP R+T  +  FRSEAGSAG+DTRGMLRQHQF K E+VSIT  + S  E +
Sbjct: 241 NDTMIEESYLPRRYTAHSLCFRSEAGSAGKDTRGMLRQHQFEKVEMVSITHPDKSDEEQK 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML CAE IL++L + YR V LCTGD+GF A +TYD+E WL GQN YREISS STCG+FQ
Sbjct: 301 RMLRCAEGILEKLGVPYRTVILCTGDMGFGARRTYDIEAWLPGQNTYREISSVSTCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R+R       ++ HTLNGSG+AVGRCLIA+LEN   ADG+V +P VL PY+   
Sbjct: 361 ARRMNARFRPEGGGKPEYVHTLNGSGLAVGRCLIAVLENGQQADGTVILPEVLAPYLGGK 420

Query: 421 AVIKKEHIL 429
             ++K+  L
Sbjct: 421 LTLQKDGTL 429


>gi|114570456|ref|YP_757136.1| seryl-tRNA synthetase [Maricaulis maris MCS10]
 gi|122315709|sp|Q0AND9|SYS_MARMM RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|114340918|gb|ABI66198.1| seryl-tRNA synthetase [Maricaulis maris MCS10]
          Length = 425

 Score =  444 bits (1141), Expect = e-122,   Method: Composition-based stats.
 Identities = 219/424 (51%), Positives = 287/424 (67%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP+  D  L  R L  QS  ++ LD   R  + K +D    RN+ S QIG+
Sbjct: 1   MHDIKLIRDNPDAFDAGLAMRGLPAQSATLIELDASRREALGKQQDAETERNALSKQIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  + L++E   LK  L    ++       L + ++ +PN+P  +VP G    
Sbjct: 61  AKASGDEAEFNRLRSEVDRLKAVLEESGQQARHFDEVLNQHLAALPNLPHADVPQGADEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+  R  G+  +     R+H ++GE+LG MDF +A ++SG+RF  L G LA LERAL Q
Sbjct: 121 DNVEERRWGEPRTMAFTPRDHVDLGESLGQMDFKKAAEISGSRFVALRGGLARLERALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGY EVS P +VRDEA++GTGQ+PKFA+D+F TTD  WLIPT+EV LTNL 
Sbjct: 181 FMLDLHTTEHGYEEVSPPYMVRDEAVFGTGQLPKFAEDLFRTTDDHWLIPTAEVPLTNLA 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
              I     LP+R T   P FRSEAGSAGRDTRGM+R HQF K E+VSI   ++S  E E
Sbjct: 241 RETIHAEADLPMRMTAYTPCFRSEAGSAGRDTRGMIRLHQFQKVEMVSIVTPDESDAELE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE++L+ L+L YRV+ LCTGD+GF+A +TYDLEVW+  Q+ YREISSCSTCG+FQ
Sbjct: 301 RMTGCAEKVLQLLELPYRVMKLCTGDMGFAARRTYDLEVWMPSQDCYREISSCSTCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM++R+R    K   F HTLNGSGVAVGR L+A+LEN+ N DGS+TIP  LRPYM  +
Sbjct: 361 ARRMDARFRKEGEKRPAFLHTLNGSGVAVGRALVAVLENHQNEDGSITIPAALRPYMGGV 420

Query: 421 AVIK 424
             I+
Sbjct: 421 ERIE 424


>gi|154253470|ref|YP_001414294.1| seryl-tRNA synthetase [Parvibaculum lavamentivorans DS-1]
 gi|171769667|sp|A7HXK4|SYS_PARL1 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|154157420|gb|ABS64637.1| seryl-tRNA synthetase [Parvibaculum lavamentivorans DS-1]
          Length = 435

 Score =  444 bits (1141), Expect = e-122,   Method: Composition-based stats.
 Identities = 232/431 (53%), Positives = 307/431 (71%), Gaps = 8/431 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR +    D  L KR L PQ+  ++ +DE+ R +I  +++++ RRN  S QIGQ
Sbjct: 1   MFDIKAIRDDAGAFDAGLAKRGLAPQAARLIEIDERRRAIITSLQELQQRRNDASKQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+ + +L  +L  E +++K  +   E++E    + ++  ++ IPN+P ++VP+G   +
Sbjct: 61  AKAKKDDALAQSLMEEVASIKSAIQEGEEKERAANAEIEAALASIPNIPFDDVPVGPDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N++  S GK        +EHF++GEALGLMDF+ A K+SGARF+VL G LA LERA+G 
Sbjct: 121 ANVIRHSHGKAREMNFAPKEHFDLGEALGLMDFEAAAKMSGARFTVLKGQLARLERAIGN 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT--------DGRWLIPTS 232
           FM+DLHT+E GY EV+ PL+VRD+AM+GT Q+PKF DD F T         +  WLIPT+
Sbjct: 181 FMVDLHTTEFGYEEVAPPLMVRDDAMFGTAQLPKFEDDQFATFKGLARDDQEKYWLIPTA 240

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL    I+  + LP RFT     FR+EAGSAGRDTRGM+RQHQF K ELVSIT  
Sbjct: 241 EVPLTNLVRESILSEEELPKRFTAYTACFRAEAGSAGRDTRGMIRQHQFSKVELVSITTP 300

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E S  EHERMLSCAEE+LKRLDLHYRV++L TGD+GF++ KTYD+EVWL GQN +REISS
Sbjct: 301 EKSREEHERMLSCAEEVLKRLDLHYRVMTLSTGDMGFASRKTYDIEVWLPGQNAFREISS 360

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS CG+FQ+RRMN+RYR    K+ +F HTLNGSG+AVGR L+A++ENY  ADGS+T+PT 
Sbjct: 361 CSVCGDFQARRMNARYRPKGEKNTRFVHTLNGSGLAVGRALVAVMENYQQADGSITVPTA 420

Query: 413 LRPYMNNLAVI 423
           L+PYM    VI
Sbjct: 421 LQPYMGGQEVI 431


>gi|304311216|ref|YP_003810814.1| Seryl-tRNA synthetase [gamma proteobacterium HdN1]
 gi|301796949|emb|CBL45162.1| Seryl-tRNA synthetase [gamma proteobacterium HdN1]
          Length = 427

 Score =  444 bits (1141), Expect = e-122,   Method: Composition-based stats.
 Identities = 198/428 (46%), Positives = 274/428 (64%), Gaps = 4/428 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + IR   + +   L  R +   +  + SL+E+ + L  + E +++ RN+ S  IG+
Sbjct: 1   MLDPKIIRGQLDFVAERLALRGMTLDTGLLTSLEEQRKGLQVQTEQLQSERNARSKAIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G  + V  L  E  TL +QL   E +  E+   L+ +   +PN+P E VP G S  
Sbjct: 61  AKAQGQDTSV--LLAEVDTLGDQLSQCENQLKELMVRLQDVYYGLPNLPHESVPKGASEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G         R+H +IGEALG +DF+ A K++GARF V+ G LA + RAL Q
Sbjct: 119 DNVEVRRWGAPREFDFEPRDHVDIGEALGELDFEVAAKITGARFVVMNGALARMHRALIQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT--DGRWLIPTSEVSLTN 238
           FM+D HTS++GY EV  P +V ++++ GTGQ+PKF  +++        +LIPT+EV +TN
Sbjct: 179 FMLDTHTSQNGYQEVYVPYVVNEDSLKGTGQLPKFGQELYRLEGEKAFYLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L   EI+    LP +F    P FRSEAG+ G+D RGM+RQHQF K ELV I R EDS+  
Sbjct: 239 LMRDEIVAEDELPKKFACHTPCFRSEAGAYGKDVRGMIRQHQFEKIELVQIVRPEDSYAA 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E +   AE IL++L+L YRV++LC GD+GFS+ KTYD+EVWL GQ  YREISSCS   +
Sbjct: 299 LEALTGHAESILQKLNLPYRVITLCGGDIGFSSAKTYDIEVWLPGQQKYREISSCSNFED 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR+ +RYR  NSK  +  HTLNGSG+AVGR L+AILENY  ADGSV +P  L PYM 
Sbjct: 359 FQARRLQARYRPNNSKKPELVHTLNGSGLAVGRTLVAILENYQQADGSVLVPEALLPYMG 418

Query: 419 NLAVIKKE 426
            + V++  
Sbjct: 419 GVTVLRPT 426


>gi|239825598|ref|YP_002948222.1| seryl-tRNA synthetase [Geobacillus sp. WCH70]
 gi|259511672|sp|C5D340|SYS_GEOSW RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|239805891|gb|ACS22956.1| seryl-tRNA synthetase [Geobacillus sp. WCH70]
          Length = 424

 Score =  444 bits (1141), Expect = e-122,   Method: Composition-based stats.
 Identities = 195/426 (45%), Positives = 267/426 (62%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++++R + E +   L KR  +    +    LD+K R LI K E+++ +RN  S QI 
Sbjct: 1   MLDVKYLRNHFEEVKEKLLKRGEDLTNIDRFEELDKKRRELIAKAEELKNKRNEVSQQIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      D L  E   + +++  ++ E  +V   L  L+  IPN+P E VP+G S 
Sbjct: 61  VLKREKK--DADHLIAEMRDVGDRIKTMDDEIRQVEEELNALLLSIPNIPHESVPVGKSE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            +N+ +R  G+  S     + H++I E LG++DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 EDNVEVRKWGEPRSFSFEPKPHWDIAEQLGILDFERAAKVTGSRFVFYKGLGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+D+H  E GY E+  P LV   +M GTGQ+PKF +D F      +  IPT+EV +TN
Sbjct: 179 NFMLDVHIEEFGYQEILPPYLVNRASMTGTGQLPKFEEDAFRIETDDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L+  EI+ ++ LP+ +   +  FR+EAGSAGRDTRG++RQHQF K ELV   + EDS+ E
Sbjct: 239 LHRDEILSAEDLPIYYVAYSACFRAEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYDE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++ + AE IL+ L L YRVV LCTGDLGFS+ KTYD+EVWL     YREISSCS    
Sbjct: 299 LEKLTNQAERILQLLGLPYRVVCLCTGDLGFSSAKTYDIEVWLPSYGTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R       ++ HTLNGSG+A+GR + AILENY   DG+V IP VLRPYM 
Sbjct: 359 FQARRANIRFRREPKAKPEYVHTLNGSGLAIGRTVAAILENYQQEDGTVVIPEVLRPYMG 418

Query: 419 NLAVIK 424
           NL VI+
Sbjct: 419 NLEVIR 424


>gi|168240814|ref|ZP_02665746.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|194451035|ref|YP_002044956.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|238690614|sp|B4TD24|SYS_SALHS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|194409339|gb|ACF69558.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|205340363|gb|EDZ27127.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
          Length = 430

 Score =  444 bits (1141), Expect = e-122,   Method: Composition-based stats.
 Identities = 198/431 (45%), Positives = 269/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L    E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVNTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELETLLAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEIRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNHDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIIDEDQLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|204930096|ref|ZP_03221117.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|204321090|gb|EDZ06291.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|322616395|gb|EFY13304.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322619645|gb|EFY16520.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322622659|gb|EFY19504.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322628572|gb|EFY25359.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322634947|gb|EFY31676.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322637035|gb|EFY33738.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322641604|gb|EFY38241.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322644441|gb|EFY40981.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322649589|gb|EFY46020.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322654109|gb|EFY50432.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322659224|gb|EFY55473.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322663498|gb|EFY59700.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322670234|gb|EFY66374.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322671470|gb|EFY67592.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322676826|gb|EFY72893.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322682751|gb|EFY78770.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322686430|gb|EFY82412.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323191716|gb|EFZ76970.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323199759|gb|EFZ84848.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323202196|gb|EFZ87250.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323209023|gb|EFZ93960.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323210415|gb|EFZ95304.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323215844|gb|EGA00584.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323222449|gb|EGA06823.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323226864|gb|EGA11047.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323229818|gb|EGA13941.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323233043|gb|EGA17139.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323240778|gb|EGA24820.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323243095|gb|EGA27115.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323247417|gb|EGA31373.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323250911|gb|EGA34788.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323256446|gb|EGA40180.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323263112|gb|EGA46654.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323267978|gb|EGA51457.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323270716|gb|EGA54156.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
          Length = 430

 Score =  444 bits (1141), Expect = e-122,   Method: Composition-based stats.
 Identities = 198/431 (45%), Positives = 269/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L    E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVNTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDTLLAEIRNIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEIRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNHDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIIDEDQLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|303232994|ref|ZP_07319674.1| serine--tRNA ligase [Atopobium vaginae PB189-T1-4]
 gi|302480921|gb|EFL44001.1| serine--tRNA ligase [Atopobium vaginae PB189-T1-4]
          Length = 429

 Score =  443 bits (1140), Expect = e-122,   Method: Composition-based stats.
 Identities = 201/427 (47%), Positives = 275/427 (64%), Gaps = 3/427 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKR-HLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+++R+NP+ +D A   R +     +   +LDE+ R  I ++E ++A RN+ S QIG
Sbjct: 1   MLDIKFVRENPDCVDKACASRQNAHWDRDAFFALDEQRRSTIVEVEKLQAHRNAVSKQIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           + +A G        K E +  KE++  LE+   E    L  L+S IPN+P   +P G   
Sbjct: 61  KLMAAGKTQEAQDAKQEVAHNKERIAELERTRTECEQKLHDLVSAIPNIPDASIPYGKDD 120

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +EN+ +R  G   S       H+++G A  ++DFDR  KL+G+RF VL G+ A +ERAL 
Sbjct: 121 SENVEVRRWGTPTSFDFEPSAHWDLGTANKMIDFDRGVKLAGSRFYVLGGYGAQMERALI 180

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNL 239
            F ID+H  + G+ E   P+L   ++++GTGQ+PKF +D+F  +D  +LIPT+EV LTNL
Sbjct: 181 NFFIDMHA-KAGFKEWWPPVLTNYDSLFGTGQLPKFDEDLFHVSDNLYLIPTAEVMLTNL 239

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +  E++++  LPL +T   P FR EAGSAGRDTRG++R H+F K E+V     E+S  E 
Sbjct: 240 HRDEVLDAAQLPLLYTAFTPCFREEAGSAGRDTRGIIRVHEFDKVEMVKFATPENSMNEL 299

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E M+  AE  L+ L L YRVVSLCTGD+GFSACK YDLEVWL   N Y+EISSCS C +F
Sbjct: 300 ELMVGEAEACLQTLGLPYRVVSLCTGDIGFSACKCYDLEVWLPSYNNYKEISSCSNCWDF 359

Query: 360 QSRRMNSRYRDPNS-KSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           Q+RR N RYRD  S K  ++ HTLNGSG+AVGR + AI+ENY  ADGS+ +P  LRPYM 
Sbjct: 360 QARRANIRYRDAASFKGTRYVHTLNGSGLAVGRTMAAIMENYQQADGSIVVPEALRPYMR 419

Query: 419 NLAVIKK 425
            L VI  
Sbjct: 420 GLEVIPP 426


>gi|260768113|ref|ZP_05877047.1| seryl-tRNA synthetase [Vibrio furnissii CIP 102972]
 gi|260616143|gb|EEX41328.1| seryl-tRNA synthetase [Vibrio furnissii CIP 102972]
          Length = 435

 Score =  443 bits (1140), Expect = e-122,   Method: Composition-based stats.
 Identities = 189/434 (43%), Positives = 265/434 (61%), Gaps = 11/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   +     L +R  +   + I +L+E+ + +  ++E++++ RNS S QIGQ
Sbjct: 1   MLDSKLLRTELDETAAKLARRGFKLDVDTIRTLEEQRKSIQVEVENLQSTRNSISKQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +++G+    + +K +  TL + L   + E   + S L  +   +PN+P + VP G   N
Sbjct: 61  LMSKGDKEGAEEVKKQIGTLGDDLDAKKVELDAIQSQLDAITQSVPNLPDDSVPDGKDEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         ++H ++GE    +DF  ATK++GARF ++ G  A L RA+ Q
Sbjct: 121 DNVEVSRWGTPKEYDFDVKDHVDLGEMGDGLDFASATKITGARFVIMKGQFARLHRAIAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-----------TDGRWLI 229
           FM+DLHT +HGYTE+  P LV  + ++GTGQ+PKF  D+F T                LI
Sbjct: 181 FMLDLHTEQHGYTELYVPYLVNSDTLFGTGQLPKFGKDLFHTEPLAEKASDEEPRRLSLI 240

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV +TNL    I E   LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I
Sbjct: 241 PTAEVPVTNLVRDTITEEADLPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQI 300

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
           T+ EDS    E +   AE++L+ L+L YR V LCTGD+GF ACKTYDLEVW+  Q  YRE
Sbjct: 301 TKPEDSMAALEELTGHAEKVLQLLELPYRKVVLCTGDMGFGACKTYDLEVWVPAQKTYRE 360

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR ++AILENY  ADG + I
Sbjct: 361 ISSCSNMWDFQARRMQARFRRKGEKKPELVHTLNGSGLAVGRTMVAILENYQQADGRIAI 420

Query: 410 PTVLRPYMNNLAVI 423
           P VL+ YM  +  I
Sbjct: 421 PAVLQKYMGGVTHI 434


>gi|197284595|ref|YP_002150467.1| seryl-tRNA synthetase [Proteus mirabilis HI4320]
 gi|227356777|ref|ZP_03841162.1| seryl-tRNA synthetase [Proteus mirabilis ATCC 29906]
 gi|238693172|sp|B4EV93|SYS_PROMH RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|194682082|emb|CAR41638.1| seryl-tRNA synthetase [Proteus mirabilis HI4320]
 gi|227163067|gb|EEI48002.1| seryl-tRNA synthetase [Proteus mirabilis ATCC 29906]
          Length = 429

 Score =  443 bits (1139), Expect = e-122,   Method: Composition-based stats.
 Identities = 191/430 (44%), Positives = 261/430 (60%), Gaps = 9/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R   + +   L +R      E I   +E+ ++L  + E ++A RNS S  IG 
Sbjct: 1   MLDPNLLRNELDAVAEKLARRGFTLDVEKIRQQEERRKVLQVETESLQAERNSRSKSIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E  ++ + ++     +PN+P + VP G   +
Sbjct: 61  AKARG--EDIEPLRQEVNQLGEKLEAAKAELDKLQADIRDYALTLPNLPHDSVPNGKDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +   G+  +     ++H  +GE    +DF  A K++G+RF V+ G +A L RA+ Q
Sbjct: 119 ENVEVFRWGEPKTYDFELKDHVTLGELTDGLDFPSAVKITGSRFVVMKGQIARLHRAIAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM++LHT +HGY E+  P LV    +YGTGQ+PKF+ D+F T            LIPT+E
Sbjct: 179 FMLNLHTEQHGYQEMYVPYLVNHATLYGTGQLPKFSGDLFHTKPLEEESESQYALIPTAE 238

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V +TN+    I+E   LPLR T   P FRSEAGS GRDTRG++R HQF K ELV I   E
Sbjct: 239 VPVTNMVRDVILEEDELPLRMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQIVHPE 298

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S    E +   AE++L+ L+L YR V LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 299 KSMDALEELTGHAEKVLQLLNLPYRKVVLCTGDMGFGARKTYDLEVWVPAQNTYREISSC 358

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R+R    K  +  HTLNGSG+AVGR L+AI+ENY  ADG + IP VL
Sbjct: 359 SNCWDFQARRMQARFRAKGDKKTQLVHTLNGSGLAVGRTLVAIMENYQTADGRIEIPEVL 418

Query: 414 RPYMNNLAVI 423
           RPYMN L  I
Sbjct: 419 RPYMNGLEYI 428


>gi|149928208|ref|ZP_01916453.1| seryl-tRNA synthetase [Limnobacter sp. MED105]
 gi|149823099|gb|EDM82339.1| seryl-tRNA synthetase [Limnobacter sp. MED105]
          Length = 429

 Score =  443 bits (1139), Expect = e-122,   Method: Composition-based stats.
 Identities = 202/433 (46%), Positives = 281/433 (64%), Gaps = 12/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++  ++   L +R      E   +L+ K + L    E+++A+RNS S QIGQ
Sbjct: 1   MLDIQLLRKDLTNVAERLAQRGYSLDIEQFNALEGKRKQLQTSTEELQAKRNSMSKQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
             A+G    V A+  E + L ++L   E +   +   +   +  IPN+P E VP G S  
Sbjct: 61  LKAKG--EDVSAVMAEVAGLGDELKRNETDLAALQEEVNAFLLNIPNLPHESVPAGKSEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +NI +R  G         ++H ++GE LG +DF+ A  LSG+RF+VL G +A L RAL Q
Sbjct: 119 DNIELRRWGTPAQFDFEVKDHVDLGEKLG-LDFETAANLSGSRFAVLKGQIAKLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC--------TTDGRWLIPTS 232
           FM+D HT +HGYTE   P +VR E + GTGQ+PKFADD+F         T++  +LIPT+
Sbjct: 178 FMLDTHTEQHGYTEHYTPYIVRGETLKGTGQLPKFADDLFSVKKGGEEGTSEPLYLIPTA 237

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV+LTNL + +I+++  LP++ T  +P FRSEAGS GRDTRG++RQHQF K E+V I   
Sbjct: 238 EVTLTNLVADQILKASDLPIKMTAHSPCFRSEAGSYGRDTRGLIRQHQFDKVEMVRIENP 297

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E+S+   + M   AE IL++L L YRV+ LCTGD+GF + +T+D+EVWL  QN YREISS
Sbjct: 298 ENSYAALDEMTQHAENILQKLGLPYRVIVLCTGDMGFGSTRTHDIEVWLPAQNTYREISS 357

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS C  FQ+RRM +R+++   KS +F HTLNGSG+AVGR L+A+LENY  ADGSV +P  
Sbjct: 358 CSNCETFQARRMKARFKNEAGKS-EFVHTLNGSGLAVGRTLVAVLENYQQADGSVKVPEA 416

Query: 413 LRPYMNNLAVIKK 425
           L+PYM    V+K 
Sbjct: 417 LQPYMGGKTVLKP 429


>gi|146276505|ref|YP_001166664.1| seryl-tRNA synthetase [Rhodobacter sphaeroides ATCC 17025]
 gi|145554746|gb|ABP69359.1| seryl-tRNA synthetase [Rhodobacter sphaeroides ATCC 17025]
          Length = 430

 Score =  443 bits (1139), Expect = e-122,   Method: Composition-based stats.
 Identities = 215/430 (50%), Positives = 282/430 (65%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP+  D AL +R L   S  IL++DE  R  I   E  +A +N  S  +G 
Sbjct: 1   MHDIRAIRENPDRFDTALARRGLSALSGEILAIDEARRSKILAAETAQAEQNRASKDVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  + L+   +  K ++  L +E     + L+ ++  +PN+PL++VP G   +
Sbjct: 61  AKARGDEAEFERLRALVAEKKAEIARLNEEAAAEDARLRDMLVALPNLPLDDVPDGPDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ IR  G   +     +EHFEI      MDF  A KLSG+RF +LTG +  + RAL Q
Sbjct: 121 ANVEIRRWGAPRNFSFTPKEHFEIAGVKPGMDFATAAKLSGSRFVMLTGAVIRVHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H +EHG TE   P+LV+DEAM+GTGQ+PKF++D + TT+G WLIPT+EV+LTN  
Sbjct: 181 FMLDTHVAEHGLTETWTPVLVKDEAMFGTGQLPKFSEDSYQTTNGWWLIPTAEVTLTNTV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI+E   LP+R T     FRSEAGSAG+DT GMLRQHQF K E+VSIT  E S  EHE
Sbjct: 241 AGEILEEAQLPIRMTAHTQCFRSEAGSAGKDTAGMLRQHQFEKVEMVSITTPETSRAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE IL++L L YR + LCTGD+GF A +T+DLEVWL GQN YREISS S CG+FQ
Sbjct: 301 RMTRCAEAILEKLGLPYRTIVLCTGDMGFGATRTHDLEVWLPGQNTYREISSVSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R+R       +F HTLNGSG+AVGRCLIA+LEN    DG+V +P VL PY+   
Sbjct: 361 ARRMNARFRPAGGGKPEFVHTLNGSGLAVGRCLIAVLENGQQEDGAVELPAVLHPYLGGK 420

Query: 421 AVIKKEHILE 430
             I  +  LE
Sbjct: 421 GRIAADGTLE 430


>gi|161503911|ref|YP_001571023.1| seryl-tRNA synthetase [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|189083583|sp|A9MHZ1|SYS_SALAR RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|160865258|gb|ABX21881.1| hypothetical protein SARI_02001 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 430

 Score =  443 bits (1139), Expect = e-122,   Method: Composition-based stats.
 Identities = 198/431 (45%), Positives = 269/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L    E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVNTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRREVNKLGEELDAAKAELEALLAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEIRDHVTLGEMHSGLDFAAAVKLTGSRFVVMRGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNHDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIIDEDQLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNIWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|221638196|ref|YP_002524458.1| seryl-tRNA synthetase [Rhodobacter sphaeroides KD131]
 gi|221158977|gb|ACL99956.1| Seryl-tRNA synthetase [Rhodobacter sphaeroides KD131]
          Length = 430

 Score =  443 bits (1139), Expect = e-122,   Method: Composition-based stats.
 Identities = 214/430 (49%), Positives = 279/430 (64%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+ P+  D AL +R L   S  IL++DE  R  I   +  +A +N  S ++G 
Sbjct: 1   MHDIRIIREFPDRFDTALSRRGLSALSGEILAIDEARRSKILAADTAQAEQNRASKEVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  + L+   +  K ++  L +E     + L+ ++  IPN+PL+EVP G   +
Sbjct: 61  AKARGDEAEFERLRALLAEKKAEVARLNEEAAAEDARLRDMLVAIPNLPLDEVPEGPDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ IR  G         +EHFEI      MDF  A K+SG+RF +L G +  + RAL Q
Sbjct: 121 ANVEIRRWGTPRGFNFAPKEHFEIAGVKPGMDFATAAKISGSRFVMLKGAVIRVHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H +EHG TE   P+LV+DEAM+GTGQ+PKF++D + TT+G WLIPTSEV+LTN  
Sbjct: 181 FMLDTHVTEHGLTETWTPVLVKDEAMFGTGQLPKFSEDSYQTTNGWWLIPTSEVTLTNSV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI++   LP+R T     FRSEAGSAG+DT GMLRQHQF K E+VSIT  E S  EHE
Sbjct: 241 AGEILDEAQLPIRMTAHTQCFRSEAGSAGKDTSGMLRQHQFEKVEMVSITTPETSLAEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE IL++L L YR + LCTGD+GF A KT+DLEVWL GQN YREISS S CG+FQ
Sbjct: 301 RMTGCAEAILQKLGLPYRTIVLCTGDMGFGATKTHDLEVWLPGQNTYREISSVSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R+R       +F HTLNGSG+AVGRCLIA+LEN    DGSV +P  L PY+   
Sbjct: 361 ARRMNARFRPAGGGKPEFVHTLNGSGLAVGRCLIAVLENGQQEDGSVELPEALHPYLGGK 420

Query: 421 AVIKKEHILE 430
             I  +  LE
Sbjct: 421 TRISADGTLE 430


>gi|218887314|ref|YP_002436635.1| seryl-tRNA synthetase [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|226701585|sp|B8DQP8|SYS_DESVM RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|218758268|gb|ACL09167.1| seryl-tRNA synthetase [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 425

 Score =  443 bits (1138), Expect = e-122,   Method: Composition-based stats.
 Identities = 191/427 (44%), Positives = 271/427 (63%), Gaps = 3/427 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++ ++++PE +  AL  R          +LDE+ R L+ ++E ++  RN  S ++ +
Sbjct: 1   MLDLKLLQRSPEVVAKALADRGSSLDMAEFTALDERRRALLAEVEALKGERNKASGEVAR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G       L    S L +++  L++E  EV +++   +  +PN+P   VP G S  
Sbjct: 61  MKRAG--EDAAPLLERLSGLSDRIKDLDRETEEVKAAVNDWLLAVPNIPDASVPFGRSEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N  +   G+  +     +EH+EIG ALG +DF+RA KL+G+RF+V     A +ERAL  
Sbjct: 119 DNPEVLRWGEPRAFSFAPKEHWEIGTALGGLDFERAGKLAGSRFAVYRTWAARMERALAN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-TTDGRWLIPTSEVSLTNL 239
           F +D H +EHGY E+  P +V  + M GTGQ+PKF +D+F       +LIPT+EV LTNL
Sbjct: 179 FFLDTHVTEHGYVEIIPPFMVNRKTMTGTGQLPKFEEDLFKLEGWDYFLIPTAEVPLTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           ++ +++E   LP+ +  + P FRSEAGS G+DTRG++RQHQF K E+V     E SF E 
Sbjct: 239 HADDVLEEAQLPMGYAAMTPCFRSEAGSYGKDTRGLIRQHQFTKVEMVRFAHPERSFDEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E+M   AE +L+RL L YRV++LCTGD+GFS+ KTYD+EVWL GQN YREISSCS CG+F
Sbjct: 299 EKMRGHAEVLLQRLGLPYRVITLCTGDMGFSSAKTYDIEVWLPGQNAYREISSCSNCGDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR   R+R       +F HTLNGSG+AVGR L+A++ENY   DGSV IP VLRPYM  
Sbjct: 359 QARRAGIRFRPAGGGKPEFAHTLNGSGLAVGRALVAVIENYQQEDGSVVIPEVLRPYMGG 418

Query: 420 LAVIKKE 426
           +  +  E
Sbjct: 419 MERVTAE 425


>gi|323700066|ref|ZP_08111978.1| seryl-tRNA synthetase [Desulfovibrio sp. ND132]
 gi|323459998|gb|EGB15863.1| seryl-tRNA synthetase [Desulfovibrio desulfuricans ND132]
          Length = 425

 Score =  443 bits (1138), Expect = e-122,   Method: Composition-based stats.
 Identities = 201/427 (47%), Positives = 280/427 (65%), Gaps = 4/427 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++ +++NP+ +  +L+KRH +        LDE+ + LI ++E ++A +N+   +I +
Sbjct: 1   MLDLKLMQKNPDLVRASLEKRHSKIDVREFTDLDERRKQLIGEVESLKAEKNAVGPEIAK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G       L  +   + E+   L++E  EV  + +  +  +PN+P E VP+G    
Sbjct: 61  RKKAG--EDASDLLEKMGRVAERTKELDRELAEVEKAEQDWMMSVPNIPHESVPLGAGEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N ++R  G+KP      +EH+EIG ALG +DF+ A KL+GARFS+  G  A LERAL Q
Sbjct: 119 DNPVLRYWGEKPVMDFEPKEHWEIGTALGGLDFECAAKLAGARFSISFGWCARLERALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGR--WLIPTSEVSLTN 238
            M+D  T  HGYTEV  P +V  + M GTGQ+PKF +D+F  TD R  +LIPT+EV LTN
Sbjct: 179 LMLDTQTERHGYTEVLPPFMVNRKTMTGTGQLPKFEEDLFKLTDEREFYLIPTAEVPLTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           +Y+ E+I  + LP++F    P FRSEAGS G+DT+G++RQHQF+K E+V+    + S+  
Sbjct: 239 IYADEVIPEEKLPVKFCAQTPCFRSEAGSYGKDTKGLIRQHQFYKVEMVNFAHPDHSYEA 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E M   AE IL+ L LHYR + LCTGD+GFSA KTYD+EVWL GQ  YREISSCS C +
Sbjct: 299 LEEMTHSAERILEILGLHYRTIVLCTGDMGFSAAKTYDIEVWLPGQGKYREISSCSNCED 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R++  +SK   + HTLNGSG+AVGRCL+A+LENY  ADGS+ IP  LRPYM 
Sbjct: 359 FQARRANIRFQPKDSKKKLYPHTLNGSGLAVGRCLVAVLENYQQADGSLVIPEALRPYMG 418

Query: 419 NLAVIKK 425
            L V+  
Sbjct: 419 GLEVVTP 425


>gi|317120858|ref|YP_004100861.1| seryl-tRNA synthetase [Thermaerobacter marianensis DSM 12885]
 gi|315590838|gb|ADU50134.1| seryl-tRNA synthetase [Thermaerobacter marianensis DSM 12885]
          Length = 425

 Score =  443 bits (1138), Expect = e-122,   Method: Composition-based stats.
 Identities = 200/427 (46%), Positives = 277/427 (64%), Gaps = 4/427 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++++RQNPE +  AL++R L+P + + +L  D + R  ++++E++RARRN  S  IG
Sbjct: 1   MLDLRFVRQNPEVVREALRRRRLDPAELDALLDADARWRQDLQQLEELRARRNQTSEAIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           +   EG  +    L      + + +  LE+    +   ++  +  IP +P  +VP G  A
Sbjct: 61  RLRREG--ADASELIAAMRQVGDSIKELEERVRGLEQEIQDRLLRIPMIPDPDVPEGDDA 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+ +R  G  PS     + H+E+G ALGL+DF+RA K++GARF+V  G  A L RAL 
Sbjct: 119 DDNVEVRRWGTPPSFDFTPKAHWELGPALGLLDFERAAKITGARFTVFRGRGARLVRALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-TDGRWLIPTSEVSLTN 238
           QFM+DLHT EHGYTEV  P LV  ++M GTGQ+PKF +D F       +L+PT+EV +TN
Sbjct: 179 QFMLDLHTQEHGYTEVLPPFLVHRQSMVGTGQLPKFEEDAFRVADSDFFLVPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           LY  EI++   LP+      P FR+EAGSAGRDTRG++RQHQF K ELV     + S  E
Sbjct: 239 LYRDEILDGAQLPIYHVAYTPCFRAEAGSAGRDTRGLIRQHQFDKVELVKFVHPDRSAEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
           HE++++ AE +L+RL L YR+V +CTGD+GF+  K YDLEVW+     Y EISSCS   +
Sbjct: 299 HEKLVADAEAVLQRLGLPYRLVLICTGDMGFAQAKQYDLEVWMPSYGRYVEISSCSNYRD 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           +Q+RR N R+R       +F HTLNGSG+AVGR L A+LENY  ADGSV IP  LRPYM 
Sbjct: 359 YQARRANIRFRPEPGARPQFVHTLNGSGLAVGRTLAALLENYQQADGSVVIPEALRPYMG 418

Query: 419 NLAVIKK 425
            L V+K 
Sbjct: 419 GLDVLKP 425


>gi|77360652|ref|YP_340227.1| seryl-tRNA synthetase [Pseudoalteromonas haloplanktis TAC125]
 gi|123588222|sp|Q3IH21|SYS_PSEHT RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|76875563|emb|CAI86784.1| serine tRNA synthetase [Pseudoalteromonas haloplanktis TAC125]
          Length = 434

 Score =  443 bits (1138), Expect = e-122,   Method: Composition-based stats.
 Identities = 196/436 (44%), Positives = 273/436 (62%), Gaps = 12/436 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD +++RQ+ E     L  R  E     + +L+EK + L  K ++++++RN+++  IGQ
Sbjct: 1   MLDSKFLRQDIEQTAARLAARGYELDVATVTALEEKRKTLQVKTQELQSQRNASAKAIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G       L +  + L  +L   + ++  V +++  +   IPN+P E VP G   +
Sbjct: 61  AKAKG--EDAQPLLDAVANLGSELDAAKAQQDVVLAAINDIALAIPNLPDESVPAGKDED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I + G         ++H ++G+ L  +DF+   K+SGARF+V+ G +A + RAL Q
Sbjct: 119 DNVEILTWGTPKKFDFDVKDHVDVGQDLNGLDFEMGVKISGARFTVMRGQVARMHRALTQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT----------TDGRWLIP 230
           +M+D HT ++GYTE+  P LV   ++YGT Q+PKFA D+F T            G  LIP
Sbjct: 179 YMLDTHTDKNGYTEMYVPYLVNSASLYGTSQLPKFAGDLFHTLGLVNDDGEQQSGFSLIP 238

Query: 231 TSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT 290
           T+EV LTN    EI +   LP+R T   P FRSEAGS GRDTRG++RQHQF K ELV + 
Sbjct: 239 TAEVPLTNSARDEIYDESDLPIRLTAHTPCFRSEAGSYGRDTRGLIRQHQFDKVELVQLV 298

Query: 291 REEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREI 350
           + EDS    E +   AE+IL+ L+L YR V LC GD+GF + KTYDLEVWL  QN YREI
Sbjct: 299 KPEDSMATLEELTGHAEQILQELELPYRKVILCMGDMGFGSAKTYDLEVWLPAQNTYREI 358

Query: 351 SSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIP 410
           SSCS   +FQ+RRM +R+R   +K  +  HTLNGSG+AVGR L+AILENY  ADGSV +P
Sbjct: 359 SSCSNMADFQARRMQARFRREGAKKPELLHTLNGSGLAVGRTLVAILENYQQADGSVVVP 418

Query: 411 TVLRPYMNNLAVIKKE 426
            VLRPYM  L VI K+
Sbjct: 419 EVLRPYMGGLEVIGKQ 434


>gi|146311074|ref|YP_001176148.1| seryl-tRNA synthetase [Enterobacter sp. 638]
 gi|166987313|sp|A4W8R7|SYS_ENT38 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|145317950|gb|ABP60097.1| seryl-tRNA synthetase [Enterobacter sp. 638]
          Length = 430

 Score =  443 bits (1138), Expect = e-122,   Method: Composition-based stats.
 Identities = 197/431 (45%), Positives = 268/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVQTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN P + VP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDQAKTELELLLAEIRDIALAIPNTPDDSVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ ++  G         R+H  +GE    +DF  A KL+GARF V+ G +AHL RAL Q
Sbjct: 119 DNVEVKRWGTPREFDFEVRDHVTLGEMHAGLDFAAAVKLTGARFVVMKGQIAHLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSETYVPYLVNHDTLYGTGQLPKFAGDLFHTRPLDEEAESSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T  +P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIIDEDDLPIKLTAHSPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E S    E M   AE++L+ L L YR ++LCTGD+GF A KT+DLEVW+  QN YREISS
Sbjct: 299 EVSMDALEEMTGHAEKVLELLGLPYRRMALCTGDMGFGATKTFDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS  G+FQ+RRM +R R    K  +  HTLNGSG+AVGR L+A++ENY  ADG + IP V
Sbjct: 359 CSNVGDFQARRMQARCRTKADKKTRLVHTLNGSGLAVGRALVAVMENYQQADGRIEIPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM     I
Sbjct: 419 LRPYMKGQQYI 429


>gi|149913919|ref|ZP_01902451.1| seryl-tRNA synthetase [Roseobacter sp. AzwK-3b]
 gi|149812203|gb|EDM72034.1| seryl-tRNA synthetase [Roseobacter sp. AzwK-3b]
          Length = 430

 Score =  442 bits (1137), Expect = e-122,   Method: Composition-based stats.
 Identities = 209/429 (48%), Positives = 278/429 (64%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D A+ +R LE  S+ IL+LDE  R  I   E  +A +NS S  +G 
Sbjct: 1   MHDIRAIRENPAAFDAAMARRGLEQASDEILALDEARRACIHAAETAQAEQNSASKDVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  D L+   S  K ++  ++ E  ++   L  L+  +PN+PL+E+P G    
Sbjct: 61  AKARGDEAEFDRLRALVSDKKSEVARMQAEAKDLDQRLTDLLMGLPNLPLDEIPDGQDEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I   G   S     +EHFEI   +  MDF+   KLSGARF V+ G +A + RAL Q
Sbjct: 121 DNVEIHRWGTPASFDFPPKEHFEIPGVIPGMDFEAGAKLSGARFVVMQGAVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H  E+G  E   P+LVR++ MYGTG +PKF +D + TT+G WL+PT+EV+LTNL 
Sbjct: 181 FMLDTHIEENGLLETWTPVLVREDMMYGTGNLPKFGEDSYQTTNGWWLVPTAEVTLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             + +E  +LP R+      FRSEAGSAG+DT GMLRQHQF K E+VSIT  + S  E +
Sbjct: 241 HGDTVEEATLPRRYAAHTQCFRSEAGSAGKDTAGMLRQHQFEKVEMVSITHPDHSRAELD 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CA+ IL+RL L YR V LCTGD+GF A +T+D+EVWL GQN YREISS S CG FQ
Sbjct: 301 RMTGCAQGILERLGLPYRTVVLCTGDMGFGARRTHDIEVWLPGQNTYREISSVSLCGEFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM +R+R       +F HTLNGSG+AVGRCLIA+LEN   ADGSV +P VL PY+   
Sbjct: 361 ARRMTARFRPAGGGKPQFVHTLNGSGLAVGRCLIAVLENGQQADGSVALPAVLHPYLGGR 420

Query: 421 AVIKKEHIL 429
           +V++ +  L
Sbjct: 421 SVLQADGTL 429


>gi|153009670|ref|YP_001370885.1| seryl-tRNA synthetase [Ochrobactrum anthropi ATCC 49188]
 gi|151561558|gb|ABS15056.1| seryl-tRNA synthetase [Ochrobactrum anthropi ATCC 49188]
          Length = 442

 Score =  442 bits (1137), Expect = e-122,   Method: Composition-based stats.
 Identities = 257/426 (60%), Positives = 320/426 (75%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NPE LD AL KR  +  S  +++LDEK R  + K++  + RRN+ S +IG+
Sbjct: 16  MLDIKWIRENPETLDKALAKRGAQSLSSELMALDEKRREYVGKVQAAQERRNAASKEIGK 75

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  + +  D LK E + LK+ L   E EE  +   L   +S IPN+PLE+VP+G   +
Sbjct: 76  AMAAKDAATADKLKAEVAELKDFLAQAEDEERRLTKELNDALSTIPNIPLEDVPLGKDES 135

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R VG + +     +EHFE+GEALG MDF+RA KL+G+RF+VL G LA LERALGQ
Sbjct: 136 DNVEVRRVGNQRNFAFQPKEHFELGEALGYMDFERAAKLAGSRFTVLKGSLARLERALGQ 195

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT EHGYTE   PL+VRDEA+YGTGQ+PKF++D+F TTDGRWLIPT+EV LTNL 
Sbjct: 196 FMLDLHTMEHGYTETMPPLMVRDEAVYGTGQLPKFSEDLFRTTDGRWLIPTAEVPLTNLV 255

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI+++KSLP R+T L P FRSEAGSAGRDTRGMLRQHQF K E+VSIT  + S  EHE
Sbjct: 256 ADEIVDTKSLPQRYTALTPCFRSEAGSAGRDTRGMLRQHQFLKVEMVSITDADSSIAEHE 315

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CAEE+LKRL L +R V LCTGD+GF A KTYD+EVWL GQN YREISSCS CG+FQ
Sbjct: 316 RMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQKTYDIEVWLPGQNTYREISSCSVCGDFQ 375

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
            RRMN+RYR    KS +F HTLNGSGVAVGR LIA++ENY   DGS+ IP  L+PYM  L
Sbjct: 376 GRRMNARYRPEGEKSTRFVHTLNGSGVAVGRALIAVMENYQEEDGSIHIPEALQPYMGGL 435

Query: 421 AVIKKE 426
             I+K 
Sbjct: 436 TRIEKT 441


>gi|15605830|ref|NP_213207.1| seryl-tRNA synthetase [Aquifex aeolicus VF5]
 gi|3915066|sp|O66647|SYS_AQUAE RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|2982982|gb|AAC06595.1| seryl-tRNA synthetase [Aquifex aeolicus VF5]
          Length = 425

 Score =  442 bits (1137), Expect = e-122,   Method: Composition-based stats.
 Identities = 206/429 (48%), Positives = 283/429 (65%), Gaps = 7/429 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP--QSEYILSLDEKNRILIKKIEDIRARRNSNSAQI 58
           M+DI  IR+ P+++   L  R  E     + +L LD++ R +IK++E +R+ RN  S +I
Sbjct: 1   MIDINLIREKPDYVKERLATRDKELVSLVDKVLELDKRRREIIKRLEALRSERNKLSKEI 60

Query: 59  GQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTS 118
           G+   EG  +    ++N    LKE++  LE+E  +V   LK  +  IPN+P   VP+G  
Sbjct: 61  GKLKREGKDT--TEIQNRVKELKEEIDRLEEELRKVEEELKNTLLWIPNLPHPSVPVGED 118

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
             +N+ +R  G+        + H+EIGE LG++DF R  KLSG+RF+V+ G  A LERAL
Sbjct: 119 EKDNVEVRRWGEPRKFDFEPKPHWEIGERLGILDFKRGAKLSGSRFTVIAGWGARLERAL 178

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGRWLIPTSEVSLT 237
             FM+DLHT + GY E+  P LV+ E + GTGQ+PKF +D++ C  D  +LIPT+EV LT
Sbjct: 179 INFMLDLHT-KKGYKEICPPHLVKPEILIGTGQLPKFEEDLYKCERDNLYLIPTAEVPLT 237

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           NLY  EI++ ++LP+  T   P +R EAG+ G+D RG++RQHQF K ELV I   + S+ 
Sbjct: 238 NLYREEILKEENLPIYLTAYTPCYRREAGAYGKDIRGIIRQHQFDKVELVKIVHPDTSYD 297

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E E+++  AEE+L+ L L YRVV LCTGDLGFSA KTYD+EVW   QN YREISSCS C 
Sbjct: 298 ELEKLVKDAEEVLQLLGLPYRVVELCTGDLGFSAAKTYDIEVWFPSQNKYREISSCSNCE 357

Query: 358 NFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +FQ+RRMN+R++D  +   +F HTLNGSG+AVGR L AILENY   DGSV +P VLR Y+
Sbjct: 358 DFQARRMNTRFKDSKTGKNRFVHTLNGSGLAVGRTLAAILENYQQEDGSVVVPEVLRDYV 417

Query: 418 NNLAVIKKE 426
               VI+ E
Sbjct: 418 -GTDVIRPE 425


>gi|110634154|ref|YP_674362.1| seryl-tRNA synthetase [Mesorhizobium sp. BNC1]
 gi|123353591|sp|Q11HC8|SYS_MESSB RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|110285138|gb|ABG63197.1| seryl-tRNA synthetase [Chelativorans sp. BNC1]
          Length = 431

 Score =  442 bits (1137), Expect = e-122,   Method: Composition-based stats.
 Identities = 254/432 (58%), Positives = 323/432 (74%), Gaps = 6/432 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQ-----SEYILSLDEKNRILIKKIEDIRARRNSNS 55
           MLDI+WIR+N + L +AL+KR  E        E  ++ DE  R  + K+++ + +RN+ S
Sbjct: 1   MLDIRWIRENADALVLALRKRGQEEAAARSTVEEAIAADEARRTHLTKLQEAQEQRNAAS 60

Query: 56  AQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
            +IG+A+A G+    + LK E + LK  +   E +E  + + L+ L++ IPN+PL++VP+
Sbjct: 61  KEIGKALAAGDKEKAERLKAEVAELKGFIQDGEAQERALDNRLRDLLARIPNIPLDDVPV 120

Query: 116 GTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLE 175
           G   N+N+ IR VG+       ++EHFEIGEALGLMDF+RA KLSGARF+VLTG LA LE
Sbjct: 121 GADENDNVEIRRVGEARQPN-WAKEHFEIGEALGLMDFERAAKLSGARFTVLTGTLARLE 179

Query: 176 RALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVS 235
           RALGQFM+DLHT+EHGYTEV  PLLVRDEA++GTGQ+PKF +D+F TTDGRW+IPT+EV 
Sbjct: 180 RALGQFMLDLHTTEHGYTEVQPPLLVRDEALFGTGQLPKFDEDLFRTTDGRWMIPTAEVP 239

Query: 236 LTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDS 295
           LTNL   EI++ + LPLR+T L P FRSEAGSAGRDTRGMLRQHQF+K ELVSIT  E +
Sbjct: 240 LTNLVREEILDGEKLPLRYTALTPCFRSEAGSAGRDTRGMLRQHQFYKVELVSITDAESA 299

Query: 296 FTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCST 355
             EHERM +CAEE+LKRL L +R V LCTGD+GF A KTYD+EVWL GQ  YREISSCS 
Sbjct: 300 LAEHERMTACAEEVLKRLGLPFRTVVLCTGDMGFGAQKTYDIEVWLPGQKTYREISSCSV 359

Query: 356 CGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRP 415
           CG+FQ+RRMN+RYR    K  +F HTLNGSGVAVGR LIA++ENY N DGS++IP +L+P
Sbjct: 360 CGDFQARRMNARYRAAGDKQARFVHTLNGSGVAVGRALIAVMENYQNEDGSISIPEILQP 419

Query: 416 YMNNLAVIKKEH 427
           YM  L  I+   
Sbjct: 420 YMGGLKKIEARG 431


>gi|224582773|ref|YP_002636571.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|254783044|sp|C0PXT0|SYS_SALPC RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|224467300|gb|ACN45130.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
          Length = 430

 Score =  442 bits (1137), Expect = e-122,   Method: Composition-based stats.
 Identities = 198/431 (45%), Positives = 269/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L    E+++A RNS S  IGQ
Sbjct: 1   MLDSNLLRNEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVNTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDTLLAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEIRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNHDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIIDEDQLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|78043693|ref|YP_361479.1| seryl-tRNA synthetase [Carboxydothermus hydrogenoformans Z-2901]
 gi|123770534|sp|Q3A8Q5|SYS_CARHZ RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|77995808|gb|ABB14707.1| seryl-tRNA synthetase [Carboxydothermus hydrogenoformans Z-2901]
          Length = 424

 Score =  442 bits (1136), Expect = e-122,   Method: Composition-based stats.
 Identities = 205/427 (48%), Positives = 279/427 (65%), Gaps = 4/427 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+ +RQNPE +  ALKKR      +  L LDE+ R L+  +E  + +RN+ S +IG+
Sbjct: 1   MLDIKKVRQNPEIVVEALKKRGANLNLDEFLRLDEERRKLLVDVEQKKYKRNTVSEEIGR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G  +  D L  E   L +++  L+ E  ++   L  ++  IPN+P E VP+G  ++
Sbjct: 61  LKKQGLPA--DDLILEMRALSDEIKKLDDEVAQIEEKLHAILLTIPNIPHESVPVGKDSS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G+        + H+EIGE L ++DF R +K++GARF+   G  A LERA+  
Sbjct: 119 ENVEVRRWGEPRKFTFTPKAHWEIGEELDILDFARGSKVTGARFTFYKGLGAMLERAVIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-TTDGRWLIPTSEVSLTNL 239
           FM+DLHT EHGY EV  P +V  ++M GTGQ+PKFA+DMF       +LIPT+EV +TNL
Sbjct: 179 FMLDLHTREHGYVEVFPPFIVNADSMMGTGQLPKFAEDMFKLEGLNYYLIPTAEVPVTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y  EI++   LP+     +  FR+EAG+AGRDTRG++RQHQF K ELV   + E+S+ E 
Sbjct: 239 YREEILDGDKLPIYHCAYSACFRAEAGAAGRDTRGLIRQHQFNKVELVKFVKPENSYEEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++   AE +L+ L L YRVV LCTGDLGFSA KTYD+EVWL   N Y+EISSCS   +F
Sbjct: 299 EKLTRDAERVLQLLGLPYRVVVLCTGDLGFSAAKTYDIEVWLPSYNDYKEISSCSNFEDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR   RY++      +F HTLNGSG+AVGR + AILENY N DGSVT+P VLRPYM  
Sbjct: 359 QARRAKIRYKEHPKAKPEFVHTLNGSGLAVGRTVAAILENYQNEDGSVTVPEVLRPYM-G 417

Query: 420 LAVIKKE 426
           +  I K+
Sbjct: 418 VDRIYKK 424


>gi|194099100|ref|YP_002002185.1| seryl-tRNA synthetase [Neisseria gonorrhoeae NCCP11945]
 gi|239999406|ref|ZP_04719330.1| seryl-tRNA synthetase [Neisseria gonorrhoeae 35/02]
 gi|240017028|ref|ZP_04723568.1| seryl-tRNA synthetase [Neisseria gonorrhoeae FA6140]
 gi|240081336|ref|ZP_04725879.1| seryl-tRNA synthetase [Neisseria gonorrhoeae FA19]
 gi|240116105|ref|ZP_04730167.1| seryl-tRNA synthetase [Neisseria gonorrhoeae PID18]
 gi|240118389|ref|ZP_04732451.1| seryl-tRNA synthetase [Neisseria gonorrhoeae PID1]
 gi|240126134|ref|ZP_04739020.1| seryl-tRNA synthetase [Neisseria gonorrhoeae SK-92-679]
 gi|240128611|ref|ZP_04741272.1| seryl-tRNA synthetase [Neisseria gonorrhoeae SK-93-1035]
 gi|260440085|ref|ZP_05793901.1| seryl-tRNA synthetase [Neisseria gonorrhoeae DGI2]
 gi|268595226|ref|ZP_06129393.1| seryl-tRNA synthetase [Neisseria gonorrhoeae 35/02]
 gi|268597438|ref|ZP_06131605.1| seryl-tRNA synthetase [Neisseria gonorrhoeae FA19]
 gi|268601771|ref|ZP_06135938.1| seryl-tRNA synthetase [Neisseria gonorrhoeae PID18]
 gi|268604101|ref|ZP_06138268.1| seryl-tRNA synthetase [Neisseria gonorrhoeae PID1]
 gi|268684720|ref|ZP_06151582.1| seryl-tRNA synthetase [Neisseria gonorrhoeae SK-92-679]
 gi|268686999|ref|ZP_06153861.1| seryl-tRNA synthetase [Neisseria gonorrhoeae SK-93-1035]
 gi|291043373|ref|ZP_06569096.1| seryl-tRNA synthetase [Neisseria gonorrhoeae DGI2]
 gi|238690216|sp|B4RN50|SYS_NEIG2 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|193934390|gb|ACF30214.1| seryl-tRNA synthetase [Neisseria gonorrhoeae NCCP11945]
 gi|268548615|gb|EEZ44033.1| seryl-tRNA synthetase [Neisseria gonorrhoeae 35/02]
 gi|268551226|gb|EEZ46245.1| seryl-tRNA synthetase [Neisseria gonorrhoeae FA19]
 gi|268585902|gb|EEZ50578.1| seryl-tRNA synthetase [Neisseria gonorrhoeae PID18]
 gi|268588232|gb|EEZ52908.1| seryl-tRNA synthetase [Neisseria gonorrhoeae PID1]
 gi|268625004|gb|EEZ57404.1| seryl-tRNA synthetase [Neisseria gonorrhoeae SK-92-679]
 gi|268627283|gb|EEZ59683.1| seryl-tRNA synthetase [Neisseria gonorrhoeae SK-93-1035]
 gi|291012979|gb|EFE04962.1| seryl-tRNA synthetase [Neisseria gonorrhoeae DGI2]
 gi|317164654|gb|ADV08195.1| seryl-tRNA synthetase [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 431

 Score =  442 bits (1136), Expect = e-122,   Method: Composition-based stats.
 Identities = 202/433 (46%), Positives = 277/433 (63%), Gaps = 9/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L +R  +  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLARRGYDFDTARFDALEERRKSVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPPGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-------TTDGRWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F        T   ++LIPT+E
Sbjct: 180 FMLDTHTLQHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVAGSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYGALEEMVGHAENILKALELPYRVITLCTGDMGFSAAKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIKKE 426
           +PYM  +  ++ +
Sbjct: 419 QPYMGGVTKLEVK 431


>gi|84503428|ref|ZP_01001488.1| seryl-tRNA synthetase [Oceanicola batsensis HTCC2597]
 gi|84388215|gb|EAQ01167.1| seryl-tRNA synthetase [Oceanicola batsensis HTCC2597]
          Length = 429

 Score =  442 bits (1136), Expect = e-122,   Method: Composition-based stats.
 Identities = 209/429 (48%), Positives = 281/429 (65%), Gaps = 1/429 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP+  D AL +R + P S  IL+LDEK R  I   E  +A +N++S +IG+
Sbjct: 1   MHDIRAIRDNPDAFDAALARRGVSPLSSEILALDEKRRACIHAAESAQADQNASSKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  + L+   +  K+++  ++ E  +    L  ++  IPN+P ++VP G   +
Sbjct: 61  AKASGDEAEFERLRALVAAKKDEVARMQAEAKDWDRKLTDMLMGIPNLPHDDVPDGADED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N  +R  G  P       EH+E+      MDF+ A KLSG+RF VL+G +A + RAL Q
Sbjct: 121 DNAELRRHGTPPEFAFKPLEHYELPGVQEGMDFETAAKLSGSRFVVLSGAVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H SE+G TE   P+LV++E MYGTGQ+PKF +D + T +G WL+PT+EV+LTN+ 
Sbjct: 181 FMLDTHVSENGLTETWTPVLVKEEMMYGTGQLPKFGEDSYRTREGWWLVPTAEVTLTNIV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           +  +I    LP R+      FRSEAGSAGRDT GMLRQHQF K E+VSITR E+S  E +
Sbjct: 241 NDVMIADSYLPRRYVAHTQCFRSEAGSAGRDTAGMLRQHQFEKVEMVSITRPEESRAELD 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE IL+RL L +R V LCTGD+GF A +T+D+EVWL GQN YREISS S CG+FQ
Sbjct: 301 RMTDCAEGILRRLGLAFRTVVLCTGDMGFGARRTHDIEVWLPGQNAYREISSVSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR    K   + HTLNGSG+AVGRCLIA+LEN    DGSV +P  L P++   
Sbjct: 361 ARRMNARYRPEGGK-PDYVHTLNGSGLAVGRCLIAVLENGQCEDGSVALPEALHPWLGGK 419

Query: 421 AVIKKEHIL 429
             +  E  L
Sbjct: 420 TTLTAEGQL 428


>gi|304397062|ref|ZP_07378941.1| seryl-tRNA synthetase [Pantoea sp. aB]
 gi|304355211|gb|EFM19579.1| seryl-tRNA synthetase [Pantoea sp. aB]
          Length = 430

 Score =  442 bits (1136), Expect = e-122,   Method: Composition-based stats.
 Identities = 200/431 (46%), Positives = 269/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   E + SL+E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGYKLDVETLRSLEERRKVLQVETENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E  E+ + ++     +PN+P +EVP+G   +
Sbjct: 61  AKARG--EDIEPLRQEVNALGERLDAAKAELDELQNQIRDFALAMPNIPADEVPLGKDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN  +   G         ++H E+GEA   +DF  A KL+G+RF V+ G +A L RAL Q
Sbjct: 119 ENQEVSRWGTPREFSFQVKDHVELGEAAKGLDFAAAVKLTGSRFVVMQGQIARLHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FMIDLHT +HGY E S P LV    +YGTGQ+PKF +D+F T             LIPT+
Sbjct: 179 FMIDLHTEQHGYLETSVPYLVNHATLYGTGQLPKFGEDLFHTRPLEEESDSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI+E  +LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I   
Sbjct: 239 EVPLTNLVRDEILEEDTLPVKLTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVTP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E S    E +   AE++L+ L+L YR V LCTGD+GF A KTYDLEVWL  QN YREISS
Sbjct: 299 EQSMEALEELTGHAEKVLQLLNLPYRKVLLCTGDMGFGATKTYDLEVWLPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS  G+FQ+RRM +R R+   K  +  HTLNGSG+AVGR L+A+LENY   DG + +P V
Sbjct: 359 CSNMGDFQARRMQARCRNKQDKKPRLVHTLNGSGLAVGRTLVAVLENYQQEDGRIAVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  + +I
Sbjct: 419 LRPYMKGVEII 429


>gi|320175334|gb|EFW50440.1| Seryl-tRNA synthetase [Shigella dysenteriae CDC 74-1112]
          Length = 430

 Score =  442 bits (1136), Expect = e-122,   Method: Composition-based stats.
 Identities = 199/431 (46%), Positives = 270/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L  K E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLGALEERRKVLQVKTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTRPLEEEADTSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNRLEYI 429


>gi|296282871|ref|ZP_06860869.1| seryl-tRNA synthetase [Citromicrobium bathyomarinum JL354]
          Length = 427

 Score =  442 bits (1136), Expect = e-122,   Method: Composition-based stats.
 Identities = 229/428 (53%), Positives = 293/428 (68%), Gaps = 3/428 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI  IR+ PE  D AL +R  EP +  +L LD + R ++ +++D + RRN+ S  IGQ
Sbjct: 1   MHDIATIRREPEAFDAALARRGAEPVTARLLDLDTRRRAVLTELQDAQNRRNAASKAIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQ-LPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           A+  GN    D LK E + LK   LP LE++   + + +  +++ IPN+P E+VP G   
Sbjct: 61  AMGSGNTEEADRLKAEVTELKATTLPRLEEDARVLGAEMDDMLAAIPNLPAEDVPEGAGE 120

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            EN+ + + G+K       REH +IG  LG +DF+    ++GARF+ L G +A L RALG
Sbjct: 121 EENVELSTWGEKREFDFEPREHADIGPMLG-LDFEIGANIAGARFTFLRGGIARLHRALG 179

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNL 239
           QFM+D   +E+GY E + PLLVRD+A++GTGQ+PKFADD+F TTDGRWLIPT+EVSLTN 
Sbjct: 180 QFMLDRQVTENGYLECNPPLLVRDDAVFGTGQLPKFADDLFHTTDGRWLIPTAEVSLTNA 239

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
               IIE   LPLR T L P FRSEAG+AG+DTRG +RQHQF K ELVSI R EDS  EH
Sbjct: 240 VRGHIIEEAHLPLRMTALTPCFRSEAGAAGKDTRGFIRQHQFEKVELVSIVRPEDSEAEH 299

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           ERM  CAE +L+ L L YR + LCTGD+GF A KTYDLEVWL GQ  YREISSCS  G+F
Sbjct: 300 ERMTQCAEGVLQALGLPYRKMLLCTGDMGFGARKTYDLEVWLPGQGAYREISSCSNVGDF 359

Query: 360 QSRRMNSRYRDPNS-KSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           Q+RRM++RYR  +  K  +F HTLNGSG+AVGR L+A+LENY + DGS+ +P  L PYM 
Sbjct: 360 QARRMSARYRPESGDKKTEFVHTLNGSGLAVGRTLVAVLENYQSEDGSIDVPEALHPYMG 419

Query: 419 NLAVIKKE 426
            L  I  E
Sbjct: 420 GLTRISPE 427


>gi|87122208|ref|ZP_01078091.1| seryl-tRNA synthetase [Marinomonas sp. MED121]
 gi|86162528|gb|EAQ63810.1| seryl-tRNA synthetase [Marinomonas sp. MED121]
          Length = 435

 Score =  441 bits (1135), Expect = e-122,   Method: Composition-based stats.
 Identities = 196/430 (45%), Positives = 274/430 (63%), Gaps = 7/430 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+ +R +PE + + LKK+  E      + L+E+ + +  + E+++  RNS S +IG 
Sbjct: 1   MLDIKALRADPEAVALRLKKKGFELDVATFIGLEERRKSIQVETENLQQSRNSVSKEIGM 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+  G+      LK +T++L + L   +++   V   +  +++ IPN+P E VP G + +
Sbjct: 61  AMKSGDKDKAAELKAQTASLGDDLANAKEQLSLVQHEMDLILASIPNIPHESVPEGATED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +NI IR  G         ++H +IGE L  +DF+ A K++G+RF+V+   LA L RAL Q
Sbjct: 121 DNIEIRRWGDVREFSFEPKDHVDIGETLEQLDFEAAVKITGSRFAVMRQDLARLHRALTQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-------TDGRWLIPTSE 233
           FMI+ H  +HGYTEV  P LV + ++ GTGQ+PKF  D+F          +  +LIPT+E
Sbjct: 181 FMINTHADQHGYTEVYVPYLVNEHSLKGTGQLPKFEADLFKVPVDKESGNNDLYLIPTAE 240

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V +TNL   EI+    L  ++    P FRSEAGS GRDTRGM+RQHQF K ELV + R +
Sbjct: 241 VPVTNLVRDEILNDAELHKKYVAHTPCFRSEAGSYGRDTRGMIRQHQFEKVELVHVCRPD 300

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S    E +++ AE ILK+L+L YR V LC GDLGFSA KTYD+EVWL GQ  YREISSC
Sbjct: 301 RSEQVLEELITDAEAILKKLNLPYRTVILCGGDLGFSAHKTYDIEVWLPGQGKYREISSC 360

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S  G+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY N DGSV +P VL
Sbjct: 361 SNMGDFQARRMQARWRNPETGRPELAHTLNGSGLAVGRTLVAVLENYQNEDGSVNVPDVL 420

Query: 414 RPYMNNLAVI 423
            PYM     +
Sbjct: 421 IPYMGGKTKL 430


>gi|296445300|ref|ZP_06887259.1| seryl-tRNA synthetase [Methylosinus trichosporium OB3b]
 gi|296257255|gb|EFH04323.1| seryl-tRNA synthetase [Methylosinus trichosporium OB3b]
          Length = 440

 Score =  441 bits (1135), Expect = e-122,   Method: Composition-based stats.
 Identities = 244/440 (55%), Positives = 305/440 (69%), Gaps = 13/440 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+WIR N    D   ++R+L P S+ +L+LD+  R  I  ++  + RRN+ S +IG 
Sbjct: 1   MYDIKWIRDNAAAFDEGRRRRNLAPLSDSLLALDDSRRAAIGVLQAAQERRNAASKEIGL 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+ E + +  +ALK E + LKE  P LE+ E E  ++L K +S IPN PLE+VP G   N
Sbjct: 61  AMREKDAARAEALKAEVAKLKEDFPQLEQREREASAALDKALSEIPNTPLEQVPEGKDEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +   G+  +     +EHF+IGE L LMDF+ ATKLSGARF V  G +A LERAL Q
Sbjct: 121 ENVEVLRWGEPRNFDFPPKEHFDIGEGLRLMDFESATKLSGARFVVNKGPMARLERALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-------------TDGRW 227
           FM+DLHT +HGY EV+ PLLVRD+AM+GT Q+PKF DD F               T   W
Sbjct: 181 FMLDLHTDQHGYAEVAPPLLVRDDAMFGTAQLPKFRDDQFSVSAGRPSGDDPASETSDYW 240

Query: 228 LIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELV 287
           LIPT+EV LTNL    I++   LPLRFT     FR+EAG+AGRDTRGM+RQHQF+K ELV
Sbjct: 241 LIPTAEVPLTNLVRESILDESQLPLRFTAGTYCFRAEAGAAGRDTRGMIRQHQFYKVELV 300

Query: 288 SITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLY 347
           SIT  E S  EHERM  CAE++L+ L+L YR V+LCTGD+GF++ KTYDLEVWL GQ  Y
Sbjct: 301 SITTPEKSLEEHERMTGCAEKVLQLLELPYRKVTLCTGDMGFASQKTYDLEVWLPGQGKY 360

Query: 348 REISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSV 407
           REISSCS CG+FQ+RRMN+RYR  +SK+ +F HTLNGSGVAVGR L+A+LENY  ADGSV
Sbjct: 361 REISSCSVCGDFQARRMNARYRPADSKATRFVHTLNGSGVAVGRALVAVLENYQEADGSV 420

Query: 408 TIPTVLRPYMNNLAVIKKEH 427
           T+P VLRPYM  L  I K  
Sbjct: 421 TVPKVLRPYMGGLEKIAKAG 440


>gi|322832176|ref|YP_004212203.1| seryl-tRNA synthetase [Rahnella sp. Y9602]
 gi|321167377|gb|ADW73076.1| seryl-tRNA synthetase [Rahnella sp. Y9602]
          Length = 430

 Score =  441 bits (1135), Expect = e-122,   Method: Composition-based stats.
 Identities = 203/431 (47%), Positives = 269/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R   + +   L +R  +   E + S +E+ ++L  + E ++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNELDAVAEKLARRGFKLDVETLRSQEERRKVLQVETETLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E +TL E+L   + E   + + ++ + S IPN+P + VP G   N
Sbjct: 61  AKARG--EDIEPLRLEVNTLGEKLDAAKAELDALQNDIRDIASAIPNMPDDSVPAGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N  +   G         R+H  +GE  G +DF  A KL+GARF V+ G +A + RAL Q
Sbjct: 119 DNQEVSRWGTPRQYDFTVRDHVSLGEMAGGLDFAAAVKLTGARFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY E   P LV  E +YGTGQ+PKF +D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYLETYVPYLVNQETLYGTGQLPKFGEDLFHTKPLDEEAGSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI+E +SLPL+ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLTRDEILEEESLPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E +   AE++L+ L+L YR V LCTGD+GF +CKTYDLEVWL  Q+ YREISS
Sbjct: 299 EDSMDALEELTGHAEKVLQLLNLPYRKVLLCTGDMGFGSCKTYDLEVWLPAQDTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS  G+FQ+RRM +R R+   K  +  HTLNGSG+AVGR L+A+LENY  ADG + +P V
Sbjct: 359 CSNMGDFQARRMQARCRNKTDKKPRLVHTLNGSGLAVGRTLVAVLENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMGGLEYI 429


>gi|85372949|ref|YP_457011.1| seryl-tRNA synthetase [Erythrobacter litoralis HTCC2594]
 gi|122545406|sp|Q2NDM7|SYS_ERYLH RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|84786032|gb|ABC62214.1| SerS, seryl-tRNA synthetase [Erythrobacter litoralis HTCC2594]
          Length = 426

 Score =  441 bits (1135), Expect = e-122,   Method: Composition-based stats.
 Identities = 234/426 (54%), Positives = 298/426 (69%), Gaps = 1/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NPE  D AL +R  EP +  IL+LDE+ R +  K+++ ++RRN  S  IGQ
Sbjct: 1   MHDIRQIRDNPEAFDAALARRGHEPVAAEILALDEQCRAVTTKMQEAQSRRNEASKAIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+ +GN    +ALK E + LK+ LP LE E+ E+   L+  ++ IPN+PL++VP G   +
Sbjct: 61  AMGQGNTEKAEALKAEVADLKQTLPRLEDEDRELKMRLENALAVIPNLPLDDVPDGADES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +NI + + G K       REH +IG ALG MDF+   +LSGARF+ L G +A L RALGQ
Sbjct: 121 DNIEVGTWGTKREFSFEPREHADIGPALG-MDFETGARLSGARFTFLRGGMARLHRALGQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D   SE+GY E + P+LVRDEAMYGT ++PKFA+D F TTDGRWLIPT+EVSLT   
Sbjct: 180 FMLDRQVSEYGYAECAPPVLVRDEAMYGTDKLPKFAEDSFQTTDGRWLIPTAEVSLTASV 239

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             +I++  +LP+R T L P FRSEAG+AG+DTRG +RQHQF KCELVSI R E+S  EHE
Sbjct: 240 MDQILDDAALPMRLTALTPCFRSEAGAAGKDTRGFIRQHQFEKCELVSIVRPENSAAEHE 299

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM   AE +L+ LDL YR + LCTGD+GF A KTYDLEVWL GQ  YREISSCS  G+FQ
Sbjct: 300 RMTEAAESVLQALDLPYRKMLLCTGDMGFGARKTYDLEVWLPGQGAYREISSCSNTGDFQ 359

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR    K   F HTLNGSG+AVGR L+A++ENY   DGSV +P VL PYM   
Sbjct: 360 ARRMNARYRPEGEKKTAFVHTLNGSGLAVGRTLVAVIENYQEEDGSVAVPEVLAPYMGGA 419

Query: 421 AVIKKE 426
             ++  
Sbjct: 420 MKLEPT 425


>gi|167629223|ref|YP_001679722.1| seryl-tRNA synthetase [Heliobacterium modesticaldum Ice1]
 gi|238687865|sp|B0TAQ9|SYS_HELMI RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|167591963|gb|ABZ83711.1| seryl-tRNA synthetase [Heliobacterium modesticaldum Ice1]
          Length = 422

 Score =  441 bits (1134), Expect = e-122,   Method: Composition-based stats.
 Identities = 197/424 (46%), Positives = 271/424 (63%), Gaps = 5/424 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD +++R NPE +  AL+KR      +  L LD + R L+ ++E ++A+RN+ SA+I +
Sbjct: 1   MLDTKFVRANPEAVQEALQKRGANISLDDFLELDRRRRALVVEVESLKAKRNAVSAEIAR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
                     +AL  E   + +Q+  L+ E   +   +   +  IPN+P   VP+GTS  
Sbjct: 61  RKKA--KEDAEALIAEMRQVGDQIKALDDELTRIELDMDNRMLYIPNIPHASVPVGTSEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G   +     + H++IGE L ++DF R  K+SGARF+V  G  A LERA+  
Sbjct: 119 DNVEVRRWGTPRTFDFPVKAHWDIGEDLNILDFQRGAKISGARFTVYKGLGARLERAVIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-TDGRWLIPTSEVSLTNL 239
            M+D H  + GYTEV  P LV  ++M GTGQ+PKFA+DMF       +LIPT+EV +TNL
Sbjct: 179 LMMDTHA-QRGYTEVLPPYLVNRQSMLGTGQLPKFAEDMFAVAGTDYYLIPTAEVPVTNL 237

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y++EI+++  LP+     +  FR+EAG+AGRDTRG++RQHQF K ELV  TR E+S+ E 
Sbjct: 238 YTNEILDADKLPIHHCAYSACFRAEAGAAGRDTRGLIRQHQFNKVELVKFTRPENSYDEL 297

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++   AE IL+ L L YRV++LCTGD+GFSA KTYD+EVWL     YREISSCS   +F
Sbjct: 298 EKLTKDAEHILQLLGLPYRVITLCTGDMGFSAAKTYDIEVWLPSFGAYREISSCSNFEDF 357

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N R+R       +F HTLNGSG+AVGR + AILEN    DGSV IP  LRPYM  
Sbjct: 358 QARRANIRFRPSPKAKPEFVHTLNGSGLAVGRTVAAILENCQQPDGSVVIPEALRPYM-G 416

Query: 420 LAVI 423
           + VI
Sbjct: 417 VDVI 420


>gi|317491441|ref|ZP_07949877.1| seryl-tRNA synthetase [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316920988|gb|EFV42311.1| seryl-tRNA synthetase [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 430

 Score =  441 bits (1134), Expect = e-122,   Method: Composition-based stats.
 Identities = 197/431 (45%), Positives = 268/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R   + +   L +R  +   + +   +E+ ++L  + E ++A RNS S  IG 
Sbjct: 1   MLDPNLLRNELDAVAEKLARRGFKLDVDTLRQQEERRKVLQVETESLQAERNSRSKSIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E  ++ + ++ L   IPN+P + VP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNELGEKLDAAKSELDQLLNDIRDLALSIPNMPDDSVPVGRDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G+  +     R+H  +GE  G +DF  A KL+GARF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGEPRTYDFDVRDHVTLGEMTGGLDFAAAVKLTGARFVVMKGQIARMHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY E   P LV  + +YGTGQ+PKF  D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYLETYVPYLVNHDTLYGTGQLPKFGGDLFHTRPLEEEADSSTYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV +TNL   EI+E +SLPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I R 
Sbjct: 239 EVPVTNLVRGEILEEESLPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E +   AE++L+ L+L YR V LCTGD+GF + KTYDLEVW+  QN YREISS
Sbjct: 299 EDSMDALEELTGHAEKVLQLLNLPYRKVLLCTGDMGFGSSKTYDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R+   K  +  HTLNGSG+AVGR L+A+LENY  ADG + +P V
Sbjct: 359 CSNMWDFQARRMQARCRNKTDKKPRLVHTLNGSGLAVGRTLVAVLENYQQADGRIQVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|323141849|ref|ZP_08076713.1| serine--tRNA ligase [Phascolarctobacterium sp. YIT 12067]
 gi|322413689|gb|EFY04544.1| serine--tRNA ligase [Phascolarctobacterium sp. YIT 12067]
          Length = 426

 Score =  441 bits (1134), Expect = e-121,   Method: Composition-based stats.
 Identities = 191/425 (44%), Positives = 272/425 (64%), Gaps = 4/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++++R+NP+ ++ A+K R+        L LD++ R + +++E ++  RN+ S +IG+
Sbjct: 1   MLDLKFVRENPKLVEEAVKSRNGSLDLTEFLELDKQRREITQQVEALKKERNTASQEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G              L +++   +KE  E+   +K ++  IPNVP E+VP+G    
Sbjct: 61  LKKAGQ--DAAEQMAAVRALGDKIAADDKELKEIEEKIKSILLTIPNVPAEDVPVGKDDT 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N +IR+ G+        + H++IGE LG++DF+R  K+SGAR+    G  + LERA+  
Sbjct: 119 CNPVIRTWGEPTKFDFEPKAHWDIGENLGILDFERGVKVSGARYVFYRGMGSRLERAVIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-TTDGRWLIPTSEVSLTNL 239
           F +D+HT +HGYTE   P +V   +M GTGQ+PKFA+DM+       +LIPT+EV +TN 
Sbjct: 179 FFLDVHTRKHGYTEFFPPFIVNGASMQGTGQLPKFAEDMYKLENGDMYLIPTAEVPVTNY 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +  +I+    LPL++T  +  FR+EAG+AGRDTRG++R HQF K ELV  T+ E+S+ E 
Sbjct: 239 HRDDILTGDELPLKYTAYSACFRAEAGAAGRDTRGLIRMHQFNKVELVKFTKPEESWAEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           +++ + AEE+L+ L L Y VV LCTGDLGFS+  TYDLEVWL   N YREISSCS   +F
Sbjct: 299 DKLTNDAEEVLQLLGLPYHVVRLCTGDLGFSSATTYDLEVWLPAANCYREISSCSNFLDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N R+R       +F HTLNGSGVAVGR + AILENY  ADGSV +P VLRPYM  
Sbjct: 359 QARRANIRFRRDAKSKPEFVHTLNGSGVAVGRTVAAILENYQQADGSVVVPEVLRPYM-G 417

Query: 420 LAVIK 424
             VI 
Sbjct: 418 CDVIP 422


>gi|268590183|ref|ZP_06124404.1| serine--tRNA ligase [Providencia rettgeri DSM 1131]
 gi|291314463|gb|EFE54916.1| serine--tRNA ligase [Providencia rettgeri DSM 1131]
          Length = 430

 Score =  441 bits (1134), Expect = e-121,   Method: Composition-based stats.
 Identities = 194/431 (45%), Positives = 265/431 (61%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R   + +   L +R      E +  L+E+ ++L  + E ++A RNS S  IG 
Sbjct: 1   MLDPNLLRTELDAVAEKLARRGFTLDVEKLRELEERRKVLQVETETLQADRNSRSKTIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E  ++   ++ +   IPN+P ++VP G   +
Sbjct: 61  AKARG--EDIEPLRLEVNQLGEKLDSAKAELDKLQQEIRDIALSIPNIPDDQVPDGKDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G+        ++H  +GE  G +DF  A KL+GARF V+ G +A + RAL Q
Sbjct: 119 DNVEVARWGEPRQYDFEVKDHVSLGELSGGLDFPAAVKLTGARFVVMKGQIARMHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY E+  P LV  + +YGTGQ+PKF +D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYQELYVPYLVNHDTLYGTGQLPKFGEDLFHTKPLEEEADSSTYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV +TNL   EI++  SLPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I   
Sbjct: 239 EVPVTNLVRDEILDEDSLPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQIVHP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E S    E +   AE++L+ L+L YR V LCTGD+GF + KTYDLEVWL  QN YREISS
Sbjct: 299 EKSMDALEELTGHAEKVLQLLNLPYRKVILCTGDIGFGSRKTYDLEVWLPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R+R  + K  +  HTLNGSG+AVGR L+AILENY  ADG + +P V
Sbjct: 359 CSNMWDFQARRMQARFRGKSDKKTQLVHTLNGSGLAVGRTLVAILENYQLADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMKGLEFI 429


>gi|148981577|ref|ZP_01816464.1| seryl-tRNA synthetase [Vibrionales bacterium SWAT-3]
 gi|145960820|gb|EDK26154.1| seryl-tRNA synthetase [Vibrionales bacterium SWAT-3]
          Length = 435

 Score =  441 bits (1134), Expect = e-121,   Method: Composition-based stats.
 Identities = 195/434 (44%), Positives = 264/434 (60%), Gaps = 11/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   +     L +R      E I  L+EK + L  K E+++A RNS S  IGQ
Sbjct: 1   MLDSKLLRAELDETAAKLARRGFALDVETIRELEEKRKSLQMKTEELQALRNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+    + +  E   L  +L   +    E+ S L+ +   IPN+P E VP G   +
Sbjct: 61  AKAKGDDEEAERILAEVGNLGAELDQAKAALAELQSDLETITMSIPNLPDESVPEGKDED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G+  +     ++H ++GE  G +DF  A K+SG+RF V+ G  A L RA+ Q
Sbjct: 121 DNVEVSRWGQPKTYDFEVKDHVDLGEMSGGLDFASAVKISGSRFIVMKGKFARLHRAIAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-----------GRWLI 229
           FM+DLHT EHGYTE+  P LV  +++YGTGQ+PKF +D+F T+               LI
Sbjct: 181 FMLDLHTDEHGYTEMYVPYLVNHDSLYGTGQLPKFGEDLFHTSPLTEQVSDVPLKTLSLI 240

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV +TN+    I +   LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I
Sbjct: 241 PTAEVPVTNMVRDTITDEAELPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQI 300

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
           T+ EDS    E +   AE++L+ L+L YR V LCTGD+GF A KTYDLEVW+  Q  YRE
Sbjct: 301 TKPEDSMAALEELTGHAEKVLQLLELPYRKVVLCTGDMGFGAAKTYDLEVWVPAQETYRE 360

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR ++AILEN   ADG + I
Sbjct: 361 ISSCSNMWDFQARRMQARFRRKGEKKPELVHTLNGSGLAVGRTMVAILENNQEADGRIAI 420

Query: 410 PTVLRPYMNNLAVI 423
           P VL+PYM  +  I
Sbjct: 421 PAVLQPYMGGVTHI 434


>gi|332971217|gb|EGK10180.1| serine--tRNA ligase [Desmospora sp. 8437]
          Length = 432

 Score =  441 bits (1133), Expect = e-121,   Method: Composition-based stats.
 Identities = 182/427 (42%), Positives = 270/427 (63%), Gaps = 4/427 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQ-SEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ +RQ+ E +   L+ R  +    + ++ LDE+ R L+++ E ++ RRN  S ++ 
Sbjct: 7   MLDLKVLRQDLEQVRKRLEHRGEDISGLDSVIRLDERRRELLRETEQLKNRRNVVSKEVA 66

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           Q    G          E   + +++  L++E  +V   L  ++  +PN+P E VP+G S 
Sbjct: 67  QKKKAG--EEAADTIAEMRRVGDRIKELDEEVRQVERELDHVLLTLPNLPHESVPVGESE 124

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            +N  +R  G+ P      + H+E+   L ++DF+RA K++G+RF    G  A LERAL 
Sbjct: 125 EDNQPVRHWGEVPRWSFEPKPHWELATELDILDFERAAKVTGSRFVFYKGAGARLERALF 184

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-TDGRWLIPTSEVSLTN 238
            +M+DLHT ++GYTE+  P +V  ++M GTGQ+PKFA+D F       +LIPT+EV +TN
Sbjct: 185 NYMLDLHTEKNGYTEMIPPYMVNRDSMTGTGQLPKFAEDSFAVADTDYYLIPTAEVPVTN 244

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            +  EI+ +  LP+++   + +FRSEAGSAGRDTRG++R HQF K ELV + + EDS+ E
Sbjct: 245 FHRGEILSAAELPVKYAGFSANFRSEAGSAGRDTRGLIRTHQFNKVELVKLVKPEDSYDE 304

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E ++  AE +L++L L YRV+ +CT DLGF+A K YDLEVWL     YREISSCS   +
Sbjct: 305 LESLVQDAEMVLQQLGLPYRVLLMCTADLGFTAAKKYDLEVWLPSSGTYREISSCSNFED 364

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           +Q+RR N R+R       +F HTLNGSG+A+GR + A+LE+Y   DGS+ IP VLRPYM 
Sbjct: 365 YQARRANIRFRRDAGSKPEFVHTLNGSGLAIGRTVAALLEHYQQEDGSIRIPEVLRPYMG 424

Query: 419 NLAVIKK 425
            L  I+K
Sbjct: 425 GLEKIEK 431


>gi|119470154|ref|ZP_01612920.1| seryl-tRNA synthetase [Alteromonadales bacterium TW-7]
 gi|119446575|gb|EAW27849.1| seryl-tRNA synthetase [Alteromonadales bacterium TW-7]
          Length = 434

 Score =  441 bits (1133), Expect = e-121,   Method: Composition-based stats.
 Identities = 198/435 (45%), Positives = 272/435 (62%), Gaps = 12/435 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD +++RQ+ E     L  R  E     +  L+E+ + L  K ++++++RN+++  IGQ
Sbjct: 1   MLDSKYLRQDVEQTAARLAARGYELDVAKVTELEEQRKTLQVKTQELQSQRNASAKAIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G       L +  + L  +L   +K + EV +++  +   IPN+P E VP G   +
Sbjct: 61  AKAKG--EDAQPLLDAVANLGSELDATKKAQDEVLNAINDIALAIPNLPDESVPEGADED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I + G         ++H ++G+ L  +DF+   K+SGARF+V+ G +A + RAL Q
Sbjct: 119 DNVEILTWGTPKKYDFEVKDHVDVGQDLNGLDFEMGVKISGARFTVMRGQVARMHRALTQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT----------TDGRWLIP 230
           +M+D HT  +GYTE+  P LV   ++YGT Q+PKFA D+F T            G  LIP
Sbjct: 179 YMLDTHTDTNGYTEMYVPYLVNSASLYGTSQLPKFAGDLFHTLGLVNDDGEQQAGFSLIP 238

Query: 231 TSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT 290
           T+EV LTN  S EI +   LP+R T   P FRSEAGS GRDTRG++RQHQF K ELV + 
Sbjct: 239 TAEVPLTNSASDEIYDESDLPIRLTAHTPCFRSEAGSYGRDTRGLIRQHQFDKVELVQLV 298

Query: 291 REEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREI 350
           + EDS    E +   AE+IL+ L+L YR V LC GD+GF A KTYDLEVWL  Q+ YREI
Sbjct: 299 KPEDSMQALEELTGHAEQILQALELPYRKVILCMGDMGFGAAKTYDLEVWLPAQDTYREI 358

Query: 351 SSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIP 410
           SSCS   +FQ+RRM +R+R   +K  +  HTLNGSG+AVGR L+AILENY  ADGSV +P
Sbjct: 359 SSCSNMVDFQARRMQARFRREGAKKPELLHTLNGSGLAVGRTLVAILENYQQADGSVVVP 418

Query: 411 TVLRPYMNNLAVIKK 425
            VLRPYM  L VI K
Sbjct: 419 EVLRPYMGGLEVIGK 433


>gi|114320852|ref|YP_742535.1| seryl-tRNA synthetase [Alkalilimnicola ehrlichii MLHE-1]
 gi|122311524|sp|Q0A7Z2|SYS_ALHEH RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|114227246|gb|ABI57045.1| seryl-tRNA synthetase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 424

 Score =  441 bits (1133), Expect = e-121,   Method: Composition-based stats.
 Identities = 207/426 (48%), Positives = 275/426 (64%), Gaps = 5/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +RQ+PE +  AL +R       +  +LDE+ R L  + ++++  RN+ S  IGQ
Sbjct: 1   MLDTRKLRQDPEGVARALARRGYRLDVAHYRALDERRRELQVRTQELQNERNTRSKGIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ LK E + L  QL   + E   V   L  +   +PN+P  +VP G   +
Sbjct: 61  AKARG--EDIEPLKAEVADLGRQLEAAKGELQAVQDELHDIHVGMPNLPHPDVPEGEDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEA-LGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           EN+ +R  G  P      R+H E+GE   G +DF+ A KL+GARF V+ G +A L RAL 
Sbjct: 119 ENVEVRRWGTPPEFGFRPRDHVELGELLDGGLDFEAAAKLTGARFVVMRGAVARLHRALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT--DGRWLIPTSEVSLT 237
           QFM+D HT+EHGY E+  P +V  ++++GTGQ+PKFA D+F        +LIPT+EV +T
Sbjct: 179 QFMLDTHTAEHGYQEIYVPYMVNRDSLFGTGQLPKFAADLFHLDAEQDYYLIPTAEVPVT 238

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           N+   EII    LPL+F    P FRSEAGS G+DTRGM+RQHQF K ELV + R E S+ 
Sbjct: 239 NMARDEIIADGQLPLKFACHTPCFRSEAGSHGKDTRGMIRQHQFEKVELVQMVRPEASWE 298

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
             E +   AE IL+RLDL YRVV+LCTGDLGFS+ KTYD+EVWL  Q  YREISSCS   
Sbjct: 299 ALEALTGHAETILQRLDLPYRVVTLCTGDLGFSSAKTYDIEVWLPAQETYREISSCSNFL 358

Query: 358 NFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +FQ+RRM +R+R+P +   +  HTLNGSG+AVGRCL+AILENY  ADG VT+P  LRPYM
Sbjct: 359 DFQARRMQARWRNPETGKPEPLHTLNGSGLAVGRCLVAILENYQEADGRVTVPEALRPYM 418

Query: 418 NNLAVI 423
             +  +
Sbjct: 419 GGITRL 424


>gi|240113545|ref|ZP_04728035.1| seryl-tRNA synthetase [Neisseria gonorrhoeae MS11]
 gi|268599610|ref|ZP_06133777.1| seryl-tRNA synthetase [Neisseria gonorrhoeae MS11]
 gi|268583741|gb|EEZ48417.1| seryl-tRNA synthetase [Neisseria gonorrhoeae MS11]
          Length = 431

 Score =  441 bits (1133), Expect = e-121,   Method: Composition-based stats.
 Identities = 203/433 (46%), Positives = 277/433 (63%), Gaps = 9/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L +R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLARRGYEFDTARFDALEERRKSVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPPGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-------TTDGRWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F        T   ++LIPT+E
Sbjct: 180 FMLDTHTLQHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVAGSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYGALEEMVGHAENILKALELPYRVITLCTGDMGFSAAKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIKKE 426
           +PYM  +  ++ +
Sbjct: 419 QPYMGGVTKLEVK 431


>gi|59801685|ref|YP_208397.1| seryl-tRNA synthetase [Neisseria gonorrhoeae FA 1090]
 gi|240014583|ref|ZP_04721496.1| seryl-tRNA synthetase [Neisseria gonorrhoeae DGI18]
 gi|240121105|ref|ZP_04734067.1| seryl-tRNA synthetase [Neisseria gonorrhoeae PID24-1]
 gi|240123934|ref|ZP_04736890.1| seryl-tRNA synthetase [Neisseria gonorrhoeae PID332]
 gi|254494125|ref|ZP_05107296.1| seryl-tRNA synthetase [Neisseria gonorrhoeae 1291]
 gi|268682559|ref|ZP_06149421.1| seryl-tRNA synthetase [Neisseria gonorrhoeae PID332]
 gi|67461600|sp|Q5F752|SYS_NEIG1 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|59718580|gb|AAW89985.1| putative seryl-tRNA synthetase [Neisseria gonorrhoeae FA 1090]
 gi|226513165|gb|EEH62510.1| seryl-tRNA synthetase [Neisseria gonorrhoeae 1291]
 gi|268622843|gb|EEZ55243.1| seryl-tRNA synthetase [Neisseria gonorrhoeae PID332]
          Length = 431

 Score =  441 bits (1133), Expect = e-121,   Method: Composition-based stats.
 Identities = 201/433 (46%), Positives = 276/433 (63%), Gaps = 9/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L +R  +  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLARRGYDFDTARFDALEERRKSVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPPGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-------TTDGRWLIPTSE 233
           FM+D H  +HGYTE   P +V D  + GTGQ+PKFA+D+F        T   ++LIPT+E
Sbjct: 180 FMLDTHMLQHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVAGSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYGALEEMVGHAENILKALELPYRVITLCTGDMGFSAAKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIKKE 426
           +PYM  +  ++ +
Sbjct: 419 QPYMGGVTKLEVK 431


>gi|152989408|ref|YP_001347960.1| seryl-tRNA synthetase [Pseudomonas aeruginosa PA7]
 gi|166223270|sp|A6V4H5|SYS_PSEA7 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|150964566|gb|ABR86591.1| seryl-tRNA synthetase [Pseudomonas aeruginosa PA7]
          Length = 426

 Score =  441 bits (1133), Expect = e-121,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 276/427 (64%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R  P+ +   L  R  +     I +L+E+ + +  + E ++A RN+ S  IGQ
Sbjct: 1   MLDPKLVRTQPQEVAARLATRGFQLDVARIEALEEQRKSVQTRTEQLQAERNARSKAIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G    +  L  +   +  +L   +++   +   L  ++  IPN+P E VP+G   +
Sbjct: 61  AKQRG--EDIAPLLADVDRMGSELEEGKRQLDAIQGELDSMLLGIPNLPHESVPVGADED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G   +     ++H  +GE  G +DF+ A KLSGARF+++ G +A L RAL Q
Sbjct: 119 ANVEVRRWGMPKTFDFEVKDHVALGERHGWLDFETAAKLSGARFALMRGPIARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG----RWLIPTSEVSL 236
           FMI+LHT+EHGY E   P LV+  A+ GTGQ+PKF +D+F          +LIPT+EVSL
Sbjct: 179 FMINLHTAEHGYEEAYTPYLVQAPALQGTGQLPKFEEDLFKIGRDGEADLYLIPTAEVSL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+ S +I++++ LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I     S+
Sbjct: 239 TNIVSGQILDARQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVDPATSY 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
              E + + AE +L+ L+L YRV++LCTGD+GF A KTYDLEVW+  Q+ YREISSCS C
Sbjct: 299 EALEGLTANAERVLQLLELPYRVLALCTGDMGFGATKTYDLEVWVPSQDKYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +RYR+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P VL+PY
Sbjct: 359 GDFQARRMQARYRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPDVLKPY 418

Query: 417 MNNLAVI 423
           M  + VI
Sbjct: 419 MGGIEVI 425


>gi|315179812|gb|ADT86726.1| seryl-tRNA synthetase [Vibrio furnissii NCTC 11218]
          Length = 435

 Score =  441 bits (1133), Expect = e-121,   Method: Composition-based stats.
 Identities = 189/434 (43%), Positives = 266/434 (61%), Gaps = 11/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   E     L +R  +   + I +L+E+ + +  ++E++++ RNS S QIGQ
Sbjct: 1   MLDSKLLRTELEETAAKLARRGFKLDVDTIRTLEEQRKSIQVEVENLQSTRNSISKQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +++G+    + +K +  TL + L   + E   V S L  +   +PN+P + VP G   N
Sbjct: 61  LMSQGDKDGAEEVKKQIGTLGDDLDAKKVELDAVMSQLDAITQSVPNLPDDAVPDGKDEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G   +     ++H ++GE    +DF  ATK++GARF ++ G  A L RA+ Q
Sbjct: 121 DNVEVSRWGTPKAYDFDVKDHVDLGEMGDGLDFASATKITGARFVIMKGQFARLHRAIAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-----------TDGRWLI 229
           FM+DLHT +HGYTE+  P LV  + ++GTGQ+PKF  D+F T                LI
Sbjct: 181 FMLDLHTEQHGYTELYVPYLVNSDTLFGTGQLPKFGKDLFHTEPLAEKASDEEPRRLSLI 240

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV +TNL    I E   LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I
Sbjct: 241 PTAEVPVTNLVRDTITEEADLPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQI 300

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
           T+ EDS    E +   AE++L+ L+L YR V LCTGD+GF +CKTYDLEVW+  Q  YRE
Sbjct: 301 TKPEDSMAALEELTGHAEKVLQLLELPYRKVILCTGDMGFGSCKTYDLEVWVPAQKTYRE 360

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR ++AILENY  ADG + +
Sbjct: 361 ISSCSNMWDFQARRMQARFRRKGEKKPELVHTLNGSGLAVGRTMVAILENYQQADGRIEV 420

Query: 410 PTVLRPYMNNLAVI 423
           P VL+ YM  +  I
Sbjct: 421 PAVLQKYMGGVTHI 434


>gi|229520458|ref|ZP_04409883.1| seryl-tRNA synthetase [Vibrio cholerae TM 11079-80]
 gi|262402530|ref|ZP_06079091.1| seryl-tRNA synthetase [Vibrio sp. RC586]
 gi|229342556|gb|EEO07549.1| seryl-tRNA synthetase [Vibrio cholerae TM 11079-80]
 gi|262351312|gb|EEZ00445.1| seryl-tRNA synthetase [Vibrio sp. RC586]
          Length = 435

 Score =  440 bits (1132), Expect = e-121,   Method: Composition-based stats.
 Identities = 195/434 (44%), Positives = 268/434 (61%), Gaps = 11/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   +     L +R  +   E I +L+E+ + +  ++E++++ RNS S QIGQ
Sbjct: 1   MLDSKLLRTELDETAAKLARRGFKLDVETIRTLEEQRKSIQVEVENLQSTRNSISKQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +A G+ +  +A+K +  TL + L   + E   V + L  +   +PN+P + VP G   +
Sbjct: 61  LMASGDKAGAEAVKQQIGTLGDDLDAKKVELDAVMAQLDAITQTVPNIPDDAVPNGKDDS 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +   G   +     ++H ++GE    +DF  ATK++GARF V+ G  A L RA+ Q
Sbjct: 121 ENVEVSRWGTPKTYDFEVKDHVDLGEMGDGLDFASATKITGARFVVMKGQFARLHRAIAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-----------TDGRWLI 229
           FM+DLHT +HGYTE+  P LV  E ++GTGQ+PKF  D+F T                LI
Sbjct: 181 FMLDLHTDQHGYTELYVPYLVNAETLFGTGQLPKFGQDLFHTEPLTEKASDEEPRRLSLI 240

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV +TNL    I++   LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I
Sbjct: 241 PTAEVPVTNLVRDTILDEAELPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQI 300

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
           TR EDS    E +   AE++L+ LDL YR V LCTGD+GF +CKTYDLEVW+  Q  YRE
Sbjct: 301 TRPEDSMAALEELTGHAEKVLQLLDLPYRKVILCTGDMGFGSCKTYDLEVWVPAQKTYRE 360

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR ++AILENY  ADG + I
Sbjct: 361 ISSCSNMWDFQARRMQARFRRKGEKKPELVHTLNGSGLAVGRTMVAILENYQEADGRIAI 420

Query: 410 PTVLRPYMNNLAVI 423
           P VL+ YM  L  I
Sbjct: 421 PAVLQKYMGGLTHI 434


>gi|71906935|ref|YP_284522.1| seryl-tRNA synthetase [Dechloromonas aromatica RCB]
 gi|123627807|sp|Q47GH9|SYS_DECAR RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|71846556|gb|AAZ46052.1| seryl-tRNA synthetase [Dechloromonas aromatica RCB]
          Length = 427

 Score =  440 bits (1132), Expect = e-121,   Method: Composition-based stats.
 Identities = 203/427 (47%), Positives = 277/427 (64%), Gaps = 7/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N + +   L KR          +L+ + + L  + +D++A+RNS S QIG 
Sbjct: 1   MLDIQQLRSNLDAVAEGLAKRGKPIDFSEFSALEAERKTLQTRTQDLQAQRNSLSKQIGM 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G       +  +  ++ ++L   E    E+ +    +++ +PN+P + VP+G+   
Sbjct: 61  LKGKG--EDASEVMAQVGSIGDELKASEARLAELLTQFNAILAALPNIPDDSVPVGSDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ I+  G         ++H ++GEALG +DF  A K+SGARFS+L G LA L RAL Q
Sbjct: 119 GNVEIKRWGTPRVFDFEVKDHTDVGEALGQLDFGTAAKISGARFSLLKGGLARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT----TDGRWLIPTSEVSL 236
           FM+D HT+EHGYTE+ AP LV   ++YGTGQ+PKF +D+F       D  +LIPT+EV +
Sbjct: 179 FMLDTHTAEHGYTELYAPYLVNAASLYGTGQLPKFEEDLFKVLRGDQDPLYLIPTAEVPV 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+   EI+ +++LPL+F    P FRSEAGS GRD RGM+RQHQF K ELV +   E S 
Sbjct: 239 TNIVRDEILSAEALPLKFVCHTPCFRSEAGSGGRDVRGMIRQHQFDKVELVQVVHPEKSA 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
             HE +   AE IL++L+L YR ++LC+GD+GFSA KTYDLEVWL  QN YREISSCS  
Sbjct: 299 EAHEELTRQAEIILEKLELPYRRMALCSGDMGFSAAKTYDLEVWLPAQNTYREISSCSNF 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G FQ+RRM +R+R+ +    +  HTLNGSG+AVGR L+AILEN  NADGSVTIP VLRPY
Sbjct: 359 GAFQARRMQARFRN-DKNKTELCHTLNGSGLAVGRTLVAILENNQNADGSVTIPAVLRPY 417

Query: 417 MNNLAVI 423
           M  L V+
Sbjct: 418 MGGLEVL 424


>gi|260459791|ref|ZP_05808045.1| seryl-tRNA synthetase [Mesorhizobium opportunistum WSM2075]
 gi|259034593|gb|EEW35850.1| seryl-tRNA synthetase [Mesorhizobium opportunistum WSM2075]
          Length = 434

 Score =  440 bits (1132), Expect = e-121,   Method: Composition-based stats.
 Identities = 237/434 (54%), Positives = 309/434 (71%), Gaps = 8/434 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQ-----SEYILSLDEKNRILIKKIEDIRARRNSNS 55
           MLDI+WIR NP+ L  AL KR           + ++++DE  R  + +++  + RRN+ S
Sbjct: 1   MLDIKWIRDNPKALVEALVKRSWSAAEAQSTVDELIAMDEARREHVTELQTSQERRNAAS 60

Query: 56  AQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
            +IG A+  G+ +L + LK E   +K  +   E  E E+  +L   ++ +PNVP ++VP+
Sbjct: 61  KEIGNAMRSGDAALAERLKAEVGEIKTFIQNGEARERELDKALNDALAVLPNVPFDDVPV 120

Query: 116 GTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLE 175
           G   ++N++   VG+ P+  +  +EHFEIGEALG+MDF+RA KLSG+RF+VL   LA +E
Sbjct: 121 GKDEHDNVVKHIVGEVPTRRNWVKEHFEIGEALGMMDFERAAKLSGSRFTVLKSGLARME 180

Query: 176 RALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD---GRWLIPTS 232
           RA+GQFM+DLHT+EHGY E+  PL+VRDE ++GT Q+PKF +D+F T        LIPT+
Sbjct: 181 RAIGQFMLDLHTNEHGYEEIIPPLMVRDEVLFGTNQLPKFEEDLFFTQHGDGRLGLIPTA 240

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI   + LPLR+T L P FRSEAGSAGRDTRGMLRQHQF+K ELVSIT +
Sbjct: 241 EVPLTNLVREEITAHEKLPLRYTALTPCFRSEAGSAGRDTRGMLRQHQFYKVELVSITDQ 300

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E S  EHERM  CAEE+LKRL L +R + LCTGD+GF A KTYD+EVWL GQN YREISS
Sbjct: 301 ESSLAEHERMTQCAEEVLKRLGLPFRTMVLCTGDMGFGARKTYDIEVWLPGQNAYREISS 360

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS CG+FQ+RRM++RY+D + K  +F HTLNGSG AVGR LIA++ENY N DGSVTIP V
Sbjct: 361 CSVCGDFQARRMDARYKDKDGKGNRFVHTLNGSGTAVGRALIAVIENYQNEDGSVTIPEV 420

Query: 413 LRPYMNNLAVIKKE 426
           LRPYM  L  I+ +
Sbjct: 421 LRPYMGGLEKIESK 434


>gi|153802126|ref|ZP_01956712.1| seryl-tRNA synthetase [Vibrio cholerae MZO-3]
 gi|124122319|gb|EAY41062.1| seryl-tRNA synthetase [Vibrio cholerae MZO-3]
          Length = 435

 Score =  440 bits (1132), Expect = e-121,   Method: Composition-based stats.
 Identities = 194/434 (44%), Positives = 268/434 (61%), Gaps = 11/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   +     L +R  +   E I +L+E+ + +  ++E++++ RNS S QIGQ
Sbjct: 1   MLDSKLLRTELDETAAKLARRGFKLDVETIRTLEEQRKSIQVEVENLQSTRNSISKQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +A G+ +  +A+K +  TL + L   + E   V + L  +   +PN+P + VP G   +
Sbjct: 61  LMASGDKAGAEAVKQQIGTLGDDLDAKKVELDAVMAQLDAITQTVPNIPDDAVPNGKDDS 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +   G   +     ++H ++GE    +DF  ATK++GARF V+ G  A L RA+ Q
Sbjct: 121 ENVEVSRWGTPKTYDFEVKDHVDLGEMGDGLDFASATKITGARFVVMKGQFARLHRAIAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-----------TDGRWLI 229
           FM+DLHT +HGYTE+  P LV  E ++GTGQ+PKF  D+F T                LI
Sbjct: 181 FMLDLHTDQHGYTELYVPYLVNAETLFGTGQLPKFGQDLFHTEPLTEKASDEEPRRLSLI 240

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV +TNL    I++   LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I
Sbjct: 241 PTAEVPVTNLVRDTILDETELPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQI 300

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
           TR EDS    E +   AE++L+ L+L YR V LCTGD+GF +CKTYDLEVW+  Q  YRE
Sbjct: 301 TRPEDSMAALEELTGHAEKVLQLLELPYRKVILCTGDMGFGSCKTYDLEVWVPAQKTYRE 360

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR ++AILENY  ADG + I
Sbjct: 361 ISSCSNMWDFQARRMQARFRRKGEKKPELVHTLNGSGLAVGRTMVAILENYQEADGRIAI 420

Query: 410 PTVLRPYMNNLAVI 423
           P VL+ YM  L  I
Sbjct: 421 PAVLQKYMGGLTHI 434


>gi|261344310|ref|ZP_05971954.1| serine--tRNA ligase [Providencia rustigianii DSM 4541]
 gi|282567914|gb|EFB73449.1| serine--tRNA ligase [Providencia rustigianii DSM 4541]
          Length = 430

 Score =  440 bits (1132), Expect = e-121,   Method: Composition-based stats.
 Identities = 193/431 (44%), Positives = 266/431 (61%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R   + +   L +R      E +  L+E+ ++L  + E ++A RNS S  IG 
Sbjct: 1   MLDPNLLRTELDAVATKLARRGFTLDVEKLRELEERRKVLQVETETLQADRNSRSKTIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E  ++   ++ +   IPN+P ++VP G   +
Sbjct: 61  AKARG--EDIEPLRLEVNQLGEKLDTAKAELEKLQQEIRDIALSIPNIPDDQVPDGKDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G+        ++H  +GE  G +DF  A KL+GARF V+ G +A + RAL Q
Sbjct: 119 DNVEVARWGEPRQYDFEVKDHVSLGELAGGLDFPAAVKLTGARFVVMKGQIARMHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY E+  P LV  + +YGTGQ+PKF +D+F T             LIPT+
Sbjct: 179 FMLDLHTEKHGYQELYVPYLVNHDTLYGTGQLPKFGEDLFHTKPLEEEADSSTYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV +TNL   EI++  +LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I   
Sbjct: 239 EVPVTNLVRDEILDEDALPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQIVHP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E S    E +   AE++L+ L+L YR V LCTGD+GF + KTYDLEVWL  QN YREISS
Sbjct: 299 EKSMEALEELTGHAEKVLQLLELPYRKVILCTGDIGFGSRKTYDLEVWLPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R+R  + K  +  HTLNGSG+AVGR L+A+LENY  ADG + +P V
Sbjct: 359 CSNMWDFQARRMQARFRGKSDKKTQLVHTLNGSGLAVGRTLVAVLENYQQADGRIQVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|15641123|ref|NP_230755.1| seryl-tRNA synthetase [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121591279|ref|ZP_01678574.1| seryl-tRNA synthetase [Vibrio cholerae 2740-80]
 gi|121726249|ref|ZP_01679539.1| seryl-tRNA synthetase [Vibrio cholerae V52]
 gi|147674801|ref|YP_001216578.1| seryl-tRNA synthetase [Vibrio cholerae O395]
 gi|153213559|ref|ZP_01948849.1| seryl-tRNA synthetase [Vibrio cholerae 1587]
 gi|153816911|ref|ZP_01969578.1| seryl-tRNA synthetase [Vibrio cholerae NCTC 8457]
 gi|153823886|ref|ZP_01976553.1| seryl-tRNA synthetase [Vibrio cholerae B33]
 gi|153824956|ref|ZP_01977623.1| seryl-tRNA synthetase [Vibrio cholerae MZO-2]
 gi|153828114|ref|ZP_01980781.1| seryl-tRNA synthetase [Vibrio cholerae 623-39]
 gi|227081283|ref|YP_002809834.1| seryl-tRNA synthetase [Vibrio cholerae M66-2]
 gi|229505295|ref|ZP_04394805.1| seryl-tRNA synthetase [Vibrio cholerae BX 330286]
 gi|229511035|ref|ZP_04400514.1| seryl-tRNA synthetase [Vibrio cholerae B33]
 gi|229515492|ref|ZP_04404951.1| seryl-tRNA synthetase [Vibrio cholerae TMA 21]
 gi|229518156|ref|ZP_04407600.1| seryl-tRNA synthetase [Vibrio cholerae RC9]
 gi|229525721|ref|ZP_04415126.1| seryl-tRNA synthetase [Vibrio cholerae bv. albensis VL426]
 gi|229529801|ref|ZP_04419191.1| seryl-tRNA synthetase [Vibrio cholerae 12129(1)]
 gi|229608314|ref|YP_002878962.1| seryl-tRNA synthetase [Vibrio cholerae MJ-1236]
 gi|254225503|ref|ZP_04919113.1| seryl-tRNA synthetase [Vibrio cholerae V51]
 gi|254848239|ref|ZP_05237589.1| seryl-tRNA synthetase [Vibrio cholerae MO10]
 gi|255745522|ref|ZP_05419470.1| seryl-tRNA synthetase [Vibrio cholera CIRS 101]
 gi|258621723|ref|ZP_05716754.1| seryl-tRNA synthetase [Vibrio mimicus VM573]
 gi|258626331|ref|ZP_05721178.1| seryl-tRNA synthetase [Vibrio mimicus VM603]
 gi|262158404|ref|ZP_06029520.1| seryl-tRNA synthetase [Vibrio cholerae INDRE 91/1]
 gi|262165386|ref|ZP_06033123.1| seryl-tRNA synthetase [Vibrio mimicus VM223]
 gi|262170266|ref|ZP_06037953.1| seryl-tRNA synthetase [Vibrio cholerae RC27]
 gi|298498786|ref|ZP_07008593.1| seryl-tRNA synthetase [Vibrio cholerae MAK 757]
 gi|30173216|sp|Q9KSZ6|SYS_VIBCH RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|172047403|sp|A5F2H1|SYS_VIBC3 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|254783501|sp|C3LU07|SYS_VIBCM RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|9655580|gb|AAF94269.1| seryl-tRNA synthetase [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121546863|gb|EAX57021.1| seryl-tRNA synthetase [Vibrio cholerae 2740-80]
 gi|121631195|gb|EAX63568.1| seryl-tRNA synthetase [Vibrio cholerae V52]
 gi|124115895|gb|EAY34715.1| seryl-tRNA synthetase [Vibrio cholerae 1587]
 gi|125621973|gb|EAZ50297.1| seryl-tRNA synthetase [Vibrio cholerae V51]
 gi|126512498|gb|EAZ75092.1| seryl-tRNA synthetase [Vibrio cholerae NCTC 8457]
 gi|126518589|gb|EAZ75812.1| seryl-tRNA synthetase [Vibrio cholerae B33]
 gi|146316684|gb|ABQ21223.1| seryl-tRNA synthetase [Vibrio cholerae O395]
 gi|148876356|gb|EDL74491.1| seryl-tRNA synthetase [Vibrio cholerae 623-39]
 gi|149741468|gb|EDM55498.1| seryl-tRNA synthetase [Vibrio cholerae MZO-2]
 gi|227009171|gb|ACP05383.1| seryl-tRNA synthetase [Vibrio cholerae M66-2]
 gi|227012925|gb|ACP09135.1| seryl-tRNA synthetase [Vibrio cholerae O395]
 gi|229333575|gb|EEN99061.1| seryl-tRNA synthetase [Vibrio cholerae 12129(1)]
 gi|229339302|gb|EEO04319.1| seryl-tRNA synthetase [Vibrio cholerae bv. albensis VL426]
 gi|229344871|gb|EEO09845.1| seryl-tRNA synthetase [Vibrio cholerae RC9]
 gi|229347261|gb|EEO12221.1| seryl-tRNA synthetase [Vibrio cholerae TMA 21]
 gi|229351000|gb|EEO15941.1| seryl-tRNA synthetase [Vibrio cholerae B33]
 gi|229357518|gb|EEO22435.1| seryl-tRNA synthetase [Vibrio cholerae BX 330286]
 gi|229370969|gb|ACQ61392.1| seryl-tRNA synthetase [Vibrio cholerae MJ-1236]
 gi|254843944|gb|EET22358.1| seryl-tRNA synthetase [Vibrio cholerae MO10]
 gi|255736597|gb|EET91994.1| seryl-tRNA synthetase [Vibrio cholera CIRS 101]
 gi|258581383|gb|EEW06285.1| seryl-tRNA synthetase [Vibrio mimicus VM603]
 gi|258585954|gb|EEW10672.1| seryl-tRNA synthetase [Vibrio mimicus VM573]
 gi|262021281|gb|EEY39995.1| seryl-tRNA synthetase [Vibrio cholerae RC27]
 gi|262025102|gb|EEY43770.1| seryl-tRNA synthetase [Vibrio mimicus VM223]
 gi|262029845|gb|EEY48493.1| seryl-tRNA synthetase [Vibrio cholerae INDRE 91/1]
 gi|297543119|gb|EFH79169.1| seryl-tRNA synthetase [Vibrio cholerae MAK 757]
 gi|327483814|gb|AEA78221.1| Seryl-tRNA synthetase [Vibrio cholerae LMA3894-4]
          Length = 435

 Score =  440 bits (1131), Expect = e-121,   Method: Composition-based stats.
 Identities = 194/434 (44%), Positives = 268/434 (61%), Gaps = 11/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   +     L +R  +   E I +L+E+ + +  ++E++++ RNS S QIGQ
Sbjct: 1   MLDSKLLRTELDETAAKLARRGFKLDVETIRTLEEQRKSIQVEVENLQSTRNSISKQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +A G+ +  +A+K +  TL + L   + E   V + L  +   +PN+P + VP G   +
Sbjct: 61  LMASGDKAGAEAVKQQIGTLGDDLDAKKVELDAVMAQLDAITQTVPNIPDDAVPNGKDDS 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +   G   +     ++H ++GE    +DF  ATK++GARF V+ G  A L RA+ Q
Sbjct: 121 ENVEVSRWGTPKTYDFEVKDHVDLGEMGDGLDFASATKITGARFVVMKGQFARLHRAIAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-----------TDGRWLI 229
           FM+DLHT +HGYTE+  P LV  E ++GTGQ+PKF  D+F T                LI
Sbjct: 181 FMLDLHTDQHGYTELYVPYLVNAETLFGTGQLPKFGQDLFHTEPLTEKASDEEPRRLSLI 240

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV +TNL    I++   LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I
Sbjct: 241 PTAEVPVTNLVRDTILDEAELPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQI 300

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
           TR EDS    E +   AE++L+ L+L YR V LCTGD+GF +CKTYDLEVW+  Q  YRE
Sbjct: 301 TRPEDSMAALEELTGHAEKVLQLLELPYRKVILCTGDMGFGSCKTYDLEVWVPAQKTYRE 360

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR ++AILENY  ADG + I
Sbjct: 361 ISSCSNMWDFQARRMQARFRRKGEKKPELVHTLNGSGLAVGRTMVAILENYQEADGRIAI 420

Query: 410 PTVLRPYMNNLAVI 423
           P VL+ YM  L  I
Sbjct: 421 PAVLQKYMGGLTHI 434


>gi|262171855|ref|ZP_06039533.1| seryl-tRNA synthetase [Vibrio mimicus MB-451]
 gi|261892931|gb|EEY38917.1| seryl-tRNA synthetase [Vibrio mimicus MB-451]
          Length = 435

 Score =  440 bits (1131), Expect = e-121,   Method: Composition-based stats.
 Identities = 194/434 (44%), Positives = 268/434 (61%), Gaps = 11/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   +     L +R  +   E I +L+E+ + +  ++E++++ RNS S QIGQ
Sbjct: 1   MLDSKLLRTELDETAAKLARRGFKLDVETIRTLEEQRKSIQVEVENLQSTRNSISKQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +A G+ +  +A+K +  TL + L   + E   V + L  +   +PN+P + VP G   +
Sbjct: 61  LMASGDKAGAEAVKQQIGTLGDDLDAKKVELDAVMAQLDAITQTVPNIPDDAVPNGKDDS 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +   G   +     ++H ++GE    +DF  ATK++GARF V+ G  A L RA+ Q
Sbjct: 121 ENVEVSRWGTPKTYDFEVKDHVDLGEMGDGLDFASATKITGARFVVMKGQFARLHRAIAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-----------TDGRWLI 229
           FM+DLHT +HGYTE+  P LV  E ++GTGQ+PKF  D+F T                LI
Sbjct: 181 FMLDLHTDQHGYTELYVPYLVNAETLFGTGQLPKFGQDLFHTEPLTEKASDEEPRRLSLI 240

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV +TNL    I++   LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I
Sbjct: 241 PTAEVPVTNLVRDTILDEAELPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQI 300

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
           TR EDS    E +   AE++L+ L+L YR V LCTGD+GF +CKTYDLEVW+  Q  YRE
Sbjct: 301 TRPEDSMAALEELTGHAEKVLQLLELPYRKVILCTGDMGFGSCKTYDLEVWVPAQKTYRE 360

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR ++AILENY  ADG + I
Sbjct: 361 ISSCSNMWDFQARRMQARFRRKGEKKPELVHTLNGSGLAVGRTMVAILENYQEADGRIAI 420

Query: 410 PTVLRPYMNNLAVI 423
           P VL+ YM  L  I
Sbjct: 421 PAVLQKYMGGLTQI 434


>gi|90579108|ref|ZP_01234918.1| seryl-tRNA synthetase [Vibrio angustum S14]
 gi|90439941|gb|EAS65122.1| seryl-tRNA synthetase [Vibrio angustum S14]
          Length = 435

 Score =  440 bits (1131), Expect = e-121,   Method: Composition-based stats.
 Identities = 194/434 (44%), Positives = 267/434 (61%), Gaps = 11/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   +     L +R      E + +L+EK + L  K E+++A+RNS S  IGQ
Sbjct: 1   MLDSKLLRTELDETAEKLARRGFNLDVETLRNLEEKRKSLQVKTEELQAQRNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+    + +  E   L  +L   +K   E+ + L  +   +PN+P + VP+G   +
Sbjct: 61  AKAKGDHEEAERIMAEVGNLGSELDDAKKALAELQAELDVITQSVPNIPDDSVPVGKDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ I   G+  +     ++H ++GE  G +DF  A K++GARF V+ G  A L RA+ Q
Sbjct: 121 ENVEISRWGEPKALDFDVKDHVDLGEMAGGLDFASAVKITGARFIVMKGQFARLHRAIAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-----------GRWLI 229
           FM+DLHT EHGYTE+  P LV  ++++GTGQ+PKF +D+F T                LI
Sbjct: 181 FMLDLHTEEHGYTEMYVPYLVNADSLFGTGQLPKFGEDLFHTQPLTEKVNDEEPRVLSLI 240

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV +TN+    I +   LP++ T   P FRSEAGS GRDTRG++R HQF K ELV I
Sbjct: 241 PTAEVPVTNMMRDTITDEADLPVKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQI 300

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
           T+ EDS    E +   AE++L+ L+L YR V LCTGD+GF ACKTYDLEVW+  Q  YRE
Sbjct: 301 TKPEDSMAALEELTGHAEKVLQLLELPYRKVVLCTGDMGFGACKTYDLEVWVPAQETYRE 360

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR ++AILEN   ADG + I
Sbjct: 361 ISSCSNMWDFQARRMQARFRRKGEKKPELLHTLNGSGLAVGRTMVAILENNQQADGRIEI 420

Query: 410 PTVLRPYMNNLAVI 423
           P VLR YMN +  I
Sbjct: 421 PEVLRKYMNGMTHI 434


>gi|183598338|ref|ZP_02959831.1| hypothetical protein PROSTU_01730 [Providencia stuartii ATCC 25827]
 gi|188020514|gb|EDU58554.1| hypothetical protein PROSTU_01730 [Providencia stuartii ATCC 25827]
          Length = 429

 Score =  440 bits (1131), Expect = e-121,   Method: Composition-based stats.
 Identities = 192/430 (44%), Positives = 261/430 (60%), Gaps = 9/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R   + +   L +R      E +  L+E+ ++L  + E ++A RNS S  IG 
Sbjct: 1   MLDPNLLRTELDAVAEKLARRGFTLDVEKLRELEERRKVLQVETESLQAERNSRSKSIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   +    ++   ++ +   IPN+P + VP G   +
Sbjct: 61  AKARG--EDIEPLRQEVNQLGEKLDAAKLALDKLQQEIRDIALSIPNMPDDAVPDGKDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G+        ++H  +GE  G +DF  A KL+GARF V+ G +A L RAL Q
Sbjct: 119 DNVEVARWGEPRQYDFEIKDHVSLGELAGGLDFPAAVKLTGARFVVMKGQIARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM+DLHT +HGY E+  P LV  + +YGTGQ+PKF +D+F T            LIPT+E
Sbjct: 179 FMLDLHTEQHGYQELYVPYLVNHDTLYGTGQLPKFGEDLFHTKPLEEEAESTYALIPTAE 238

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V +TNL   EI++  +LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I   E
Sbjct: 239 VPVTNLVRDEILDEDALPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQIVHPE 298

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S    E +   AE++L+ L L YR V LCTGD+GF + KTYDLEVWL  QN YREISSC
Sbjct: 299 KSMEALEELTGHAEKVLQLLKLPYRKVILCTGDIGFGSRKTYDLEVWLPAQNTYREISSC 358

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR L+A+LENY  ADG + +P VL
Sbjct: 359 SNMWDFQARRMQARFRSKGDKKTQLVHTLNGSGLAVGRTLVAVLENYQLADGRIEVPEVL 418

Query: 414 RPYMNNLAVI 423
           RPYM  L  I
Sbjct: 419 RPYMKGLEYI 428


>gi|147676348|ref|YP_001210563.1| seryl-tRNA synthetase [Pelotomaculum thermopropionicum SI]
 gi|189083576|sp|A5D6D5|SYS_PELTS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|146272445|dbj|BAF58194.1| seryl-tRNA synthetase [Pelotomaculum thermopropionicum SI]
          Length = 422

 Score =  440 bits (1131), Expect = e-121,   Method: Composition-based stats.
 Identities = 203/424 (47%), Positives = 279/424 (65%), Gaps = 4/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++++R NP  +  AL +R +    +    LDE+ R  +  +E ++ RRN  S +IG+
Sbjct: 1   MLDMKFVRNNPAAVRDALARRGVSVALDEFYKLDEERREKLFIVEQMKNRRNVVSEEIGR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G  +    +  E   L  Q+  +++E  E+   L+ ++  IPN+P E VP G  A 
Sbjct: 61  LKKSGKDAP--EMVLEMRDLSRQIKEIDEEIKELDGRLQDMLLNIPNIPHESVPEGAGAA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN ++R+ GK        R H+EIGE L ++DF+R  K++GARFS   G+ A LERA+  
Sbjct: 119 ENPVVRTWGKPRDFGFTPRPHWEIGEQLDIIDFERGGKVAGARFSFYKGYGARLERAVIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-TTDGRWLIPTSEVSLTNL 239
           FM+DLHT+EHGY E+  P +V  ++M GTGQ+PKFA+DMF       +LIPT+EV +TNL
Sbjct: 179 FMLDLHTAEHGYVEIFPPFIVNRDSMVGTGQLPKFAEDMFKLEGAEYYLIPTAEVPVTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y +EI++ + LP+     +  FR+EAG+AGRDTRG++RQHQF K ELV   R EDS+ E 
Sbjct: 239 YRNEILDGEKLPILHCAYSACFRAEAGAAGRDTRGLIRQHQFNKVELVKFCRPEDSYDEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++ + AE++L++L L YRVV LCTGDLGFSA KTYDLEVWL     Y+EISSCS   +F
Sbjct: 299 EKLTADAEKVLQKLGLPYRVVVLCTGDLGFSAAKTYDLEVWLPSYQEYKEISSCSNFADF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR   R+R+   K  +F HTLNGSG+AVGR + AILENY  ADGSVT+P  LRPYM  
Sbjct: 359 QARRAGIRFRNARGK-TEFVHTLNGSGLAVGRTVAAILENYQEADGSVTVPEALRPYMGG 417

Query: 420 LAVI 423
           L+ I
Sbjct: 418 LSRI 421


>gi|121998174|ref|YP_001002961.1| seryl-tRNA synthetase [Halorhodospira halophila SL1]
 gi|166222731|sp|A1WWU7|SYS_HALHL RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|121589579|gb|ABM62159.1| seryl-tRNA synthetase [Halorhodospira halophila SL1]
          Length = 425

 Score =  440 bits (1131), Expect = e-121,   Method: Composition-based stats.
 Identities = 197/425 (46%), Positives = 268/425 (63%), Gaps = 4/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M+D + +R +PE +   L +R  E  +    +LD + R L ++ + ++ +RN  S +IG 
Sbjct: 1   MIDPKLLRNDPEGVAANLARRGFEFDAAGYRALDARRRDLQQETQTLQNQRNERSKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G    ++ LK E   + E+L   E   +EV   L +L   +PN+  E+VP G    
Sbjct: 61  AKKRG--EDIEPLKAEVGRIAERLSEAETALNEVQEQLDELHLGLPNLLDEQVPDGQDEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N ++R  G  P+     R+H ++GE LG MDF+ A +++G+RF  L+G LA L RAL Q
Sbjct: 119 DNRVLRQWGGIPALSFKPRDHVDLGELLGGMDFEAAARIAGSRFVTLSGPLARLHRALTQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG--RWLIPTSEVSLTN 238
           FM+DLH  EHGYTEV  P LV   ++ GTGQ+PKF DD+F        +L PT+EV +TN
Sbjct: 179 FMLDLHCREHGYTEVYVPYLVNARSLTGTGQLPKFEDDLFRVEHDPSLYLAPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L    I+E   +PLRF    P FRSEAGS G+DTRGM+RQHQF K ELV + R  +S+  
Sbjct: 239 LVQERIVEDADMPLRFVCHTPCFRSEAGSYGKDTRGMIRQHQFEKVELVQVVRPGESWDA 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E +   AE +L+RL L YRVVSLC GD+GFSA +TYDLEVWL  Q  YREISSCS   +
Sbjct: 299 LEALTGHAETVLRRLALPYRVVSLCGGDIGFSAARTYDLEVWLPAQERYREISSCSNFTD 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR+ +R+R+P +   +  HTLNGSG+AVGRCL+AILENY  ADG V +P  L PYM 
Sbjct: 359 FQARRLQARWRNPETGKPEPVHTLNGSGLAVGRCLVAILENYQEADGRVNVPEALVPYMG 418

Query: 419 NLAVI 423
              ++
Sbjct: 419 GQRLL 423


>gi|261210729|ref|ZP_05925021.1| seryl-tRNA synthetase [Vibrio sp. RC341]
 gi|260840214|gb|EEX66794.1| seryl-tRNA synthetase [Vibrio sp. RC341]
          Length = 435

 Score =  440 bits (1131), Expect = e-121,   Method: Composition-based stats.
 Identities = 194/434 (44%), Positives = 268/434 (61%), Gaps = 11/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   +     L +R  +   E I +L+E+ + +  ++E++++ RNS S QIGQ
Sbjct: 1   MLDSKLLRTELDETAAKLARRGFKLDVETIRTLEEQRKSIQVEVENLQSTRNSISKQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +A G+ +  +A+K +  TL + L   + E   V + L  +   +PN+P + VP G   +
Sbjct: 61  LMASGDKAGAEAVKQQIGTLGDDLDAKKVELDAVMAQLDAITQTVPNIPDDAVPNGRDDS 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +   G   +     ++H ++GE    +DF  ATK++GARF V+ G  A L RA+ Q
Sbjct: 121 ENVEVSRWGTPKTYDFEVKDHVDLGEMGDGLDFASATKITGARFVVMKGQFARLHRAIAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-----------TDGRWLI 229
           FM+DLHT +HGYTE+  P LV  E ++GTGQ+PKF  D+F T                LI
Sbjct: 181 FMLDLHTDQHGYTELYVPYLVNAETLFGTGQLPKFGQDLFHTEPLTEKASDEEPRRLSLI 240

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV +TNL    I++   LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I
Sbjct: 241 PTAEVPVTNLVRDTILDEAELPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQI 300

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
           TR EDS    E +   AE++L+ L+L YR V LCTGD+GF +CKTYDLEVW+  Q  YRE
Sbjct: 301 TRPEDSMAALEELTGHAEKVLQLLELPYRKVILCTGDMGFGSCKTYDLEVWVPAQKTYRE 360

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR ++AILENY  ADG + I
Sbjct: 361 ISSCSNMWDFQARRMQARFRRKGEKKPELVHTLNGSGLAVGRTMVAILENYQEADGRIAI 420

Query: 410 PTVLRPYMNNLAVI 423
           P VL+ YM  L  I
Sbjct: 421 PAVLQKYMGGLTHI 434


>gi|260424728|ref|ZP_05733081.2| serine--tRNA ligase [Dialister invisus DSM 15470]
 gi|260402970|gb|EEW96517.1| serine--tRNA ligase [Dialister invisus DSM 15470]
          Length = 440

 Score =  440 bits (1131), Expect = e-121,   Method: Composition-based stats.
 Identities = 189/427 (44%), Positives = 270/427 (63%), Gaps = 3/427 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI++IR+N E +   L  RH +   + ++ LD K R L++  E +++ RN+ + +I  
Sbjct: 7   MLDIKFIRENTEAVKANLVNRHNDFDLDEVIELDRKRRELLQMTEALKSERNAETKKIAL 66

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A    N        +    +  ++  ++KE   V   L+  +  IPN+    VP+G   +
Sbjct: 67  AKK--NKEDASVAISAMREVGTKIAAIDKELAGVELILQDSLLRIPNMTDASVPVGKDDS 124

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN  +R  G+       ++EH+E+GE LG++D +RA K+SGARF       A LERA+  
Sbjct: 125 ENPEVRRWGEIRKFPFPAKEHYELGENLGILDSERAGKVSGARFYFYLSMAARLERAVYN 184

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT-DGRWLIPTSEVSLTNL 239
           FM+D+HT ++ +TEV  P ++   +M GTGQ+PKF DDM+    +  ++ PT+EV LTN 
Sbjct: 185 FMLDVHTQQNDFTEVIPPYIINGASMQGTGQLPKFEDDMYKVEGENMYMTPTAEVPLTNY 244

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +S EI++   LP+  T L P FR EAGSAG+DTRG++RQHQF K E+V   + EDS+ E 
Sbjct: 245 FSGEILDGAVLPVHLTALTPCFRKEAGSAGKDTRGLIRQHQFHKVEMVKYCKPEDSWDEL 304

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E + + AE+IL+ L L Y VV LCTGD+GFS+ KTYD+EVW+ GQ  YREISSCS C +F
Sbjct: 305 ESLTAEAEKILQLLKLPYHVVCLCTGDIGFSSAKTYDIEVWMPGQQKYREISSCSNCLDF 364

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N R+R       +F HTLNGSG+AVGR + AI+ENY   DG++ +P VLRPYMN 
Sbjct: 365 QARRANIRFRRHQGDKPEFVHTLNGSGLAVGRTVAAIMENYQQEDGTIVVPDVLRPYMNG 424

Query: 420 LAVIKKE 426
           L +I K 
Sbjct: 425 LEIIGKR 431


>gi|134297896|ref|YP_001111392.1| seryl-tRNA synthetase [Desulfotomaculum reducens MI-1]
 gi|172044203|sp|A4J0G4|SYS_DESRM RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|134050596|gb|ABO48567.1| seryl-tRNA synthetase [Desulfotomaculum reducens MI-1]
          Length = 424

 Score =  440 bits (1131), Expect = e-121,   Method: Composition-based stats.
 Identities = 199/425 (46%), Positives = 272/425 (64%), Gaps = 3/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+++R NPE +   LKKR  +   +  L LD   R  +   E ++  RN  S +IG+
Sbjct: 1   MLDIKFVRSNPELVLEGLKKRGSDISLDEFLKLDSMRREKLVVAEQLKNTRNVVSQEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G  +    L  E   + +++  ++ E   +   L++++  IPN+P E VP+G   N
Sbjct: 61  LKKAGQDAEEKTL--EMRKVSQKIKDMDDEIRNIEEKLQEILLSIPNIPHESVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ IR  GK        + H+++GE L ++DF+R  K++GARFS   G  A LERAL  
Sbjct: 119 DNVEIRRWGKPRGFEFEPKPHWDLGEDLNILDFERGGKVTGARFSFYKGMGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-TTDGRWLIPTSEVSLTNL 239
           FM+DLHT EHGYTE+  P +V  ++M GTGQ+PKFA+DMF       +LIPT+EV +TNL
Sbjct: 179 FMLDLHTREHGYTEIFPPFIVNGDSMLGTGQLPKFAEDMFKLEGLNYYLIPTAEVPVTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y  EI+  + LP+     +  FR+EAG+AGRDTRG++RQHQF K ELV  ++ E+SF E 
Sbjct: 239 YRDEILAEEQLPIYHCAYSACFRAEAGAAGRDTRGLIRQHQFNKVELVKFSKPEESFDEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           ER+ + AE+IL+ L L YRVV L TGD+GF++ KTYDLEVWL   N Y+EISSCS   +F
Sbjct: 299 ERLTANAEKILQALGLPYRVVLLSTGDMGFTSAKTYDLEVWLPSYNAYKEISSCSNFLDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N +YR       +F HTLNGSG+AVGR L AILENY  ADGS+T+P VL PYM  
Sbjct: 359 QARRANIKYRPTPKSKPEFVHTLNGSGIAVGRALSAILENYQEADGSITVPPVLVPYMGG 418

Query: 420 LAVIK 424
           +  I 
Sbjct: 419 IERIT 423


>gi|330721801|gb|EGG99781.1| Seryl-tRNA synthetase [gamma proteobacterium IMCC2047]
          Length = 426

 Score =  440 bits (1131), Expect = e-121,   Method: Composition-based stats.
 Identities = 203/425 (47%), Positives = 281/425 (66%), Gaps = 4/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R N + +   LKK+  +     +  L+ + + +  + E ++  RNS S  IG+
Sbjct: 1   MLDSKLLRANLQDVADLLKKKKYQLDVARVTELEAQRKAIQTETEQLQNDRNSRSKNIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    +  L  E +++ E+L   + + ++V + L+ ++S +PN+P E VP G    
Sbjct: 61  AKAAG--EDIAPLIAEMNSMGERLDECKAKLNDVQAQLEGILSGVPNLPHESVPEGEDEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ + + G+  S     ++H ++G   G +DF+ A KL+GARF+ + G +A L RAL Q
Sbjct: 119 DNVTVLTWGEPRSFDFEPKDHVDVGANTGGLDFETAAKLTGARFATMKGQMAQLHRALIQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--TDGRWLIPTSEVSLTN 238
           FM++LHT +HGY EV  P +V  E +YGTGQ+PKFA+D+F     +  +LIPT+EV +TN
Sbjct: 179 FMLNLHTQQHGYEEVYVPYIVNSETLYGTGQLPKFAEDLFKVGSENDWYLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           +Y  EI+++  LP RFT   P FRSEAGS GRDTRGM+RQHQF K ELV +     SF  
Sbjct: 239 MYRGEILDAGELPKRFTAHTPCFRSEAGSYGRDTRGMIRQHQFEKVELVQLVEPTKSFDA 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E ++  AE++L+ L+L YR V LC GDLGFSA KTYDLEVWL GQ+ YREISSCS C +
Sbjct: 299 LEELVGQAEKVLQLLNLPYRKVILCGGDLGFSATKTYDLEVWLPGQDKYREISSCSNCLD 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRM  R+R+P +   +  HTLNGSG+AVGR L+AILENY NADGSVTIP VLRPYMN
Sbjct: 359 FQARRMQLRWRNPETGKPELLHTLNGSGLAVGRTLVAILENYQNADGSVTIPEVLRPYMN 418

Query: 419 NLAVI 423
           N   I
Sbjct: 419 NAEFI 423


>gi|39995148|ref|NP_951099.1| seryl-tRNA synthetase [Geobacter sulfurreducens PCA]
 gi|67461826|sp|Q74H55|SYS_GEOSL RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|39981910|gb|AAR33372.1| seryl-tRNA synthetase [Geobacter sulfurreducens PCA]
 gi|298504178|gb|ADI82901.1| seryl-tRNA synthetase [Geobacter sulfurreducens KN400]
          Length = 422

 Score =  440 bits (1131), Expect = e-121,   Method: Composition-based stats.
 Identities = 199/424 (46%), Positives = 269/424 (63%), Gaps = 4/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD +++R+N E ++  L  R  E        LDE+ R L+ + E ++A +NS S  I +
Sbjct: 1   MLDAKYLRENLEEVEARLATRGSEVSLGRFRELDERRRALLTESESLKALKNSVSEAISK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
                + S +     E   +  ++  L+ E   +   L+ ++  +PNVP   VP+G S  
Sbjct: 61  VK---DKSQIQDKIAEMREVGVRIKGLDDELRGIEDELQMVLLTVPNVPHPTVPVGASEA 117

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N  +R+ G+ P      + H+EIGE LG++DF+R  KL+GARF++  G  A LERAL  
Sbjct: 118 DNRQVRTWGEPPCFAFDPKPHWEIGEGLGILDFERGAKLTGARFTLYRGAGARLERALVN 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-TTDGRWLIPTSEVSLTNL 239
           FM+DLHT  H Y E+  P +V  E+M GTGQ+PKF DD+F       +LIPT+EV +TN+
Sbjct: 178 FMLDLHTERHNYLEMLPPFVVNRESMTGTGQLPKFEDDLFHLEGVDYFLIPTAEVPVTNI 237

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +  EI+++  LPL +T   P FR EAGS G+D RG++RQHQF K ELV       S+ E 
Sbjct: 238 HRAEILKAADLPLSYTAYTPCFRKEAGSYGKDVRGLIRQHQFNKVELVKFVHPATSYDEL 297

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++LS AEE+L++L L YRVV LCTGD+GFSA KTYD+EVWL GQ  YREISSCS   +F
Sbjct: 298 EKLLSNAEEVLRQLGLAYRVVELCTGDMGFSAAKTYDIEVWLPGQETYREISSCSNFEDF 357

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           QSRR + R+R+      +F HTLNGSG+AVGR L+AILENY   DGSV IP VLRPYM  
Sbjct: 358 QSRRASIRFREDEKSKPEFVHTLNGSGLAVGRTLVAILENYQQEDGSVVIPDVLRPYMGG 417

Query: 420 LAVI 423
           L  I
Sbjct: 418 LQKI 421


>gi|127512948|ref|YP_001094145.1| seryl-tRNA synthetase [Shewanella loihica PV-4]
 gi|166223287|sp|A3QEI8|SYS_SHELP RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|126638243|gb|ABO23886.1| seryl-tRNA synthetase [Shewanella loihica PV-4]
          Length = 428

 Score =  440 bits (1131), Expect = e-121,   Method: Composition-based stats.
 Identities = 197/429 (45%), Positives = 265/429 (61%), Gaps = 8/429 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD +++R   E     L  R      + +  L+EK + L    E+++A RN+ S  IGQ
Sbjct: 1   MLDPKFLRTELEATAERLATRGFILDVDRLSKLEEKRKSLQVATEELQASRNAISKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G    V  +  +   L  +L   E E  ++   L  +   +PN+P E  PIG   N
Sbjct: 61  AKAKG--EDVAPIMAKVGDLGAELSSKEAELKQLLEELNAIAMSVPNLPDESAPIGADEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ IR  G+        ++H ++GE    +DF  A K++G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEIRRWGEPKQFDFDVKDHVDLGEQHAGLDFKSAVKITGSRFIVMKGQIARMHRALTQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG------RWLIPTSEV 234
           FM+DLHT+EHGYTE   PLLV ++++ GTGQ+PKF +D+F T           LIPT+EV
Sbjct: 179 FMLDLHTTEHGYTETYVPLLVNEDSLLGTGQLPKFGEDLFHTKPATEEGQGLSLIPTAEV 238

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            LTNL    II+   LP++ T     FRSEAGS GRDTRG++RQHQF K ELV + + ED
Sbjct: 239 PLTNLARDTIIDEDELPIKMTAHTACFRSEAGSYGRDTRGLIRQHQFDKVELVQLVKPED 298

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCS 354
           S    E +   AE +L+RL L YR V LCTGD+GF A KT+D+EVWL  QN YREISSCS
Sbjct: 299 SMAALESLTQHAETVLQRLGLPYRTVVLCTGDMGFGAAKTFDIEVWLPAQNTYREISSCS 358

Query: 355 TCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR 414
              +FQ+RRM +RY+  ++K     HTLNGSG+AVGR L+A+LENY NADGS+T+P  LR
Sbjct: 359 NMQDFQARRMQARYKAKSAKKPALLHTLNGSGLAVGRTLVAVLENYQNADGSITVPEALR 418

Query: 415 PYMNNLAVI 423
           PYM  L  I
Sbjct: 419 PYMGGLTQI 427


>gi|291616897|ref|YP_003519639.1| SerS [Pantoea ananatis LMG 20103]
 gi|291151927|gb|ADD76511.1| SerS [Pantoea ananatis LMG 20103]
          Length = 430

 Score =  439 bits (1130), Expect = e-121,   Method: Composition-based stats.
 Identities = 201/431 (46%), Positives = 269/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   E + SL+E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVEMLRSLEERRKVLQVETENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E ++L E+L   + E  E+ + ++     +PN+P + VP+G    
Sbjct: 61  AKARG--EDIEPLRQEVNSLGERLDAAKAELDELQNQIRDFSLALPNLPADVVPLGKDDT 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ I   G+        ++H E+GEA   +DF  A KL+G+RF V+ G +A L RAL Q
Sbjct: 119 ENLEISRWGEPRQFDFQVKDHVELGEAAKGLDFAAAVKLTGSRFVVMQGQIARLHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FMIDLHT +HGY E   P LV    +YGTGQ+PKF +D+F T             LIPT+
Sbjct: 179 FMIDLHTEQHGYLETYVPYLVNHATLYGTGQLPKFGEDLFHTRPLEEESESSHYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI+E ++LPL+ T   P FRSEAGS GRDTRG++R HQF K E+V I   
Sbjct: 239 EVPLTNLVRDEIVEEENLPLKLTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVAP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E S    E ++  AE++L+ L+L YR V LCTGD+GF A KTYDLEVWL  QN YREISS
Sbjct: 299 ETSMDALEELVGHAEKVLQLLNLPYRKVLLCTGDMGFGATKTYDLEVWLPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS  G+FQ+RRM +R R    K  +  HTLNGSG+AVGR L+A+LENY   DG + +P V
Sbjct: 359 CSNMGDFQARRMQARTRSKQDKKPRLVHTLNGSGLAVGRTLVAVLENYQQQDGRIAVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMKGLEFI 429


>gi|261378875|ref|ZP_05983448.1| serine--tRNA ligase [Neisseria cinerea ATCC 14685]
 gi|269144690|gb|EEZ71108.1| serine--tRNA ligase [Neisseria cinerea ATCC 14685]
          Length = 431

 Score =  439 bits (1130), Expect = e-121,   Method: Composition-based stats.
 Identities = 201/433 (46%), Positives = 277/433 (63%), Gaps = 9/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L +R  +  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTASVAERLARRGYDFDTARFDALEERRKSVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPTGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +AHL RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMRGQIAHLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-------TTDGRWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F        T   ++LIPT+E
Sbjct: 180 FMLDTHTLKHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  I++   LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVAGSILDEGGLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIKKE 426
           +PYM  +A ++ +
Sbjct: 419 QPYMGGVAKLEVK 431


>gi|78224711|ref|YP_386458.1| seryl-tRNA synthetase [Geobacter metallireducens GS-15]
 gi|123570656|sp|Q39PU1|SYS_GEOMG RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|78195966|gb|ABB33733.1| seryl-tRNA synthetase [Geobacter metallireducens GS-15]
          Length = 423

 Score =  439 bits (1130), Expect = e-121,   Method: Composition-based stats.
 Identities = 196/426 (46%), Positives = 273/426 (64%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R+N E ++  L  R      +    LD + R L+++ E ++A RN+ S +I +
Sbjct: 1   MLDPKHLRENFESVEQRLATRGGAVTLDRFRELDSRRRELLREAESLKAVRNAASEEISR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
                + S       E   +  ++ +L+ +   V   L+ ++  IPN+P + VP+G S  
Sbjct: 61  IK---DKSQAQPRIAEMREVSAKIKVLDDDLRGVDDDLQAVLLTIPNIPHQSVPVGASEA 117

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N  +R  G+ P      R H+EIGE LG++DF+R  KL+GARF++  G  A LERAL  
Sbjct: 118 DNREVRKWGEPPRFGFTPRPHWEIGEGLGILDFERGAKLTGARFTLYRGAGARLERALIN 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT-DGRWLIPTSEVSLTNL 239
           FM+DLHT +HGY E   P +V  E+M GTGQ+PKF +D+F       +LIPT+EV +TN+
Sbjct: 178 FMLDLHTEKHGYEETLPPFMVNRESMTGTGQLPKFEEDLFHLDGTDYYLIPTAEVPVTNI 237

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +  EI++   LPL +T   P FR EAGS G+D RG++RQHQF K ELV  T    S+ E 
Sbjct: 238 HRGEILKGSDLPLSYTAYTPCFRKEAGSYGKDVRGLIRQHQFNKVELVKFTHPSTSYAEL 297

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           ER+L+ AEE+L++L LHYRVV LCTGD+GFSA KTYD+EVWL  Q+ YREISSCS   +F
Sbjct: 298 ERLLANAEEVLRQLGLHYRVVELCTGDMGFSAAKTYDIEVWLPAQDTYREISSCSNFEDF 357

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR + R+R+ +    +F HTLNGSG+AVGR L+AILENY   DG+V IP VLRPYM  
Sbjct: 358 QARRASIRFREDDKAKPEFAHTLNGSGLAVGRTLVAILENYQQEDGTVVIPEVLRPYMGG 417

Query: 420 LAVIKK 425
            + I +
Sbjct: 418 CSSIGR 423


>gi|312792870|ref|YP_004025793.1| seryl-tRNA synthetase [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312180010|gb|ADQ40180.1| seryl-tRNA synthetase [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 420

 Score =  439 bits (1130), Expect = e-121,   Method: Composition-based stats.
 Identities = 199/424 (46%), Positives = 281/424 (66%), Gaps = 4/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD+++IR NPE +   L KR+ +     IL LDEK R L+ ++E ++A +N  S ++ +
Sbjct: 1   MLDLKYIRTNPEKVQEGLSKRNKDISIAPILELDEKRRKLLAEVESLKALQNQKSKEVPR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG    V  L NE   L +++  L+    EV   ++K++  IPN+P E VP+G    
Sbjct: 61  LKKEGK--DVTELMNELKELSDKIKELDSRFKEVEDEIEKILLTIPNIPHESVPVGKDDT 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G         + H+EIG +LG++DF+RA+K+SG+RF+   G  A LERAL  
Sbjct: 119 ENVEVRRWGDVRVPDFEVKPHWEIGMSLGILDFERASKVSGSRFTFYRGLGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLH  +HGYTE+  P LV  ++M GTGQ+PKF +D F TTD  +LIPT+EV +TN +
Sbjct: 179 FMLDLHIEKHGYTEIFPPFLVARKSMIGTGQLPKFEEDAFKTTDDYFLIPTAEVPVTNYH 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ + LP+++   +  FR+EAG+AG+DTRG++RQHQF K ELV   + E+S+ E E
Sbjct: 239 REEILKEEDLPIKYVAYSACFRAEAGAAGKDTRGLIRQHQFNKVELVKFAKPEESYDELE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           ++ + AE++LK L L YRVV LC+GDLGFS+ KTYD+EVW+     Y EISSCS   ++Q
Sbjct: 299 KLTADAEDVLKELGLPYRVVLLCSGDLGFSSAKTYDIEVWMPSYGRYVEISSCSNFESYQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RR N R+R  + K L + HTLNGSG+AVGR L AILEN+   DG+V +P VLR YM   
Sbjct: 359 ARRANIRFRRKDGK-LDYVHTLNGSGLAVGRTLAAILENFQQKDGTVVVPEVLRKYM-GT 416

Query: 421 AVIK 424
            VIK
Sbjct: 417 DVIK 420


>gi|319790114|ref|YP_004151747.1| seryl-tRNA synthetase [Thermovibrio ammonificans HB-1]
 gi|317114616|gb|ADU97106.1| seryl-tRNA synthetase [Thermovibrio ammonificans HB-1]
          Length = 427

 Score =  439 bits (1130), Expect = e-121,   Method: Composition-based stats.
 Identities = 203/429 (47%), Positives = 278/429 (64%), Gaps = 5/429 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRH--LEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQI 58
           M+DI+ +R+ PE     L +R        + +L++D + R LI + E+++ARRN  S +I
Sbjct: 1   MIDIKALRREPEKFKELLSRRDPLYASMVDELLAVDAERRALITEAENLKARRNKLSKEI 60

Query: 59  GQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTS 118
           G+   EG       LK E   + E+L  +E+E  EV     +LI  IPN P   VP+G  
Sbjct: 61  GKLFKEGRREEALKLKAEVEEISEKLVKVERELAEVEKKFNRLILSIPNPPHPSVPVGED 120

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
            N+N+++R  G+KP        H++I ++L ++DF+RATKL+G+RF V     A LERAL
Sbjct: 121 ENDNVVVRVWGEKPKFDFTPVPHWDIAKSLDILDFERATKLAGSRFVVYKKWGAKLERAL 180

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT-DGRWLIPTSEVSLT 237
             FM+DLHT+EHGY E+  P LV  + M GTGQ+PKF +D++    +  WLIPT+EV LT
Sbjct: 181 INFMLDLHTTEHGYQEIIPPFLVNTKTMTGTGQLPKFEEDLYKIEGEDLWLIPTAEVPLT 240

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           NL+++EI+  K+LP+ +T   P FR EAG+ GRD RG++R HQF K ELV I   E S+ 
Sbjct: 241 NLHANEILPEKALPIYYTAYTPCFRKEAGAHGRDVRGIMRLHQFNKVELVKIVHPETSYD 300

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E E+++  AE++L+ L LHYRVV LCTGDLGFSA KTYD+EVW+  Q  YREISSCS C 
Sbjct: 301 ELEKLVKEAEKVLQLLGLHYRVVELCTGDLGFSAAKTYDIEVWIPSQERYREISSCSNCE 360

Query: 358 NFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +FQ+RR   R+RD   K  +  HTLNGSG+AVGR +IAILE +   DGSV +P VL+ Y+
Sbjct: 361 DFQARRAKIRFRDKEGK-TQLVHTLNGSGLAVGRTVIAILEQFQQKDGSVKVPEVLQDYL 419

Query: 418 NNLAVIKKE 426
               VI  E
Sbjct: 420 K-TKVITPE 427


>gi|251792122|ref|YP_003006842.1| seryl-tRNA synthetase [Aggregatibacter aphrophilus NJ8700]
 gi|247533509|gb|ACS96755.1| seryl-tRNA synthetase [Aggregatibacter aphrophilus NJ8700]
          Length = 435

 Score =  439 bits (1130), Expect = e-121,   Method: Composition-based stats.
 Identities = 203/437 (46%), Positives = 268/437 (61%), Gaps = 14/437 (3%)

Query: 1   MLDIQWIRQNPEHLDIALK-KRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           M+D   +R N   +   LK KR      E I  L+E+ + L  K E ++A RN+ S  IG
Sbjct: 1   MIDPNLLRNNLAEVAEKLKVKRGFTLDVEKITQLEEQRKALQVKTETLQAERNARSKVIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
            A A G    +  L  E   + E+L   + E  +V ++L  +   IPN+P +EVP+G   
Sbjct: 61  AAKARG--EDIAPLLAEVDHMGEELEQGKAELEKVQNALNDIALNIPNIPADEVPLGKDD 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+ +   G+         +H  +GE L  +DF  A KL+G+RF V+ G +A L RA+ 
Sbjct: 119 SDNLEVSRWGEPRKFDFDILDHVSLGEQLQGLDFAAAVKLTGSRFVVMKGQIARLHRAIS 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-----------TDGRWL 228
           QFM+DLHT +HGYTE   P LV  + +YGTGQ+PKF +D+F T                L
Sbjct: 179 QFMLDLHTEQHGYTEAYVPYLVNHDTLYGTGQLPKFGEDLFHTKPLEGQDPNEVQRTYGL 238

Query: 229 IPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVS 288
           IPT+EV +TNL   EI+E+++LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV 
Sbjct: 239 IPTAEVPVTNLVRGEILEAENLPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQ 298

Query: 289 ITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYR 348
           I   E S    E +   AE++L+ L L YR V LCTGD+GF +CKTYDLEVW+  QN YR
Sbjct: 299 IVEPEKSMEALEELTGHAEKVLQLLGLPYRKVLLCTGDMGFGSCKTYDLEVWVPAQNTYR 358

Query: 349 EISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVT 408
           EISSCS   +FQ+RRM +R R    K  +  HTLNGSG+AVGR L+A+LENY NADGS+T
Sbjct: 359 EISSCSNMWDFQARRMQARCRSKGDKKTRLVHTLNGSGLAVGRTLVAVLENYQNADGSIT 418

Query: 409 IPTVLRPYMNNLAVIKK 425
           +P VLRPYM  L VI K
Sbjct: 419 VPEVLRPYMGGLEVIGK 435


>gi|83858681|ref|ZP_00952203.1| seryl-tRNA synthetase [Oceanicaulis alexandrii HTCC2633]
 gi|83853504|gb|EAP91356.1| seryl-tRNA synthetase [Oceanicaulis alexandrii HTCC2633]
          Length = 424

 Score =  439 bits (1130), Expect = e-121,   Method: Composition-based stats.
 Identities = 231/425 (54%), Positives = 296/425 (69%), Gaps = 1/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR  P   D A+ +R LEPQ++ ++ LD + R    +++++   RNS S +IG+
Sbjct: 1   MHDIRLIRDEPAAFDAAMAQRGLEPQAQRLIDLDARRREATTRLQEVETERNSKSKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+    +AL+ E  +LK ++  L +E       L + ++ +PN P E+VP G   N
Sbjct: 61  AKAQGDEDRFNALRAEVESLKSEMERLTEEARTAEEVLNQHLAALPNRPAEDVPEGADEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N  +R  G+  +      +H  +GE LG +DF+RA  +SGARF+VL G LA LERALGQ
Sbjct: 121 DNEEVRGWGEPRAFDFEPVDHVTVGERLG-LDFERAAAMSGARFAVLQGPLARLERALGQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DL T+EHGY E S P +VRDEA++GTGQ+PKFA+D+F TTD RWLIPT+EV LTNL 
Sbjct: 180 FMLDLQTTEHGYRETSVPYMVRDEALFGTGQLPKFAEDLFRTTDDRWLIPTAEVPLTNLV 239

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
              I    S P+R T L P FRSEAGSAGRDTRG++R HQF K ELVSIT  E S  E E
Sbjct: 240 RDSIHAEDSFPIRMTALTPCFRSEAGSAGRDTRGLIRMHQFLKVELVSITTPEQSEDELE 299

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAEE+L+RL+L YRV+ LCTGD+GFSA +TYDLEVW+  QN YREISSCSTCG+FQ
Sbjct: 300 RMTQCAEEVLRRLELPYRVMKLCTGDMGFSARRTYDLEVWMPSQNTYREISSCSTCGDFQ 359

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR    K   F HTLNGSG+AVGR L+AILEN+  ADGSV IP  LRPYM  +
Sbjct: 360 ARRMNARYRKEGEKKPDFLHTLNGSGLAVGRALVAILENHQQADGSVYIPEALRPYMGGV 419

Query: 421 AVIKK 425
             I+ 
Sbjct: 420 EAIQP 424


>gi|325144922|gb|EGC67206.1| seryl-tRNA synthetase [Neisseria meningitidis M01-240013]
 gi|325205599|gb|ADZ01052.1| seryl-tRNA synthetase [Neisseria meningitidis M04-240196]
          Length = 431

 Score =  439 bits (1130), Expect = e-121,   Method: Composition-based stats.
 Identities = 201/433 (46%), Positives = 278/433 (64%), Gaps = 9/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L +R  +  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLARRGYDFDTARFDALEERRKSVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E+VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLEAVQKELDAWLLSIPNLPHEDVPFGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-------TTDGRWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F        T   ++LIPT+E
Sbjct: 180 FMLDTHTLQHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RR+ +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRLKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIKKE 426
           +PYM  +A ++ +
Sbjct: 419 QPYMGGVAKLEVK 431


>gi|254291533|ref|ZP_04962324.1| seryl-tRNA synthetase [Vibrio cholerae AM-19226]
 gi|150422597|gb|EDN14553.1| seryl-tRNA synthetase [Vibrio cholerae AM-19226]
          Length = 435

 Score =  439 bits (1130), Expect = e-121,   Method: Composition-based stats.
 Identities = 194/434 (44%), Positives = 268/434 (61%), Gaps = 11/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   +     L +R  +   E I +L+E+ + +  ++E++++ RNS S QIGQ
Sbjct: 1   MLDSKLLRTELDETAAKLARRGFKLDVETIRTLEEQRKSIQVEVENLQSTRNSISKQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +A G+ +  +A+K +  TL + L   + E   V + L  +   +PN+P + VP G   +
Sbjct: 61  LMASGDKAGAEAVKQQIGTLGDDLDAKKVELDAVMAQLDAITQTVPNIPDDAVPNGKDDS 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +   G   +     ++H ++GE    +DF  ATK++GARF V+ G  A L RA+ Q
Sbjct: 121 ENVEVSRWGTPKTYDFEVKDHVDLGEMGDGLDFASATKITGARFVVMKGQFARLHRAIAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-----------TDGRWLI 229
           FM+DLHT +HGYTE+  P LV  E ++GTGQ+PKF  D+F T                LI
Sbjct: 181 FMLDLHTDKHGYTELYVPYLVNAETLFGTGQLPKFGQDLFHTEPLTEKASDEEPRRLSLI 240

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV +TNL    I++   LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I
Sbjct: 241 PTAEVPVTNLVRDTILDEAELPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQI 300

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
           TR EDS    E +   AE++L+ L+L YR V LCTGD+GF +CKTYDLEVW+  Q  YRE
Sbjct: 301 TRPEDSMAALEELTGHAEKVLQLLELPYRKVILCTGDMGFGSCKTYDLEVWVPAQKTYRE 360

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR ++AILENY  ADG + I
Sbjct: 361 ISSCSNMWDFQARRMQARFRRKGEKKPELVHTLNGSGLAVGRTMVAILENYQEADGRIAI 420

Query: 410 PTVLRPYMNNLAVI 423
           P VL+ YM  L  I
Sbjct: 421 PAVLQKYMGGLTHI 434


>gi|253990316|ref|YP_003041672.1| seryl-tRNA synthetase [Photorhabdus asymbiotica subsp. asymbiotica
           ATCC 43949]
 gi|253781766|emb|CAQ84929.1| seryl-tRNA synthetase [Photorhabdus asymbiotica]
          Length = 429

 Score =  439 bits (1130), Expect = e-121,   Method: Composition-based stats.
 Identities = 196/430 (45%), Positives = 263/430 (61%), Gaps = 9/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R   + +   L +R      + +   +E+ ++L  + E ++A RNS S  IG 
Sbjct: 1   MLDPNILRNELDAVAEKLARRGYTLDVDTLRKQEERRKVLQVETETLQAERNSRSKAIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    +D L+ E + L E+L   + E  ++ + ++ L   IPNVP + VP+G   N
Sbjct: 61  AKARG--ENIDPLRQEVNQLGEKLDTAKSELEKLQTEIRDLALNIPNVPDDSVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G+        ++H  +GE    +DF  A KL+G+RF V+ G +A L RAL Q
Sbjct: 119 DNLEVSRWGEPRKYDFEVKDHVSLGELANGLDFAAAVKLTGSRFVVMKGQIARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM++LHT +HGY E   P LV  + +YGTGQ+PKF +D+F T            LIPT+E
Sbjct: 179 FMLNLHTEQHGYLETYVPYLVNHDTLYGTGQLPKFGEDLFHTKPLEEETGSHYALIPTAE 238

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V +TNL   EI++   LPLR T   P FRSEAGS GRDTRG++R HQF K ELV I   E
Sbjct: 239 VPVTNLVRDEILDESELPLRMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQIVHPE 298

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
           +S    E +   AE++L+ L+L YR V LCTGD+GF ACKTYDLEVWL  QN YREISSC
Sbjct: 299 ESMNALEELTGHAEKVLQLLNLPYRKVLLCTGDMGFGACKTYDLEVWLPAQNAYREISSC 358

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR L+AI+ENY  ADG + IP VL
Sbjct: 359 SNMWDFQARRMQARFRGKEDKKTQLLHTLNGSGLAVGRTLVAIMENYQQADGRIEIPEVL 418

Query: 414 RPYMNNLAVI 423
           RPYM  L  I
Sbjct: 419 RPYMGGLEYI 428


>gi|304386837|ref|ZP_07369101.1| serine--tRNA ligase [Neisseria meningitidis ATCC 13091]
 gi|304339091|gb|EFM05181.1| serine--tRNA ligase [Neisseria meningitidis ATCC 13091]
          Length = 431

 Score =  439 bits (1130), Expect = e-121,   Method: Composition-based stats.
 Identities = 200/433 (46%), Positives = 275/433 (63%), Gaps = 9/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L +R     +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLARRGYNFDTARFDALEERRKSVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPAGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T         ++LIPT+E
Sbjct: 180 FMLDTHTLKHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDESKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  I++   LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVAGSILDEGGLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIKKE 426
           +PYM  +A ++ +
Sbjct: 419 QPYMGGVAKLEVK 431


>gi|146296476|ref|YP_001180247.1| seryl-tRNA synthetase [Caldicellulosiruptor saccharolyticus DSM
           8903]
 gi|166201242|sp|A4XJH1|SYS_CALS8 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|145410052|gb|ABP67056.1| seryl-tRNA synthetase [Caldicellulosiruptor saccharolyticus DSM
           8903]
          Length = 420

 Score =  439 bits (1130), Expect = e-121,   Method: Composition-based stats.
 Identities = 202/424 (47%), Positives = 282/424 (66%), Gaps = 4/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD+++IR NPE +   L KR+ +     IL LDEK R L+ ++E ++A +N  S +I +
Sbjct: 1   MLDLKFIRSNPEKVQEGLNKRNKDISIAPILELDEKRRKLLAEVEKMKAIQNQKSKEIPK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG  +    L NE   L +++  L+ +  EV   ++K++  IPN+P E VPIG    
Sbjct: 61  LKKEGKDT--TELMNELKELSDKIKELDSQVKEVEDEIEKILLTIPNIPHESVPIGKDDT 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G+        + H+EIGE LG++DF+RA+K+SG+RF+   G  A LERAL  
Sbjct: 119 ENVEVRRWGEPRVPDFEIKPHWEIGEKLGILDFERASKVSGSRFTFYRGLGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLH  +HGY E+  P LV  ++M GTGQ+PKF +D F TTD  +LIPT+EV +TN +
Sbjct: 179 FMLDLHIEKHGYVELFPPFLVARKSMIGTGQLPKFEEDAFKTTDDYFLIPTAEVPVTNYH 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ + LP+++   +  FR+EAG+AG+DTRG++RQHQF K ELV   + EDS+ E E
Sbjct: 239 REEILKEEDLPIKYVAYSACFRAEAGAAGKDTRGLIRQHQFNKVELVKFAKPEDSYDELE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           ++ + AE++LK L L YRVV LC+GDLGFS+ KTYD+EVW+     Y EISSCS   +FQ
Sbjct: 299 KLTADAEDVLKHLGLPYRVVLLCSGDLGFSSAKTYDIEVWMPSYGRYVEISSCSNFESFQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RR N R+R  + K L F HTLNGSG+AVGR + AILEN+   DGSV +P VLR YM   
Sbjct: 359 ARRANIRFRRKDGK-LDFVHTLNGSGLAVGRTVAAILENFQQKDGSVVVPEVLRKYM-GT 416

Query: 421 AVIK 424
            +IK
Sbjct: 417 DIIK 420


>gi|325134782|gb|EGC57419.1| seryl-tRNA synthetase [Neisseria meningitidis M13399]
          Length = 431

 Score =  439 bits (1130), Expect = e-121,   Method: Composition-based stats.
 Identities = 201/433 (46%), Positives = 278/433 (64%), Gaps = 9/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L +R  +  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLARRGYDFDTARFDALEERRKSVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E+VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLEAVQKELDAWLLSIPNLPHEDVPFGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-------TTDGRWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F        T   ++LIPT+E
Sbjct: 180 FMLDTHTLQHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGAAKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RR+ +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRLKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIKKE 426
           +PYM  +A ++ +
Sbjct: 419 QPYMGGVAKLEVK 431


>gi|257792717|ref|YP_003183323.1| seryl-tRNA synthetase [Eggerthella lenta DSM 2243]
 gi|317489004|ref|ZP_07947531.1| seryl-tRNA synthetase [Eggerthella sp. 1_3_56FAA]
 gi|325831041|ref|ZP_08164365.1| serine--tRNA ligase [Eggerthella sp. HGA1]
 gi|257476614|gb|ACV56934.1| seryl-tRNA synthetase [Eggerthella lenta DSM 2243]
 gi|316911871|gb|EFV33453.1| seryl-tRNA synthetase [Eggerthella sp. 1_3_56FAA]
 gi|325486962|gb|EGC89408.1| serine--tRNA ligase [Eggerthella sp. HGA1]
          Length = 429

 Score =  439 bits (1130), Expect = e-121,   Method: Composition-based stats.
 Identities = 194/430 (45%), Positives = 274/430 (63%), Gaps = 5/430 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+++R N E +  A+K RH    +     LDE  R  I K E ++A RN+ S  IGQ
Sbjct: 1   MLDIKFVRDNQEAVAEAMKNRHASWDAARFSELDETRRAAIAKEEALQAERNATSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +A G     +A K     + ++L ++ K+      +L++++   PN+P +  P+G   +
Sbjct: 61  MMAAGQKDEAEAAKQRVRAINDELAVIGKDREAADEALREVLLRTPNMPADSTPVGDDED 120

Query: 121 ENILIRSVGKKPSA---IHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
           +N  +R  G            + H+++G  LG++DF+RA KL+ +RF +L G  A LERA
Sbjct: 121 DNPEVRRWGAPRDFAAEGFEMKPHWDLGPELGIIDFERAVKLAASRFILLGGLGARLERA 180

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLT 237
           L  FM D H    GY E   P +   E + GTGQ+PKF +D+F TT+G +LIPT+EV LT
Sbjct: 181 LINFMADTHA-SRGYKEWWCPAMANAETLTGTGQLPKFEEDLFHTTEGLYLIPTAEVQLT 239

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           N+++ E++++  LPL++    P FR EAGSAGRDTRG++R HQF K E+V   + E+SF 
Sbjct: 240 NIHAGEVLDAGQLPLKYCAFTPCFREEAGSAGRDTRGLIRVHQFDKVEMVKYAKPEESFD 299

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           + E M++ AE IL+ L L YRV+SLCTGD+GFSA KTYDLEVWL   N Y+EISSCS C 
Sbjct: 300 DLEAMVADAENILQLLGLPYRVISLCTGDIGFSAAKTYDLEVWLPSYNGYKEISSCSNCT 359

Query: 358 NFQSRRMNSRYRDPNS-KSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           +FQ+RR N +YRDP + K  ++ HTLNGSG+AVGR + A++ENY   DG+V +P VL PY
Sbjct: 360 DFQARRANIKYRDPENFKGSRYVHTLNGSGLAVGRTMAAVIENYQQPDGTVRVPDVLVPY 419

Query: 417 MNNLAVIKKE 426
           M  + VI  E
Sbjct: 420 MGGVEVIAPE 429


>gi|260428621|ref|ZP_05782600.1| seryl-tRNA synthetase [Citreicella sp. SE45]
 gi|260423113|gb|EEX16364.1| seryl-tRNA synthetase [Citreicella sp. SE45]
          Length = 430

 Score =  439 bits (1130), Expect = e-121,   Method: Composition-based stats.
 Identities = 201/429 (46%), Positives = 278/429 (64%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D AL +R +  QS  IL++DE+ R  I   E  +A +N  S ++G+
Sbjct: 1   MHDIRAIRENPAAFDAALSRRGMPSQSPAILAMDEERRAAIHAAETAQAEQNKASKEVGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  + L+      K ++  ++    E+ + L +L+  +PN+P ++ P G    
Sbjct: 61  AKASGDEAEFERLRALVGEKKAEVAEMQTRAKELDAQLAELLMGLPNLPFDDTPDGADEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I   G   +     +EH+E+   +  MDF+ A KLSGARF VL+G +A + RAL Q
Sbjct: 121 DNVEIHRWGTPATLDFTPKEHYELPGVVKGMDFETAAKLSGARFVVLSGAVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H  E+G TE   P+LVR+E MYGTGQ+PKF DD + T +G WL+PT+EV+LTN+ 
Sbjct: 181 FMLDTHVEENGLTETWTPVLVREEMMYGTGQLPKFGDDSYQTREGWWLVPTAEVTLTNIV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           +   ++  +LP R+      FRSEAGSAGRDT GMLRQHQF K E+VSIT  + S  E +
Sbjct: 241 NGLTVDEDTLPRRYVAHTQCFRSEAGSAGRDTAGMLRQHQFEKVEMVSITHPDKSRDELD 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CA+ IL++L L YR V+LCTGD+GF A +T+DLEVWL GQN YREISS S CG+FQ
Sbjct: 301 RMTGCAQGILEKLGLPYRTVALCTGDIGFGARRTHDLEVWLPGQNTYREISSVSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++        F HTLNGSG+AVGRCLIA+LEN   ADGSV +P  L+P++   
Sbjct: 361 ARRMNARFKPTAGGKPDFVHTLNGSGLAVGRCLIAVLENGQQADGSVRLPEALQPWLGGR 420

Query: 421 AVIKKEHIL 429
             +     L
Sbjct: 421 TTLTANGDL 429


>gi|222528873|ref|YP_002572755.1| seryl-tRNA synthetase [Caldicellulosiruptor bescii DSM 6725]
 gi|254783001|sp|B9MQM8|SYS_ANATD RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|222455720|gb|ACM59982.1| seryl-tRNA synthetase [Caldicellulosiruptor bescii DSM 6725]
          Length = 420

 Score =  439 bits (1130), Expect = e-121,   Method: Composition-based stats.
 Identities = 201/424 (47%), Positives = 283/424 (66%), Gaps = 4/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD+++IR NPE +   L KR+ +     IL LDE+ R L+ ++E ++A +N  S ++ +
Sbjct: 1   MLDLKYIRANPEKVQEGLSKRNKDVSIAPILELDERRRKLLAEVESLKALQNQKSKEVPK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG    V  L NE   L +++  L+ +  EV   ++K++  IPN+P E VP+G    
Sbjct: 61  LKKEGK--DVTDLMNELKDLSDKIKELDSKVKEVEDEIEKILLTIPNIPHESVPVGKDDT 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G+        + H+EIG  LG++DF+RA+K+SG+RF+   G  A LERAL  
Sbjct: 119 ENVEVRRWGEVREPDFEIKPHWEIGVNLGILDFERASKVSGSRFTFYRGLGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLH  +HGYTE+  P LV  ++M GTGQ+PKF +D F TTD  +LIPT+EV +TN +
Sbjct: 179 FMLDLHIEKHGYTELFPPFLVARKSMIGTGQLPKFEEDAFKTTDDYFLIPTAEVPVTNYH 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ + LP+++   +  FR+EAG+AG+DTRG++RQHQF K ELV  T+ EDS+ E E
Sbjct: 239 REEILKEEDLPIKYVAYSACFRAEAGAAGKDTRGLIRQHQFNKVELVKFTKPEDSYDELE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           ++ + AE++LK L L YRVV LC+GDLGFS+ KTYD+EVW+     Y EISSCS   N+Q
Sbjct: 299 KLTADAEDVLKELGLPYRVVLLCSGDLGFSSAKTYDIEVWMPSYGRYVEISSCSNFENYQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RR N R+R  + K L + HTLNGSG+AVGR L AILEN+   DG+V +P VLR YM   
Sbjct: 359 ARRANIRFRRKDGK-LDYVHTLNGSGLAVGRTLAAILENFQQKDGTVVVPEVLRKYM-GT 416

Query: 421 AVIK 424
            VIK
Sbjct: 417 DVIK 420


>gi|269139541|ref|YP_003296242.1| seryl-tRNA synthetase [Edwardsiella tarda EIB202]
 gi|267985202|gb|ACY85031.1| seryl-tRNA synthetase [Edwardsiella tarda EIB202]
 gi|304559430|gb|ADM42094.1| Seryl-tRNA synthetase [Edwardsiella tarda FL6-60]
          Length = 430

 Score =  439 bits (1129), Expect = e-121,   Method: Composition-based stats.
 Identities = 196/431 (45%), Positives = 265/431 (61%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R   + +   L +R  +   + +   +E+ ++L  + E ++A RNS S  IG 
Sbjct: 1   MLDPNLLRNELDAVAEKLARRGYKLDVDTLRQQEERRKVLQVETESLQAERNSRSKSIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E  ++   ++ L   IPN+P + VP+G   N
Sbjct: 61  AKARG--EDIEPLRREVNELGEKLDAAKAELDQLQQEIRDLALSIPNLPDDSVPVGRDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N  I   G+        R+H  +GE    +DF  A KL+GARF V+ G +A + RAL Q
Sbjct: 119 DNQEICRWGEPRRYDFDVRDHVTLGEMADGLDFAAAVKLTGARFVVMKGQIARMHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY E   P LV  + +YGTGQ+PKF  D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYLETYVPYLVNHDTLYGTGQLPKFGADLFHTRPLEEEADSSTYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV +TNL   EI+E  +LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I R 
Sbjct: 239 EVPVTNLVRGEILEESALPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E + + AE++L+ L+L YR V LCTGD+GF + KTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEELTAHAEKVLQLLNLPYRKVLLCTGDMGFGSSKTYDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +RYR  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNMWDFQARRMQARYRSKDDKKPRLVHTLNGSGLAVGRTLVAVMENYQQADGRIQVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|94497464|ref|ZP_01304034.1| seryl-tRNA synthetase [Sphingomonas sp. SKA58]
 gi|94423095|gb|EAT08126.1| seryl-tRNA synthetase [Sphingomonas sp. SKA58]
          Length = 425

 Score =  439 bits (1129), Expect = e-121,   Method: Composition-based stats.
 Identities = 229/426 (53%), Positives = 292/426 (68%), Gaps = 1/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI++IR+NP   D AL +R L P S  I++LDEK+R L  + +  +ARRN  S  IGQ
Sbjct: 1   MHDIRFIRENPAAFDAALGRRGLSPMSAEIITLDEKSRALKTEWQQAQARRNEASKAIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  + +  DALK E + LK+++P LE EE      L  L+S IPN+P ++VP GT   
Sbjct: 61  AMAAKDSATADALKAEVAELKDRMPALEGEERAAGEQLTALLSAIPNLPAQDVPDGTDEV 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G   +     ++H + G ALG +DF+    LSGARF+ L G +A L RAL Q
Sbjct: 121 DNVEVARWGTPRAFAFPPQDHADFGPALG-LDFEGGAALSGARFTALRGQMARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D  T  +GY E   PLLV+D A++GTGQ+PKFA+D+F TTDGRWLIPT+EVSLTNL 
Sbjct: 180 FMLDQQTVANGYEETIVPLLVKDAALFGTGQLPKFAEDLFKTTDGRWLIPTAEVSLTNLV 239

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + +I+  + LPLR T L P FRSEAGSAGRDTRG +RQHQF K ELV+I R E+S  EHE
Sbjct: 240 ADQIVPEERLPLRLTALTPCFRSEAGSAGRDTRGFIRQHQFEKVELVTICRPEESEAEHE 299

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM++ AE IL+ L L YR + LCTGD+GF A KTYDLEVWL  Q+ YREISS S CG+FQ
Sbjct: 300 RMVAAAEGILQALALPYRKMLLCTGDMGFGARKTYDLEVWLPSQDTYREISSVSNCGDFQ 359

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R R    K   F HTLNGSG+AVGR L+A+LEN   ADGSV IP  L PYM  +
Sbjct: 360 ARRMNARMRPDGGKQTVFLHTLNGSGLAVGRTLVAVLENCQQADGSVVIPDALAPYMGGV 419

Query: 421 AVIKKE 426
             ++  
Sbjct: 420 TKLEPR 425


>gi|310778421|ref|YP_003966754.1| seryl-tRNA synthetase [Ilyobacter polytropus DSM 2926]
 gi|309747744|gb|ADO82406.1| seryl-tRNA synthetase [Ilyobacter polytropus DSM 2926]
          Length = 423

 Score =  439 bits (1129), Expect = e-121,   Method: Composition-based stats.
 Identities = 206/425 (48%), Positives = 282/425 (66%), Gaps = 2/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++++R N E L   LK R+     +    LD + R L+ ++E ++ +RN+ S ++G+
Sbjct: 1   MLDLRYMRDNIEFLKGMLKNRNASVDLDDFEQLDAERRDLLTEVEALKHKRNNVSQEVGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              E        +  E  T+  ++  L+ +  E+ S L+     IPNV  E  P+G    
Sbjct: 61  LKREKK--DASHIIAEMGTVSSKIKELDSKLSEIDSKLQYYQMTIPNVYHESTPVGKDEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+L+R+ G+     +  + H+E+GE LG++DF+R  KL GARF+V  G  A LERAL  
Sbjct: 119 DNLLVRTWGEPTEFEYEPKNHWELGEELGILDFERGAKLGGARFTVYRGLGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT+EHGYTE   P LVR +   GTGQ+PKF DDM+ TTD  +LI TSE++LTNL+
Sbjct: 179 FMLDLHTTEHGYTEHITPFLVRRDICEGTGQLPKFEDDMYKTTDEMFLISTSEITLTNLH 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI+E   LP  +T  +P FR EAGS GRD +G++RQHQF K E+V IT  E+S+ E +
Sbjct: 239 RKEILEESDLPKYYTAHSPCFRREAGSYGRDVKGLIRQHQFNKVEMVKITTPENSYDELD 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           +M+  AE +L++L L YR+V LC+GD+GFSA KTYDLEVWL GQ  YREISSCS CG+FQ
Sbjct: 299 KMVVNAETVLQKLGLPYRLVQLCSGDIGFSAAKTYDLEVWLPGQGKYREISSCSNCGDFQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM  +YR   +K  +F +TLNGSGVAVGR L+AI+ENY   DGS+ IP  LRPYM  +
Sbjct: 359 ARRMGLKYRPEGTKKSEFVNTLNGSGVAVGRALLAIMENYQQEDGSIIIPEALRPYMGGI 418

Query: 421 AVIKK 425
            VIKK
Sbjct: 419 DVIKK 423


>gi|121635325|ref|YP_975570.1| seryl-tRNA synthetase [Neisseria meningitidis FAM18]
 gi|166222753|sp|A1KV93|SYS_NEIMF RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|120867031|emb|CAM10794.1| seryl-tRNA synthetase [Neisseria meningitidis FAM18]
 gi|325132820|gb|EGC55500.1| seryl-tRNA synthetase [Neisseria meningitidis M6190]
 gi|325138723|gb|EGC61275.1| seryl-tRNA synthetase [Neisseria meningitidis ES14902]
 gi|325198782|gb|ADY94238.1| seryl-tRNA synthetase [Neisseria meningitidis G2136]
          Length = 431

 Score =  439 bits (1129), Expect = e-121,   Method: Composition-based stats.
 Identities = 202/433 (46%), Positives = 278/433 (64%), Gaps = 9/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L +R  +  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLARRGYDFDTARFDALEERRKSVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E+VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLEAVQKELDAWLLSIPNLPHEDVPFGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-------TTDGRWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F        T   ++LIPT+E
Sbjct: 180 FMLDTHTLQHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIKKE 426
           +PYM  +A ++ +
Sbjct: 419 QPYMGGVAKLEVK 431


>gi|15677532|ref|NP_274688.1| seryl-tRNA synthetase [Neisseria meningitidis MC58]
 gi|30173214|sp|Q9JY95|SYS_NEIMB RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|7226938|gb|AAF42032.1| seryl-tRNA synthetase [Neisseria meningitidis MC58]
 gi|316984831|gb|EFV63788.1| seryl-tRNA synthetase [Neisseria meningitidis H44/76]
 gi|325140853|gb|EGC63363.1| seryl-tRNA synthetase [Neisseria meningitidis CU385]
 gi|325199722|gb|ADY95177.1| seryl-tRNA synthetase [Neisseria meningitidis H44/76]
          Length = 431

 Score =  439 bits (1129), Expect = e-121,   Method: Composition-based stats.
 Identities = 202/433 (46%), Positives = 277/433 (63%), Gaps = 9/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L +R  +  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLARRGYDFDTARFDTLEERRKSVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  N+ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMNQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPAGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-------TTDGRWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F        T   ++LIPT+E
Sbjct: 180 FMLDTHTLQHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYETLEEMVGHAENILKALELPYRVITLCTGDMGFGAAKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RR+ +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRLKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIKKE 426
           +PYM  +A ++ +
Sbjct: 419 QPYMGGVAKLEVK 431


>gi|13471180|ref|NP_102749.1| seryl-tRNA synthetase [Mesorhizobium loti MAFF303099]
 gi|30173204|sp|Q98LC8|SYS_RHILO RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|14021924|dbj|BAB48535.1| seryl-tRNA synthetase [Mesorhizobium loti MAFF303099]
          Length = 434

 Score =  439 bits (1128), Expect = e-121,   Method: Composition-based stats.
 Identities = 241/434 (55%), Positives = 311/434 (71%), Gaps = 8/434 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-----QSEYILSLDEKNRILIKKIEDIRARRNSNS 55
           MLDI+WIR NP+ L  AL KR           + +++ DE  R  + +++  + RRN+ S
Sbjct: 1   MLDIKWIRDNPKALVEALAKRSWSAGEAQSTVDDLIARDEARREHVTELQTKQERRNAAS 60

Query: 56  AQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
            +IG A+  G+ +L + LK E   +K  +   E  E E+  +L   ++ +PNVPL++VP+
Sbjct: 61  KEIGNAMRSGDAALAEKLKAEVGDIKTFIQNGEARERELDKALTDALAVLPNVPLDDVPV 120

Query: 116 GTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLE 175
           G   ++N++   VGK P+  +  +EHFEIGEALG+MDF+RA KLSG+RF+VL   LA +E
Sbjct: 121 GKDEHDNVVKHIVGKVPTRSNWVKEHFEIGEALGMMDFERAAKLSGSRFTVLKSGLARME 180

Query: 176 RALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD---GRWLIPTS 232
           RA+GQFM+DLHT+EHGY EV  PL+VRDE ++GT Q+PKF +D+F T        LIPT+
Sbjct: 181 RAIGQFMLDLHTTEHGYEEVIPPLMVRDEVLFGTNQLPKFEEDLFFTPHGEGRLGLIPTA 240

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI   + LPLRFT L P FRSEAGSAGRDTRGMLRQHQF+K ELVSIT +
Sbjct: 241 EVPLTNLVREEITAHEKLPLRFTALTPCFRSEAGSAGRDTRGMLRQHQFYKVELVSITDQ 300

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           + S  EHERM  CAEE+LKRL+L +R + LCTGD+GF A KTYD+EVWL GQN YREISS
Sbjct: 301 DSSLAEHERMTQCAEEVLKRLELPFRTMVLCTGDMGFGARKTYDIEVWLPGQNAYREISS 360

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS CG+FQ+RRM++RY+D + K  +F HTLNGSG AVGR LIA++ENY N DGSVTIP V
Sbjct: 361 CSVCGDFQARRMDARYKDKDGKGNRFVHTLNGSGTAVGRALIAVIENYQNEDGSVTIPEV 420

Query: 413 LRPYMNNLAVIKKE 426
           LRPYM  LA I+ +
Sbjct: 421 LRPYMGGLAKIEAK 434


>gi|319638614|ref|ZP_07993376.1| seryl-tRNA synthetase [Neisseria mucosa C102]
 gi|317400363|gb|EFV81022.1| seryl-tRNA synthetase [Neisseria mucosa C102]
          Length = 431

 Score =  439 bits (1128), Expect = e-121,   Method: Composition-based stats.
 Identities = 199/433 (45%), Positives = 275/433 (63%), Gaps = 9/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L  R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLAARGYEFDTARFNALEEQRKAVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP+G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKADLEQAAADLDAVQKELDAWLLSIPNLPHESVPVGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +AHL RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMKGQIAHLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T         ++LIPT+E
Sbjct: 180 FMLDTHTLKHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDESKKTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  I+    LPL+ T  +P FRSEAG+ G+D RG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIVAGSDLPLKLTAHSPCFRSEAGAYGKDVRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ +P VL
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINVPAVL 418

Query: 414 RPYMNNLAVIKKE 426
           +PYM  +  ++ +
Sbjct: 419 QPYMGGVTKLEVK 431


>gi|209885385|ref|YP_002289242.1| seryl-tRNA synthetase [Oligotropha carboxidovorans OM5]
 gi|229890229|sp|B6JFP3|SYS_OLICO RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|209873581|gb|ACI93377.1| seryl-tRNA synthetase [Oligotropha carboxidovorans OM5]
          Length = 439

 Score =  439 bits (1128), Expect = e-121,   Method: Composition-based stats.
 Identities = 240/439 (54%), Positives = 305/439 (69%), Gaps = 14/439 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+WIR NPE  D AL +R LEPQ+  +++LDEK R  I   E  +ARRN+ S +IG+
Sbjct: 1   MHDIRWIRDNPEAFDAALGRRGLEPQAAALIALDEKRRGAIAAFEQAQARRNAASKEIGE 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A      +  DAL  E   LK +LP ++     +   L+K ++ IPN+PL EVP G   +
Sbjct: 61  AKKAKENARADALMAEVGELKTKLPEMDAAAKRLEEDLRKELAQIPNLPLAEVPEGADEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+     G+  S     +EH  +GE LG MDF+RA KLSGARF VL   LA LERA+GQ
Sbjct: 121 GNVQHHVYGEPRSYAFKPKEHVALGEGLGFMDFERAAKLSGARFVVLKSGLARLERAIGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF------CTTDGRWLIPTSEV 234
           F +D+HT EHGYTEV+ PLLVRD+AM+GT Q+PKF +D F          G WLIPT+EV
Sbjct: 181 FFLDVHTGEHGYTEVNPPLLVRDDAMFGTAQLPKFREDQFAAGSLDAEGQGYWLIPTAEV 240

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            LTNL    I++ K LP+R T L P FR+EAG+AGRDTRGM+RQHQF K ELVSIT  ++
Sbjct: 241 PLTNLVRESILDEKELPMRLTALTPCFRAEAGAAGRDTRGMIRQHQFTKVELVSITTPDE 300

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQ-------NLY 347
           S  EHERMLSCAEE+LKRL LHYRV++LCTGD+GF++ KTYD+EVW+ GQ        +Y
Sbjct: 301 SRNEHERMLSCAEEVLKRLGLHYRVMTLCTGDMGFASQKTYDIEVWMPGQISSQGEGGMY 360

Query: 348 REISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSV 407
           REISSCS CG+FQ+RRM++RYR P++K   F HTLNGSG AVGR LIA++E Y   DGS+
Sbjct: 361 REISSCSVCGDFQARRMDARYRGPDNK-PHFVHTLNGSGTAVGRALIAVMETYQQEDGSI 419

Query: 408 TIPTVLRPYMNNLAVIKKE 426
            +P VL+PYM  L VI+++
Sbjct: 420 AVPDVLQPYMGGLKVIERD 438


>gi|220932938|ref|YP_002509846.1| seryl-tRNA synthetase [Halothermothrix orenii H 168]
 gi|254783031|sp|B8CZZ9|SYS_HALOH RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|219994248|gb|ACL70851.1| seryl-tRNA synthetase [Halothermothrix orenii H 168]
          Length = 422

 Score =  439 bits (1128), Expect = e-121,   Method: Composition-based stats.
 Identities = 189/426 (44%), Positives = 276/426 (64%), Gaps = 5/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD+++IR+N E +   LK+R  E   +    LDEK R +I+++E ++ +RN  S++IG+
Sbjct: 1   MLDMKFIRENLETVADMLKRRGTEAPLDEFKELDEKRREIIQEVEQLKHKRNVVSSKIGE 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G       +  E   +   +   ++E   +   L++++  IPN+P + VP+G   +
Sbjct: 61  LKRAG--EDASDIIAEMKEVSATIKKYDEELRGIEERLQQVVLSIPNMPHDSVPVGEDED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G+        + H+++GEAL ++DF+R +K+SGARF+ L G  A LER+L  
Sbjct: 119 DNVEVRRWGEPRKFDFEFKPHWDLGEALDILDFERGSKVSGARFTFLKGAGARLERSLIS 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT-DGRWLIPTSEVSLTNL 239
           FMID HT ++GYTE+  P +V  ++  GTGQ+PKFA DMF       +LIPT+EV +TNL
Sbjct: 179 FMIDHHT-QNGYTEIFPPFMVNSDSCIGTGQLPKFAGDMFKVEGTDYYLIPTAEVPVTNL 237

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y  EI+ ++ LP+     +  FR+EAG+ GRDTRG++RQHQF K ELV     + SF E 
Sbjct: 238 YRDEILNAEDLPVYHVAYSACFRAEAGAHGRDTRGIIRQHQFNKVELVKFVHPDKSFEEL 297

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++   AEEIL+ L+L YRVV+LCTGDL FS+ KTYD+EVW+   + YREISSCS   +F
Sbjct: 298 EKLTRNAEEILQMLELPYRVVTLCTGDLTFSSAKTYDIEVWMPAYDTYREISSCSNFKDF 357

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR   R+R       ++ HTLNGSG+A+GR + AI+ENY N DGS+T+P VLRPYM  
Sbjct: 358 QARRAGIRFRPEPGAKAEYVHTLNGSGLAIGRTVAAIMENYQNEDGSITVPEVLRPYM-G 416

Query: 420 LAVIKK 425
           + VIK 
Sbjct: 417 MDVIKP 422


>gi|192359600|ref|YP_001983012.1| seryl-tRNA synthetase [Cellvibrio japonicus Ueda107]
 gi|238692464|sp|B3PL38|SYS_CELJU RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|190685765|gb|ACE83443.1| seryl-tRNA synthetase [Cellvibrio japonicus Ueda107]
          Length = 428

 Score =  439 bits (1128), Expect = e-121,   Method: Composition-based stats.
 Identities = 199/427 (46%), Positives = 275/427 (64%), Gaps = 4/427 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   E +   L KR  E     I +L+E  + +  K E++++ RN+ S  IG+
Sbjct: 1   MLDSKLLRTATEQVAKGLAKRGYELDVAKIQALEETRKAIQIKTENLQSERNTRSKAIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G    V  L     ++K+QL   E +   V +   + +  IPN+P +EVP G S  
Sbjct: 61  AKQAG--EDVAPLMQAVESIKQQLVDAEADLARVQTEWDEFVKAIPNIPADEVPEGKSDE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ IR  G   S     ++H ++G  LG +DFD ATK++G+RF+VL G +A L RAL Q
Sbjct: 119 DNVEIRRWGMPRSFHFPIKDHVDLGADLGGLDFDTATKITGSRFAVLRGGIARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGR--WLIPTSEVSLTN 238
           FM+D H ++HGY EV+ P +V  ++++GTGQ+PKF +D+F  TD R  +LIPT+EV LTN
Sbjct: 179 FMLDTHINQHGYEEVNIPFIVNRDSLFGTGQLPKFEEDLFKLTDDREFYLIPTAEVPLTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           +Y   I+E   LP++F   +P FRSEAGS GRDTRGM+RQHQF K ELV + + E S   
Sbjct: 239 IYRDAILEDNQLPIKFVAHSPCFRSEAGSYGRDTRGMIRQHQFEKVELVWLVQPEKSDEA 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E +++ AE+IL  L+L +R V LC GD+GFSA KTYD+EVW+  QN YREISSCS   +
Sbjct: 299 LEALVAHAEKILHDLELPHRTVVLCGGDIGFSAAKTYDIEVWVPSQNKYREISSCSNVRD 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRM +R+R+  +   +  HTLNGSG+AVGR L+A+LENY   DGSV IP VLRPYM 
Sbjct: 359 FQARRMLARFRNKETGKPELLHTLNGSGLAVGRTLLAVLENYQQEDGSVIIPEVLRPYMG 418

Query: 419 NLAVIKK 425
              V+  
Sbjct: 419 GQEVLAP 425


>gi|196041939|ref|ZP_03109226.1| serine--tRNA ligase [Bacillus cereus NVH0597-99]
 gi|196027194|gb|EDX65814.1| serine--tRNA ligase [Bacillus cereus NVH0597-99]
          Length = 424

 Score =  439 bits (1128), Expect = e-121,   Method: Composition-based stats.
 Identities = 188/426 (44%), Positives = 268/426 (62%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+++R N E +   L+ R  +         LD + R L+ + E+++++RN  S QI 
Sbjct: 1   MLDIKFLRTNFEEVKAKLQHRGEDLTDFSRFEELDTRRRELLVQTEELKSKRNEVSQQIS 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      +AL  E   + E++  L+ E   V   L++L+  IPN+P E  P+G + 
Sbjct: 61  VLKREKK--DAEALILEMREVGEKVKDLDNELRTVEEDLERLMLSIPNIPHESAPVGETE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N++ R+ G+        + H+++   LG++DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 DDNVVARTWGEVKEFAFEPKPHWDLATDLGILDFERAGKVTGSRFVFYKGAGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLHT EHGY EV  P +V   +M GTGQ+PKF +D F      +  IPT+EV +TN
Sbjct: 179 SFMLDLHTDEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIESEDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           ++  EI+  + LP+R+   +  FRSEAGSAGRDTRG++RQHQF K ELV   + EDS+ E
Sbjct: 239 MHRDEILNKEQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++ + AE +L+ L+L YRV+S+CTGDLGF+A K YD+EVW+     YREISSCS    
Sbjct: 299 LEKLTNDAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVWIPSYGTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R   +   +  HTLNGSG+A+GR + AILENY   DG++ IP VLRPYM 
Sbjct: 359 FQARRANIRFRREPNGKPEHVHTLNGSGLAIGRTVAAILENYQQEDGTIIIPEVLRPYMG 418

Query: 419 NLAVIK 424
              VIK
Sbjct: 419 GKTVIK 424


>gi|83588895|ref|YP_428904.1| seryl-tRNA synthetase [Moorella thermoacetica ATCC 39073]
 gi|123525300|sp|Q2RMH8|SYS_MOOTA RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|83571809|gb|ABC18361.1| seryl-tRNA synthetase [Moorella thermoacetica ATCC 39073]
          Length = 427

 Score =  439 bits (1128), Expect = e-121,   Method: Composition-based stats.
 Identities = 201/428 (46%), Positives = 271/428 (63%), Gaps = 3/428 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+ +RQ+PE +   L +R L    E+ L LD + R L+ ++E ++ RRN  SA++ +
Sbjct: 1   MLDIRVVRQDPEGVARGLARRGLAAGLEHFLELDARRRNLLVEVEGLKNRRNQVSAEVAR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G       L      + E++  L+++   V   L++ +  +PN+P   VP G S  
Sbjct: 61  LKKSGQ--DATELIASMREVGERIKELDEKVRAVEEELRQEMLKLPNIPHASVPDGLSDA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N  +R  G+ P      R H+EI E LG++DF+R  K++GARF    G  A LERAL  
Sbjct: 119 DNKPVRHWGELPRFKFEPRPHWEIAENLGIVDFERGGKVAGARFVFYRGAGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT-DGRWLIPTSEVSLTNL 239
           FM+DLHT +HGYTE+  P +V   +M GTGQ+PKFA+DMF       +LIPT+EV +TNL
Sbjct: 179 FMLDLHTIKHGYTEIFPPYMVNSASMLGTGQLPKFAEDMFHVEGTDYYLIPTAEVPVTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y  EI+  + LP+     +  FR+EAG+AGRDTRG++RQHQF K ELV  TR EDS+ E 
Sbjct: 239 YRGEILPGEKLPIYHVAYSACFRAEAGAAGRDTRGLIRQHQFNKVELVKFTRPEDSYEEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++   AEE+L+ L L YRVV+LC GDLGFSA KTYDLEVW+ G   YREISSCS   +F
Sbjct: 299 EKLTRDAEEVLQLLGLPYRVVALCAGDLGFSAAKTYDLEVWMPGTACYREISSCSNFEDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR + R+R    +  +  HTLNGSGVAVGR + AILENY   DG+V IP  L+PYM  
Sbjct: 359 QARRADIRFRPGPKEKPRLVHTLNGSGVAVGRTVAAILENYQQEDGTVLIPPALKPYMGG 418

Query: 420 LAVIKKEH 427
           L  I+ E 
Sbjct: 419 LTSIQPEQ 426


>gi|52078504|ref|YP_077295.1| seryl-tRNA synthetase [Bacillus licheniformis ATCC 14580]
 gi|52783868|ref|YP_089697.1| seryl-tRNA synthetase [Bacillus licheniformis ATCC 14580]
 gi|319648532|ref|ZP_08002747.1| seryl-tRNA synthetase [Bacillus sp. BT1B_CT2]
 gi|67461715|sp|Q65PL0|SYS_BACLD RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|52001715|gb|AAU21657.1| seryl-tRNA synthetase [Bacillus licheniformis ATCC 14580]
 gi|52346370|gb|AAU39004.1| SerS [Bacillus licheniformis ATCC 14580]
 gi|317389380|gb|EFV70192.1| seryl-tRNA synthetase [Bacillus sp. BT1B_CT2]
          Length = 425

 Score =  439 bits (1128), Expect = e-121,   Method: Composition-based stats.
 Identities = 195/427 (45%), Positives = 270/427 (63%), Gaps = 4/427 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ +R N E +   L  R  +    +    LD K R LI K+E+++ +RN  S Q+ 
Sbjct: 1   MLDVKLLRANFEEIKQKLAHRGEDLSDFDQFEELDTKRRELIVKVEELKGKRNEVSQQVA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      D L  E   + E +  L++E   V SSL K++  IPN+P E VP+G + 
Sbjct: 61  ALKREKK--DADHLIKEMREVGEDIKKLDEELRTVESSLDKIMLSIPNIPHESVPVGETE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+ +R  G+ P      + H++I + L ++DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 DDNVEVRKWGELPEFSFEPKPHWDIADQLDILDFERAGKVTGSRFVFYKGLGARLERALY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLH  E+GYTEV  P +V   +M GTGQ+PKF +D F   +  +  IPT+EV +TN
Sbjct: 179 NFMLDLHVDEYGYTEVIPPYMVNRASMTGTGQLPKFEEDAFKIREEDYFLIPTAEVPITN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L+  EI+ +  LP+ +   +  FRSEAGSAGRDTRG++RQHQF K ELV   + EDS+ E
Sbjct: 239 LHRDEILSADELPINYAAFSACFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++ + AE++L+ L+L YRV+S+CTGDLGF+A K YD+EVW+  QN YREISSCS    
Sbjct: 299 LEKLTNQAEKVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVWIPSQNTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R       +  HTLNGSG+AVGR + A+LENY   DGSV IP  LRPYM 
Sbjct: 359 FQARRANIRFRREAKGKPEHVHTLNGSGLAVGRTVAALLENYQQEDGSVIIPKALRPYMG 418

Query: 419 NLAVIKK 425
           N  VI+ 
Sbjct: 419 NRDVIQP 425


>gi|308389806|gb|ADO32126.1| seryl-tRNA synthetase [Neisseria meningitidis alpha710]
          Length = 431

 Score =  439 bits (1128), Expect = e-121,   Method: Composition-based stats.
 Identities = 202/433 (46%), Positives = 276/433 (63%), Gaps = 9/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L  R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLAARGYEFDAARFNALEEQRKAVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPAGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-------TTDGRWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F        T   ++LIPT+E
Sbjct: 180 FMLDTHTLQHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYETLEEMVGHAENILKALELPYRVITLCTGDMGFGAAKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RR+ +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRLKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIKKE 426
           +PYM  +A ++ +
Sbjct: 419 QPYMGGVAKLEVK 431


>gi|312134746|ref|YP_004002084.1| seryl-tRNA synthetase [Caldicellulosiruptor owensensis OL]
 gi|311774797|gb|ADQ04284.1| seryl-tRNA synthetase [Caldicellulosiruptor owensensis OL]
          Length = 420

 Score =  439 bits (1128), Expect = e-121,   Method: Composition-based stats.
 Identities = 199/424 (46%), Positives = 280/424 (66%), Gaps = 4/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD+++IR NPE +   L KR+ +     IL LDE+ R L+ ++E ++A +N  S ++ +
Sbjct: 1   MLDLKYIRANPEKVQEGLTKRNKDISIAPILELDERRRKLLAEVESLKALQNQKSKEVPK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG    V  L NE   L +++  L+    EV   ++K++  IPN+P E VP+G    
Sbjct: 61  LKKEGK--DVTELMNELKELSDKIKELDSVVKEVEDEIEKILLTIPNIPHESVPVGKDDT 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G         + H+EIG  LG++DF+RA+K+SG+RF+   G  A LERAL  
Sbjct: 119 ENVEVRRWGDVRVPDFELKPHWEIGINLGILDFERASKVSGSRFTFYRGLGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLH  +HGYTE+  P LV  ++M GTGQ+PKF +D F TTD  +LIPT+EV +TN +
Sbjct: 179 FMLDLHIEKHGYTELFPPFLVARKSMIGTGQLPKFEEDAFKTTDDYFLIPTAEVPVTNYH 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ + LP+++   +  FR+EAG+AG+DTRG++RQHQF K ELV   + EDS+ E E
Sbjct: 239 REEILKEEDLPIKYVAYSACFRAEAGAAGKDTRGLIRQHQFNKVELVKFAKPEDSYDELE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           ++ + AE++LK L L YRVV LC+GDLGFS+ KTYD+EVW+     Y EISSCS   ++Q
Sbjct: 299 KLTADAEDVLKELGLPYRVVLLCSGDLGFSSAKTYDIEVWMPSYGRYVEISSCSNFESYQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RR N R+R  + K L + HTLNGSG+AVGR L AILEN+   DG+V +P VLR YM   
Sbjct: 359 ARRANIRFRRKDGK-LDYVHTLNGSGLAVGRTLAAILENFQQKDGTVVVPEVLRKYM-GT 416

Query: 421 AVIK 424
            VIK
Sbjct: 417 DVIK 420


>gi|59711515|ref|YP_204291.1| seryl-tRNA synthetase [Vibrio fischeri ES114]
 gi|67461597|sp|Q5E6E3|SYS_VIBF1 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|59479616|gb|AAW85403.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Vibrio fischeri ES114]
          Length = 435

 Score =  439 bits (1128), Expect = e-121,   Method: Composition-based stats.
 Identities = 189/434 (43%), Positives = 267/434 (61%), Gaps = 11/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   +     L +R  +   E + +L+E+ + L  K E+++A+RNS S  IGQ
Sbjct: 1   MLDSKLLRTELDETAEKLARRGFKLDVETLRNLEEQRKSLQVKTEELQAQRNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+    D +  + + L  +L   +    E+   ++ +   +PN+P + VP+G   N
Sbjct: 61  AKAKGDHEEADRIMADVANLGSELDEAKAALAELQQQIEDIALSVPNIPDDSVPLGKDEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +   G   +     ++H ++GE    +DF  A K+SG+RF V+ G  A L RAL Q
Sbjct: 121 ENVEVLRWGTPLAYDFEVKDHVDLGEMADGLDFASAVKISGSRFIVMKGQFARLHRALSQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-----------GRWLI 229
           FM+DLHT EHGYTE+  P LV  ++++GTGQ+PKF +D+F T+               LI
Sbjct: 181 FMLDLHTEEHGYTEMYVPYLVNPDSLFGTGQLPKFGEDLFHTSPLTEQVSDVPLKKLSLI 240

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV +TN+    I +   +PL+ T   P FRSEAGS GRDTRG++R HQF K ELV I
Sbjct: 241 PTAEVPVTNMVRDTITDEADMPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQI 300

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
           T+ EDS    E +   AE++L+ L+L YR V LCTGD+GF + KTYDLEVW+  Q  YRE
Sbjct: 301 TKPEDSMAALEELTGHAEKVLQLLELPYRKVVLCTGDMGFGSRKTYDLEVWVPAQETYRE 360

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR ++AILEN+  ADG + I
Sbjct: 361 ISSCSNMWDFQARRMQARFRRKGEKKPELVHTLNGSGLAVGRTMVAILENFQQADGKIAI 420

Query: 410 PTVLRPYMNNLAVI 423
           P VLR YMN +  I
Sbjct: 421 PQVLRKYMNGVEFI 434


>gi|52145196|ref|YP_081631.1| seryl-tRNA synthetase [Bacillus cereus E33L]
 gi|67461705|sp|Q63HF6|SYS_BACCZ RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|51978665|gb|AAU20215.1| serine--tRNA ligase (seryl-tRNA synthetase) [Bacillus cereus E33L]
          Length = 424

 Score =  439 bits (1128), Expect = e-121,   Method: Composition-based stats.
 Identities = 188/426 (44%), Positives = 268/426 (62%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+++R N E +   L+ R  +         LD + R L+ + E+++++RN  S QI 
Sbjct: 1   MLDIKFLRTNFEEVKAKLQHRGEDLTDFGRFEELDTRRRELLVQTEELKSKRNEVSQQIS 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      +AL  E   + E++  L+ E   V   L++L+  IPN+P E  P+G + 
Sbjct: 61  VLKREKK--DAEALILEMREVGEKVKDLDNELRTVEEDLERLMLSIPNIPHESAPVGETE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N++ R+ G+        + H+++   LG++DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 DDNVVARTWGEVKEFNFEPKPHWDLATDLGILDFERAGKVTGSRFVFYKGAGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLHT EHGY EV  P +V   +M GTGQ+PKF +D F      +  IPT+EV +TN
Sbjct: 179 SFMLDLHTDEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIESEDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           ++  EI+  + LP+R+   +  FRSEAGSAGRDTRG++RQHQF K ELV   + EDS+ E
Sbjct: 239 MHRDEILNKEQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++ + AE +L+ L+L YRV+S+CTGDLGF+A K YD+EVW+     YREISSCS    
Sbjct: 299 LEKLTNDAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVWIPSYGTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R   +   +  HTLNGSG+A+GR + AILENY   DG++ IP VLRPYM 
Sbjct: 359 FQARRANIRFRREPNGKPEHVHTLNGSGLAIGRTVAAILENYQQEDGTIIIPEVLRPYMG 418

Query: 419 NLAVIK 424
              VIK
Sbjct: 419 GKTVIK 424


>gi|254469216|ref|ZP_05082621.1| seryl-tRNA synthetase [Pseudovibrio sp. JE062]
 gi|211961051|gb|EEA96246.1| seryl-tRNA synthetase [Pseudovibrio sp. JE062]
          Length = 426

 Score =  439 bits (1128), Expect = e-121,   Method: Composition-based stats.
 Identities = 242/424 (57%), Positives = 311/424 (73%), Gaps = 1/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+N E LD AL KR  EP++  ++ LD+  R    K+++ + RRNS S +IG 
Sbjct: 1   MLDIKWIRENQESLDAALAKRGQEPRAAQLVELDDARRSHTTKLQEAQQRRNSASKEIGM 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+ +G+    +ALK E + +K  +   E E+ ++ ++L+  ++ IPN+PL+EVP+G    
Sbjct: 61  AMGQGDKEKAEALKAEVAEIKSFIQNGEDEQRKLNAALEDALAVIPNIPLDEVPVGEDEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+L+ + G+KP      +EH+E+GE LG MDF+ A K+SG+RF +L   +A LERALGQ
Sbjct: 121 DNVLLHTHGEKPELDFEPKEHYELGEKLGGMDFETAAKMSGSRFVILKSQIARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-RWLIPTSEVSLTNL 239
           FMIDLHT EHGYTEVS PLLVRD A+YGT Q+PKFA+D F   +   WLIPT+EV LTN+
Sbjct: 181 FMIDLHTREHGYTEVSPPLLVRDNALYGTSQLPKFAEDQFRDQETGHWLIPTAEVPLTNM 240

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
            + E +    LP+R T L   FRSEAGSAGRDT GMLRQHQF KCELVS+T E  S  E 
Sbjct: 241 VAGETLAEADLPIRVTALTYCFRSEAGSAGRDTAGMLRQHQFQKCELVSVTDENSSLDEL 300

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           ERM   AE++LK L LHYRVV+LC+GD+GF A KTYD+EVWL GQ+ YREISSCS CG+F
Sbjct: 301 ERMRESAEKVLKLLGLHYRVVTLCSGDMGFGARKTYDIEVWLPGQDAYREISSCSVCGDF 360

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q RRMN+RYR    K+LKF HTLNGSG+AVGRCLIA++ENY NADG++T+P  LRPYMN 
Sbjct: 361 QGRRMNARYRVEGEKALKFVHTLNGSGLAVGRCLIAVMENYQNADGTITVPEALRPYMNG 420

Query: 420 LAVI 423
           L VI
Sbjct: 421 LEVI 424


>gi|218895153|ref|YP_002443564.1| seryl-tRNA synthetase [Bacillus cereus G9842]
 gi|228937319|ref|ZP_04099967.1| Seryl-tRNA synthetase [Bacillus thuringiensis serovar berliner ATCC
           10792]
 gi|228963114|ref|ZP_04124285.1| Seryl-tRNA synthetase [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228970205|ref|ZP_04130866.1| Seryl-tRNA synthetase [Bacillus thuringiensis serovar thuringiensis
           str. T01001]
 gi|228976775|ref|ZP_04137189.1| Seryl-tRNA synthetase [Bacillus thuringiensis Bt407]
 gi|226701387|sp|B7IS31|SYS_BACC2 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|218545743|gb|ACK98137.1| seryl-tRNA synthetase [Bacillus cereus G9842]
 gi|228782937|gb|EEM31101.1| Seryl-tRNA synthetase [Bacillus thuringiensis Bt407]
 gi|228789506|gb|EEM37424.1| Seryl-tRNA synthetase [Bacillus thuringiensis serovar thuringiensis
           str. T01001]
 gi|228796570|gb|EEM44007.1| Seryl-tRNA synthetase [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228822344|gb|EEM68324.1| Seryl-tRNA synthetase [Bacillus thuringiensis serovar berliner ATCC
           10792]
 gi|326937809|gb|AEA13705.1| seryl-tRNA synthetase [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 424

 Score =  439 bits (1128), Expect = e-121,   Method: Composition-based stats.
 Identities = 187/426 (43%), Positives = 267/426 (62%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+++R N E +   L+ R  +         LD + R L+ + E+++++RN  S QI 
Sbjct: 1   MLDIKFLRTNFEEVKAKLQHRGEDLTDFGRFEELDTRRRELLVQTEELKSKRNEVSQQIS 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      +AL  E   + E++   + E   V   L++L+  IPN+P E  P+G + 
Sbjct: 61  VLKREKK--DAEALILEMREVGEKVKDFDNELRTVEEDLERLMLSIPNIPHESAPVGETE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N++ R+ G+        + H+++   LG++DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 DDNVVARTWGEVKEFTFEPKPHWDLATDLGILDFERAGKVTGSRFVFYKGAGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLHT EHGY EV  P +V   +M GTGQ+PKF +D F      +  IPT+EV +TN
Sbjct: 179 SFMLDLHTDEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIESEDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           ++  EI+  + LP+R+   +  FRSEAGSAGRDTRG++RQHQF K ELV   + EDS+ E
Sbjct: 239 MHRDEILNKEQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++ + AE +L+ L+L YRV+S+CTGDLGF+A K YD+EVW+     YREISSCS    
Sbjct: 299 LEKLTNDAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVWIPSYGTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R   +   +  HTLNGSG+A+GR + AILENY   DG++ IP VLRPYM 
Sbjct: 359 FQARRANIRFRREPNGKPEHVHTLNGSGLAIGRTVAAILENYQQEDGTIIIPEVLRPYMG 418

Query: 419 NLAVIK 424
              VIK
Sbjct: 419 GKTVIK 424


>gi|313107648|ref|ZP_07793831.1| seryl-tRNA synthetase [Pseudomonas aeruginosa 39016]
 gi|310880333|gb|EFQ38927.1| seryl-tRNA synthetase [Pseudomonas aeruginosa 39016]
          Length = 426

 Score =  439 bits (1128), Expect = e-121,   Method: Composition-based stats.
 Identities = 194/427 (45%), Positives = 276/427 (64%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R  P+ +   L  R  +     I +L+E+ + +  + E ++A RN+ S  IGQ
Sbjct: 1   MLDPKLVRTQPQEVAARLATRGFQLDVARIEALEEQRKSVQTRTEQLQAERNARSKAIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G    +  L  +   +  +L   +++   +   L  ++  IPN+P E VP+G   +
Sbjct: 61  AKQRG--EDIAPLLADVDRMGSELEEGKRQLDAIQGELDAMLLGIPNLPHESVPVGADED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G   +     ++H  +GE  G +DF+ A KLSGARF+++ G +A L RAL Q
Sbjct: 119 ANVEVRRWGTPKTFDFEVKDHVALGERHGWLDFETAAKLSGARFALMRGPIARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG----RWLIPTSEVSL 236
           FMI+LHT+EHGY E   P LV+  A+ GTGQ+PKF +D+F          +LIPT+EVSL
Sbjct: 179 FMINLHTAEHGYEEAYTPYLVQAPALQGTGQLPKFEEDLFKIGRDGEADLYLIPTAEVSL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+ S +I+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I     S+
Sbjct: 239 TNIVSGQILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVDPATSY 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
              E + + AE +L+ L+L YRV++LCTGD+GF A KTYDLEVW+  Q+ YREISSCS C
Sbjct: 299 EALEGLTANAERVLQLLELPYRVLALCTGDMGFGATKTYDLEVWVPSQDKYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +RYR+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P VL+PY
Sbjct: 359 GDFQARRMQTRYRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPEVLKPY 418

Query: 417 MNNLAVI 423
           M  + VI
Sbjct: 419 MAGIEVI 425


>gi|315126413|ref|YP_004068416.1| seryl-tRNA synthetase [Pseudoalteromonas sp. SM9913]
 gi|315014927|gb|ADT68265.1| seryl-tRNA synthetase [Pseudoalteromonas sp. SM9913]
          Length = 434

 Score =  439 bits (1128), Expect = e-121,   Method: Composition-based stats.
 Identities = 199/435 (45%), Positives = 273/435 (62%), Gaps = 12/435 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD +++RQ+ E     L  R  E     +  L+E+ + L  K ++++++RN+++  IGQ
Sbjct: 1   MLDSKYLRQDVEQTAARLAARGYELDVAAVTELEERRKTLQVKTQELQSQRNASAKAIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G       L +  + L  +L   + E+ EV  ++K++   IPN+P E VP G   +
Sbjct: 61  AKAKG--EDAQPLLDAVANLGSELDAAKTEQDEVLEAIKQIALAIPNLPDESVPAGADED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I + G         ++H ++G+ L  +DF+   K+SGARF+V+ G +A + RAL Q
Sbjct: 119 DNVEILTWGTPKKYDFEVKDHVDVGQDLNGLDFEMGVKISGARFTVMRGQVARMHRALTQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT----------TDGRWLIP 230
           +M+D HT ++GYTE+  P LV   ++YGT Q+PKFA D+F T            G  LIP
Sbjct: 179 YMLDTHTDKNGYTEMYVPYLVNSASLYGTSQLPKFAGDLFHTLGLVNDDGEQQPGFSLIP 238

Query: 231 TSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT 290
           T+EV LTN    EI E   LP+R T   P FRSEAGS GRDTRG++RQHQF K ELV + 
Sbjct: 239 TAEVPLTNSARDEIYEESDLPIRLTAHTPCFRSEAGSYGRDTRGLIRQHQFDKVELVQLV 298

Query: 291 REEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREI 350
           + EDS    E +   AE+IL+ L+L YR V LC GD+GF A KTYDLEVWL  Q+ YREI
Sbjct: 299 KPEDSMQALEELTGHAEQILQALELPYRKVILCMGDMGFGAAKTYDLEVWLPAQDTYREI 358

Query: 351 SSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIP 410
           SSCS   +FQ+RRM +R+R   +K  +  HTLNGSG+AVGR L+AILENY  ADGSV +P
Sbjct: 359 SSCSNMVDFQARRMQARFRREGAKKPELLHTLNGSGLAVGRTLVAILENYQQADGSVVVP 418

Query: 411 TVLRPYMNNLAVIKK 425
            VLRPYM  L VI K
Sbjct: 419 EVLRPYMGGLEVIGK 433


>gi|319783192|ref|YP_004142668.1| seryl-tRNA synthetase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317169080|gb|ADV12618.1| seryl-tRNA synthetase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 434

 Score =  438 bits (1127), Expect = e-121,   Method: Composition-based stats.
 Identities = 238/434 (54%), Positives = 307/434 (70%), Gaps = 8/434 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEY-----ILSLDEKNRILIKKIEDIRARRNSNS 55
           MLDI+WIR NP+ L  AL KR             +++ DE  R  + +++  + RRN+ S
Sbjct: 1   MLDIKWIRDNPKALVEALVKRSWSADEAQSTVGGLIASDEARREHVTELQTKQERRNAAS 60

Query: 56  AQIGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPI 115
            +IG A+  G+ +L + LK E   +K  +   E  E E+  +L   ++ +PNVP ++VP+
Sbjct: 61  KEIGNAMRSGDAALAETLKAEVGEIKVFIQNGEARERELDKALNDALAVLPNVPFDDVPV 120

Query: 116 GTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLE 175
           G   ++N++   VGK P+  +  +EHFEIGEALG+MDF+RA KLSG+RF+VL   LA +E
Sbjct: 121 GKDEHDNVVKHIVGKVPTRPNWVKEHFEIGEALGMMDFERAAKLSGSRFTVLKNGLARME 180

Query: 176 RALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD---GRWLIPTS 232
           RALGQFM+DLHT+EHGY EV  PL+V+D  ++GT Q+PKF +D+F T        LIPT+
Sbjct: 181 RALGQFMLDLHTTEHGYEEVIPPLMVKDNVLFGTNQLPKFEEDLFFTPHGEGRLGLIPTA 240

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI   + LPLR+T L P FRSEAGSAGRDTRGMLRQHQF+K ELVSIT +
Sbjct: 241 EVPLTNLVREEITAHEKLPLRYTALTPCFRSEAGSAGRDTRGMLRQHQFYKVELVSITDQ 300

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E S  EHERM  CAEE+LKRL L +R ++LCTGD+GF A KTYD+EVWL GQN YREISS
Sbjct: 301 ESSLAEHERMTQCAEEVLKRLGLPFRTMTLCTGDMGFGARKTYDIEVWLPGQNAYREISS 360

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS CG+FQ+RRM++RY+D + K  +F HTLNGSG AVGR LIA++ENY N DGSVTIP V
Sbjct: 361 CSVCGDFQARRMDARYKDKDGKGNRFVHTLNGSGTAVGRALIAVIENYQNEDGSVTIPEV 420

Query: 413 LRPYMNNLAVIKKE 426
           LRPYM  L  I+ +
Sbjct: 421 LRPYMGGLEKIEAK 434


>gi|206978343|ref|ZP_03239217.1| seryl-tRNA synthetase [Bacillus cereus H3081.97]
 gi|217957593|ref|YP_002336135.1| seryl-tRNA synthetase [Bacillus cereus AH187]
 gi|222093786|ref|YP_002527834.1| seryl-tRNA synthetase [Bacillus cereus Q1]
 gi|228983272|ref|ZP_04143487.1| Seryl-tRNA synthetase [Bacillus thuringiensis serovar tochigiensis
           BGSC 4Y1]
 gi|229136860|ref|ZP_04265489.1| Seryl-tRNA synthetase [Bacillus cereus BDRD-ST26]
 gi|229153796|ref|ZP_04281928.1| Seryl-tRNA synthetase [Bacillus cereus ATCC 4342]
 gi|226701626|sp|B7HPS8|SYS_BACC7 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|254783006|sp|B9IYI0|SYS_BACCQ RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|206743435|gb|EDZ54868.1| seryl-tRNA synthetase [Bacillus cereus H3081.97]
 gi|217068054|gb|ACJ82304.1| seryl-tRNA synthetase [Bacillus cereus AH187]
 gi|221237832|gb|ACM10542.1| serine--tRNA ligase (seryl-tRNA synthetase) [Bacillus cereus Q1]
 gi|228629665|gb|EEK86360.1| Seryl-tRNA synthetase [Bacillus cereus ATCC 4342]
 gi|228646595|gb|EEL02800.1| Seryl-tRNA synthetase [Bacillus cereus BDRD-ST26]
 gi|228776452|gb|EEM24803.1| Seryl-tRNA synthetase [Bacillus thuringiensis serovar tochigiensis
           BGSC 4Y1]
          Length = 424

 Score =  438 bits (1127), Expect = e-121,   Method: Composition-based stats.
 Identities = 188/426 (44%), Positives = 267/426 (62%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+++R N E +   L+ R  +         LD + R L+ + E+++++RN  S QI 
Sbjct: 1   MLDIKFLRTNFEEVKAKLQHRGEDLTDFGRFEELDTRRRELLVQTEELKSKRNEVSQQIS 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      +AL  E   + E++  L+ E   V   L++L+  IPN+P E  P+G + 
Sbjct: 61  VLKREKK--DAEALILEMREVGEKVKDLDNELRTVEEDLERLMLSIPNIPHESAPVGETE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N++ R+ G+        + H+++   LG++DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 DDNVVARTWGEVKEFAFEPKPHWDLATDLGILDFERAGKVTGSRFVFYKGAGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLHT EHGY EV  P +V   +M GTGQ+PKF +D F      +  IPT+EV +TN
Sbjct: 179 SFMLDLHTDEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIESEDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           ++  EI+    LP+R+   +  FRSEAGSAGRDTRG++RQHQF K ELV   + EDS+ E
Sbjct: 239 MHRDEILNKDQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++ + AE +L+ L+L YRV+S+CTGDLGF+A K YD+EVW+     YREISSCS    
Sbjct: 299 LEKLTNDAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVWIPSYGTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R   +   +  HTLNGSG+A+GR + AILENY   DG++ IP VLRPYM 
Sbjct: 359 FQARRANIRFRREPNGKPEHVHTLNGSGLAIGRTVAAILENYQQEDGTIIIPEVLRPYMG 418

Query: 419 NLAVIK 424
              VIK
Sbjct: 419 GKTVIK 424


>gi|260891941|ref|YP_003238038.1| seryl-tRNA synthetase [Ammonifex degensii KC4]
 gi|260864082|gb|ACX51188.1| seryl-tRNA synthetase [Ammonifex degensii KC4]
          Length = 427

 Score =  438 bits (1127), Expect = e-121,   Method: Composition-based stats.
 Identities = 198/428 (46%), Positives = 269/428 (62%), Gaps = 4/428 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQ-SEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD+++IR+ PE +  AL++R       + +L++D + R  +  ++++R+  N  S +I 
Sbjct: 1   MLDLKFIRRQPEVVKEALRRRGYPENLVDELLAVDARWREKLTYLQELRSEHNRVSEEIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           +    G+      L      L +++  L KE   +   L++ +  IPN+P   VP G  A
Sbjct: 61  RRKQAGD--EAVELIAAMRELSDRIEDLAKEVGALERELQERLLEIPNIPHPSVPYGEDA 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            +N+ +R  G+        R H+EIGE  G++DF R  K++G RF    G  A LERAL 
Sbjct: 119 EDNVEVRRWGEPRRFSFPPRPHWEIGEITGVLDFARGVKVAGTRFVFYRGLGAALERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT-DGRWLIPTSEVSLTN 238
            FM+DLHT EHGY EV  P LV  E+M GTGQ+PKFA+DMF    +  +LIPT+EV +TN
Sbjct: 179 NFMLDLHTREHGYEEVFPPFLVNRESMVGTGQLPKFAEDMFKVEGEDFYLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L+  EI++   LPL++   +  FR+EAG+AGR+TRG++RQHQF K ELV   R E S  E
Sbjct: 239 LHREEILDGGQLPLKYVAYSACFRAEAGAAGRETRGLIRQHQFNKVELVKFCRPEQSEEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++++ AEE+LKRL L YRVV LCTGDLGF+A KTYD+EVWL     Y+EISSCS  G+
Sbjct: 299 LEKLVADAEEVLKRLGLPYRVVVLCTGDLGFAAAKTYDIEVWLPSYGAYKEISSCSNFGD 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N RYR        F HTLNGSG+AVGR + AILENY   DGSV IP  LRPYM 
Sbjct: 359 FQARRANIRYRPHPKAKAAFVHTLNGSGLAVGRTVAAILENYQEEDGSVVIPPALRPYMG 418

Query: 419 NLAVIKKE 426
            +  I  +
Sbjct: 419 GVERIPAQ 426


>gi|168236873|ref|ZP_02661931.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|194735850|ref|YP_002114015.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|238693663|sp|B4TRS5|SYS_SALSV RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|194711352|gb|ACF90573.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197290153|gb|EDY29510.1| seryl-tRNA synthetase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
          Length = 430

 Score =  438 bits (1127), Expect = e-121,   Method: Composition-based stats.
 Identities = 198/431 (45%), Positives = 269/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + +L+E+ ++L    E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDKLRALEERRKVLQVNTENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++ +   IPN+P +EVP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNKLGEELDAAKAELDTLLAEIRNIALTIPNLPADEVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         R+H  +GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGTPREFDFEIRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY+E   P LV  + +YGTGQ+PKFA D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYSENYVPYLVNHDTLYGTGQLPKFAGDLFHTRPLEEEADSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EII+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEIIDEDQLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E M   AE++L+ L L YR + LCTGD+GF ACKTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNELEYI 429


>gi|312128024|ref|YP_003992898.1| seryl-tRNA synthetase [Caldicellulosiruptor hydrothermalis 108]
 gi|311778043|gb|ADQ07529.1| seryl-tRNA synthetase [Caldicellulosiruptor hydrothermalis 108]
          Length = 420

 Score =  438 bits (1127), Expect = e-121,   Method: Composition-based stats.
 Identities = 198/424 (46%), Positives = 282/424 (66%), Gaps = 4/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD+++IR NPE +   L KR+ +     IL LDE+ R L+ ++E ++A +N  S ++ +
Sbjct: 1   MLDLKYIRSNPEKVQEGLSKRNKDISIAPILELDERRRKLLAEVESLKALQNQKSKEVPK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG    V  L NE   L +++  L+ +  EV   ++K++  IPN+P E VP+G    
Sbjct: 61  LKKEGK--DVTDLMNELKELSDKIKELDSKVKEVEDEIEKILLTIPNIPHESVPVGKDDT 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G+        + H+EIG  LG++DF+RA+K+SG+RF+   G  A LERAL  
Sbjct: 119 ENVEVRRWGEVREPDFEIKPHWEIGVNLGILDFERASKVSGSRFTFYRGLGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLH  +HGYTE+  P LV  ++M GTGQ+PKF +D F TTD  +LIPT+EV +TN +
Sbjct: 179 FMLDLHIEKHGYTELFPPFLVARKSMIGTGQLPKFEEDAFKTTDDYFLIPTAEVPVTNYH 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ + LP+++   +  FR+EAG+AG+DTRG++RQHQF K ELV   + EDS+ E E
Sbjct: 239 REEILKEEDLPIKYVAYSACFRAEAGAAGKDTRGLIRQHQFNKVELVKFAKPEDSYDELE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           ++ + AE++LK L L YRVV LC+GDLGFS+ KTYD+EVW+     Y EISSCS   ++Q
Sbjct: 299 KLTADAEDVLKELGLPYRVVLLCSGDLGFSSAKTYDIEVWMPSYGRYVEISSCSNFESYQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RR N R+R  + K L + HTLNGSG+AVGR L A+LEN+   DG+V +P VLR YM   
Sbjct: 359 ARRANIRFRRKDGK-LDYVHTLNGSGLAVGRTLAAVLENFQQKDGTVVVPEVLRKYM-GT 416

Query: 421 AVIK 424
            VIK
Sbjct: 417 DVIK 420


>gi|197334999|ref|YP_002155670.1| seryl-tRNA synthetase [Vibrio fischeri MJ11]
 gi|238690279|sp|B5FCK7|SYS_VIBFM RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|197316489|gb|ACH65936.1| seryl-tRNA synthetase [Vibrio fischeri MJ11]
          Length = 435

 Score =  438 bits (1127), Expect = e-121,   Method: Composition-based stats.
 Identities = 190/434 (43%), Positives = 267/434 (61%), Gaps = 11/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   +     L +R  +   E + +L+E+ + L  K E+++A+RNS S  IGQ
Sbjct: 1   MLDSKLLRTELDETAEKLARRGFKLDVETLRNLEEQRKSLQVKTEELQAQRNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+    D +  + + L  +L   +    E+   ++ +   +PN+P + VP+G   N
Sbjct: 61  AKAKGDHEEADRIMADVANLGSELDEAKAALAELQQQIEDIALSVPNIPDDSVPLGKDEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +   G   +     ++H ++GE    +DF  A K+SG+RF V+ G  A L RAL Q
Sbjct: 121 ENVEVLRWGTPLAYDFEVKDHVDLGEMADGLDFASAVKISGSRFIVMKGQFARLHRALSQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-----------GRWLI 229
           FM+DLHT EHGYTE+  P LV  ++++GTGQ+PKF +D+F T+               LI
Sbjct: 181 FMLDLHTEEHGYTEMYVPYLVNPDSLFGTGQLPKFGEDLFHTSPLTEQVSDVPLKKLSLI 240

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV +TN+    I +   +PL+ T   P FRSEAGS GRDTRG++R HQF K ELV I
Sbjct: 241 PTAEVPVTNMVRDTITDEADMPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQI 300

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
           TR EDS    E +   AE++L+ L+L YR V LCTGD+GF + KTYDLEVW+  Q  YRE
Sbjct: 301 TRPEDSMAALEELTGHAEKVLQLLELPYRKVVLCTGDMGFGSRKTYDLEVWVPAQETYRE 360

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR ++AILEN+  ADG + I
Sbjct: 361 ISSCSNMWDFQARRMQARFRRKGEKKPELVHTLNGSGLAVGRTMVAILENFQQADGKIAI 420

Query: 410 PTVLRPYMNNLAVI 423
           P VLR YMN +  I
Sbjct: 421 PQVLRKYMNGVEFI 434


>gi|206972683|ref|ZP_03233623.1| seryl-tRNA synthetase [Bacillus cereus AH1134]
 gi|228950564|ref|ZP_04112700.1| Seryl-tRNA synthetase [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|229067780|ref|ZP_04201099.1| Seryl-tRNA synthetase [Bacillus cereus F65185]
 gi|229077289|ref|ZP_04209972.1| Seryl-tRNA synthetase [Bacillus cereus Rock4-2]
 gi|229176616|ref|ZP_04304022.1| Seryl-tRNA synthetase [Bacillus cereus 172560W]
 gi|206732403|gb|EDZ49585.1| seryl-tRNA synthetase [Bacillus cereus AH1134]
 gi|228606846|gb|EEK64261.1| Seryl-tRNA synthetase [Bacillus cereus 172560W]
 gi|228706012|gb|EEL58317.1| Seryl-tRNA synthetase [Bacillus cereus Rock4-2]
 gi|228715333|gb|EEL67190.1| Seryl-tRNA synthetase [Bacillus cereus F65185]
 gi|228809107|gb|EEM55590.1| Seryl-tRNA synthetase [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
          Length = 424

 Score =  438 bits (1127), Expect = e-121,   Method: Composition-based stats.
 Identities = 188/426 (44%), Positives = 268/426 (62%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+++R N E +   L+ R  +         LD + R L+ + E+++++RN  S QI 
Sbjct: 1   MLDIKFLRTNFEEVKAKLQHRGEDLTDFGRFEELDTRRRELLVQTEELKSKRNEVSQQIS 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      +AL  E   + E++  L+ E   V   L++L+  IPN+P E  P+G + 
Sbjct: 61  VLKREKK--DAEALILEMREVGEKVKDLDNELRTVEEDLERLMLSIPNIPHESAPVGETE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N++ R+ G+        + H+++   LG++DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 DDNVVARTWGEVKEFTFEPKPHWDLATDLGILDFERAGKVTGSRFVFYKGAGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLHT EHGY EV  P +V   +M GTGQ+PKF +D F      +  IPT+EV +TN
Sbjct: 179 SFMLDLHTDEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIESEDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           ++  EI+  + LP+R+   +  FRSEAGSAGRDTRG++RQHQF K ELV   + EDS+ E
Sbjct: 239 MHRDEILNKEQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++ + AE +L+ L+L YRV+S+CTGDLGF+A K YD+EVW+     YREISSCS    
Sbjct: 299 LEKLTNDAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVWIPSYGTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R   +   +  HTLNGSG+A+GR + AILENY   DG++ IP VLRPYM 
Sbjct: 359 FQARRANIRFRREPNGKPEHVHTLNGSGLAIGRTVAAILENYQQEDGTIIIPEVLRPYMG 418

Query: 419 NLAVIK 424
              VIK
Sbjct: 419 GKTVIK 424


>gi|170726825|ref|YP_001760851.1| seryl-tRNA synthetase [Shewanella woodyi ATCC 51908]
 gi|238688660|sp|B1KG49|SYS_SHEWM RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|169812172|gb|ACA86756.1| seryl-tRNA synthetase [Shewanella woodyi ATCC 51908]
          Length = 428

 Score =  438 bits (1127), Expect = e-121,   Method: Composition-based stats.
 Identities = 196/429 (45%), Positives = 268/429 (62%), Gaps = 8/429 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD +++R   E    +L  R      E +  L+EK + L    E+++A RN+ S  IGQ
Sbjct: 1   MLDPKFLRNELEATAESLATRGFILDVERLSKLEEKRKSLQVATEELQASRNAISKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G    V  +  +   L  QL   + E  E+   L  +   +PN+P    PIG   +
Sbjct: 61  AKAKG--EDVAPIMAQVGDLGSQLDSKKAELAELLEELNAIALSVPNLPDASAPIGKDES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G         ++H E+GE LG +DF  A K++G+RF ++ G +A + RAL Q
Sbjct: 119 ENVEVRRWGTIKEYGFEVKDHVELGETLGGLDFKSAVKITGSRFIIMKGQIARMHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG------RWLIPTSEV 234
           FM+DLHT+EHGYTE   PLLV ++++ GTGQ+PKF +D+F T           LIPT+EV
Sbjct: 179 FMLDLHTTEHGYTETYVPLLVNEDSLMGTGQLPKFGEDLFHTKPATEEGQGLSLIPTAEV 238

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            LTN+    II+   LP++ T   P FRSEAGS GRDTRG++RQHQF K ELV + + ED
Sbjct: 239 PLTNIARDTIIDEAELPVKLTAHTPCFRSEAGSYGRDTRGLIRQHQFDKVELVQLVKPED 298

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCS 354
           S    + +   AE++L++L L YR V LCTGD+GF + KT+D+EVWL  QN YREISSCS
Sbjct: 299 SMAALDALTGHAEKVLEKLGLPYRTVILCTGDMGFGSSKTFDIEVWLPAQNTYREISSCS 358

Query: 355 TCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR 414
              +FQ+RRM +RY+  ++K     HTLNGSG+AVGR L+A+LENY N DGS+T+P VLR
Sbjct: 359 NMQDFQARRMQARYKAADAKKPALLHTLNGSGLAVGRTLVAVLENYQNEDGSITVPEVLR 418

Query: 415 PYMNNLAVI 423
           PYM  L  I
Sbjct: 419 PYMGGLEKI 427


>gi|229015418|ref|ZP_04172422.1| Seryl-tRNA synthetase [Bacillus cereus AH1273]
 gi|229021624|ref|ZP_04178212.1| Seryl-tRNA synthetase [Bacillus cereus AH1272]
 gi|228739670|gb|EEL90078.1| Seryl-tRNA synthetase [Bacillus cereus AH1272]
 gi|228745876|gb|EEL95874.1| Seryl-tRNA synthetase [Bacillus cereus AH1273]
          Length = 424

 Score =  438 bits (1127), Expect = e-121,   Method: Composition-based stats.
 Identities = 188/426 (44%), Positives = 268/426 (62%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+++R N E +   L+ R  +         LD + R L+ + E+++++RN  S QI 
Sbjct: 1   MLDIKFLRTNFEEVKAKLQHRGEDLTDFGRFEELDTRRRELLVQTEELKSKRNEVSQQIS 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      +AL  E   + E++  L+ E   V   L++L+  IPN+P E  P+G + 
Sbjct: 61  VLKREKK--DAEALILEMREVGEKVKDLDNELRTVEEDLERLMLSIPNIPHESAPVGETE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N++ R+ G+        + H+++   LG++DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 DDNVVARNWGEVKEFTFEPKPHWDLATDLGILDFERAGKVTGSRFVFYKGAGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLHT EHGY EV  P +V   +M GTGQ+PKF +D F      +  IPT+EV +TN
Sbjct: 179 SFMLDLHTDEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIESEDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           ++  EI+  + LP+R+   +  FRSEAGSAGRDTRG++RQHQF K ELV   + EDS+ E
Sbjct: 239 MHRDEILSKEQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++ + AE +L+ L+L YRV+S+CTGDLGF+A K YD+EVW+     YREISSCS    
Sbjct: 299 LEKLTNDAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVWIPSYGTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R   +   +  HTLNGSG+A+GR + AILENY   DG++ IP VLRPYM 
Sbjct: 359 FQARRANIRFRREPNGKPEHVHTLNGSGLAIGRTVAAILENYQQEDGTIIIPEVLRPYMG 418

Query: 419 NLAVIK 424
              VIK
Sbjct: 419 GKTVIK 424


>gi|261392091|emb|CAX49588.1| seryl-tRNA synthetase (serine--tRNA ligase; SerRS) [Neisseria
           meningitidis 8013]
          Length = 431

 Score =  438 bits (1127), Expect = e-121,   Method: Composition-based stats.
 Identities = 203/433 (46%), Positives = 276/433 (63%), Gaps = 9/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L  R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLAARGYEFDAARFNALEEQRKAVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPAGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-------TTDGRWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F        T   ++LIPT+E
Sbjct: 180 FMLDTHTLQHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYETLEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIKKE 426
           +PYM  +A ++ +
Sbjct: 419 QPYMGGVAKLEVK 431


>gi|114767457|ref|ZP_01446244.1| seryl-tRNA synthetase [Pelagibaca bermudensis HTCC2601]
 gi|114540467|gb|EAU43548.1| seryl-tRNA synthetase [Roseovarius sp. HTCC2601]
          Length = 430

 Score =  438 bits (1127), Expect = e-121,   Method: Composition-based stats.
 Identities = 196/429 (45%), Positives = 274/429 (63%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D AL +R +EPQS  IL +DE+ R  I   E  +A +   +  +G 
Sbjct: 1   MHDIRAIRENPAAFDAALSRRGMEPQSPSILKIDEERRAAIHAAETAQADQKKAAKDVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A GN +  + L+      K ++  ++     + + L +L+  +PN+P ++VP G   +
Sbjct: 61  AKASGNEAEFERLRALVGAKKAEVSEMQDRAKALDAQLDELLMGLPNLPFDDVPDGADED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I   G   +     +EH+++      MDF+ A KLSG+RF VL+G +  + RAL Q
Sbjct: 121 DNVEIHRWGTPATFDFAPKEHYQLAAVQKGMDFETAAKLSGSRFVVLSGGVVRIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H  E+G TE   P+LVR+E MYGTGQ+PKF +D + T +G WL+PT+EV+LTN+ 
Sbjct: 181 FMLDTHVEENGLTETWTPVLVREEMMYGTGQLPKFGEDSYQTREGWWLVPTAEVTLTNIV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + E +E   LP R+      FRSEAGSAGRDT GMLRQHQF K E+VS+T  + S  E +
Sbjct: 241 NGETVEESYLPRRYVAHTQCFRSEAGSAGRDTSGMLRQHQFEKVEMVSVTHPDKSREELD 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CA+ IL++L L YR V LCTGD+GF A +T+D+EVWL GQN YREISS S CG+FQ
Sbjct: 301 RMTACAQGILEKLGLPYRTVVLCTGDIGFGARRTHDIEVWLPGQNTYREISSVSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++        + HTLNGSG+AVGRCLIA+LEN    DGSV +P  L P++   
Sbjct: 361 ARRMNARFKPAGGGKPDYVHTLNGSGLAVGRCLIAVLENGQQEDGSVKLPEALHPWLGGK 420

Query: 421 AVIKKEHIL 429
             +  +  L
Sbjct: 421 TTLTADGEL 429


>gi|15597808|ref|NP_251302.1| seryl-tRNA synthetase [Pseudomonas aeruginosa PAO1]
 gi|107102134|ref|ZP_01366052.1| hypothetical protein PaerPA_01003183 [Pseudomonas aeruginosa PACS2]
 gi|116050599|ref|YP_790582.1| seryl-tRNA synthetase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218891227|ref|YP_002440093.1| seryl-tRNA synthetase [Pseudomonas aeruginosa LESB58]
 gi|254235598|ref|ZP_04928921.1| seryl-tRNA synthetase [Pseudomonas aeruginosa C3719]
 gi|254241045|ref|ZP_04934367.1| seryl-tRNA synthetase [Pseudomonas aeruginosa 2192]
 gi|296388929|ref|ZP_06878404.1| seryl-tRNA synthetase [Pseudomonas aeruginosa PAb1]
 gi|30173211|sp|Q9I0M6|SYS_PSEAE RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|122259722|sp|Q02NA4|SYS_PSEAB RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|226701396|sp|B7UW10|SYS_PSEA8 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|9948677|gb|AAG06000.1|AE004689_12 seryl-tRNA synthetase [Pseudomonas aeruginosa PAO1]
 gi|115585820|gb|ABJ11835.1| seryl-tRNA synthetase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126167529|gb|EAZ53040.1| seryl-tRNA synthetase [Pseudomonas aeruginosa C3719]
 gi|126194423|gb|EAZ58486.1| seryl-tRNA synthetase [Pseudomonas aeruginosa 2192]
 gi|218771452|emb|CAW27219.1| seryl-tRNA synthetase [Pseudomonas aeruginosa LESB58]
          Length = 426

 Score =  438 bits (1127), Expect = e-121,   Method: Composition-based stats.
 Identities = 194/427 (45%), Positives = 276/427 (64%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R  P+ +   L  R  +     I +L+E+ + +  + E ++A RN+ S  IGQ
Sbjct: 1   MLDPKLVRTQPQEVAARLATRGFQLDVARIEALEEQRKSVQTRTEQLQAERNARSKAIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G    +  L  +   +  +L   +++   +   L  ++  IPN+P E VP+G   +
Sbjct: 61  AKQRG--EDIAPLLADVDRMGSELEEGKRQLDAIQGELDAMLLGIPNLPHESVPVGADED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G   +     ++H  +GE  G +DF+ A KLSGARF+++ G +A L RAL Q
Sbjct: 119 ANVEVRRWGTPKTFDFEVKDHVALGERHGWLDFETAAKLSGARFALMRGPIARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG----RWLIPTSEVSL 236
           FMI+LHT+EHGY E   P LV+  A+ GTGQ+PKF +D+F          +LIPT+EVSL
Sbjct: 179 FMINLHTAEHGYEEAYTPYLVQAPALQGTGQLPKFEEDLFKIGRDGEADLYLIPTAEVSL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+ S +I+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I     S+
Sbjct: 239 TNIVSGQILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVDPATSY 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
              E + + AE +L+ L+L YRV++LCTGD+GF A KTYDLEVW+  Q+ YREISSCS C
Sbjct: 299 EALEGLTANAERVLQLLELPYRVLALCTGDMGFGATKTYDLEVWVPSQDKYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +RYR+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P VL+PY
Sbjct: 359 GDFQARRMQARYRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPEVLKPY 418

Query: 417 MNNLAVI 423
           M  + VI
Sbjct: 419 MAGIEVI 425


>gi|152973866|ref|YP_001373383.1| seryl-tRNA synthetase [Bacillus cereus subsp. cytotoxis NVH 391-98]
 gi|189083557|sp|A7GJT0|SYS_BACCN RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|152022618|gb|ABS20388.1| seryl-tRNA synthetase [Bacillus cytotoxicus NVH 391-98]
          Length = 424

 Score =  438 bits (1127), Expect = e-121,   Method: Composition-based stats.
 Identities = 191/426 (44%), Positives = 273/426 (64%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+++R N E +   L+ R  +    E    LD K R L+ + E+++++RN  S QI 
Sbjct: 1   MLDIKFLRANFEEVKEKLQHRGEDLADFECFEELDTKRRELLVQTEELKSKRNEVSQQIS 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      +AL  E   + E++  L+ E  EV   L++L+  IPN+P E  P+G + 
Sbjct: 61  MLKREKK--DAEALILEMREVGEKIKGLDNELREVEEDLERLMLSIPNIPHESTPVGETE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+++R+ G+        + H+++   LG++DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 DDNVVVRTWGEVKEFNFEPKPHWDLATDLGIVDFERAGKVTGSRFVFYKGAGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLHT EHGY EV  P +V   +M GTGQ+PKF +D F      +  IPT+EV +TN
Sbjct: 179 SFMLDLHTEEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFLIESEDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           ++  EI+ ++ LP+R+   +  FRSEAGSAGRDTRG++RQHQF K ELV   + E+S+ E
Sbjct: 239 MHRDEILSAEQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEESYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++ + AE +L+ L+L YRV+S+CTGDLGF+A K YD+EVWL   + YREISSCS    
Sbjct: 299 LEKLTNDAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVWLPSYDTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R   +   +  HTLNGSG+A+GR + AILENY   DG++ IP VLRPYM 
Sbjct: 359 FQARRANIRFRREPNAKPEPVHTLNGSGLAIGRTVAAILENYQQEDGTIIIPEVLRPYMG 418

Query: 419 NLAVIK 424
              VIK
Sbjct: 419 GKTVIK 424


>gi|302871467|ref|YP_003840103.1| seryl-tRNA synthetase [Caldicellulosiruptor obsidiansis OB47]
 gi|302574326|gb|ADL42117.1| seryl-tRNA synthetase [Caldicellulosiruptor obsidiansis OB47]
          Length = 420

 Score =  438 bits (1127), Expect = e-121,   Method: Composition-based stats.
 Identities = 198/424 (46%), Positives = 283/424 (66%), Gaps = 4/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD+++IR NPE +   L KR+ +     IL LDEK R L+ ++E ++A +N  S ++ +
Sbjct: 1   MLDLKYIRANPEKVQEGLSKRNKDISIAPILELDEKRRKLLAEVESLKALQNQKSKEVPK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG    V  L NE   L +++  L+ +  +V   ++K++  IPN+P E VP+G    
Sbjct: 61  LKKEGK--DVTGLMNELKELSDKIKELDSKVKDVEDEIEKILLTIPNIPHESVPVGKDDT 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G+      + + H+EIG  LG++DF+RA+K+SG+RF+   G  A LERAL  
Sbjct: 119 ENVEVRRWGEVREPDFIIKPHWEIGVNLGILDFERASKVSGSRFTFYRGLGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLH  +HGYTE+  P LV  ++M GTGQ+PKF +D F TTD  +LIPT+EV +TN +
Sbjct: 179 FMLDLHIEKHGYTELFPPFLVARKSMIGTGQLPKFEEDAFKTTDDYFLIPTAEVPVTNYH 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ + LP+++   +  FR+EAG+AG+DTRG++RQHQF K ELV   + EDS+ E E
Sbjct: 239 REEILKEEDLPIKYVAYSACFRAEAGAAGKDTRGLIRQHQFNKVELVKFAKPEDSYDELE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           ++ + AE++L+ L L YRVV LC+GDLGFS+ KTYD+EVW+     Y EISSCS   ++Q
Sbjct: 299 KLTADAEDVLRELGLPYRVVLLCSGDLGFSSAKTYDIEVWMPSYGRYVEISSCSNFESYQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RR N R+R  + K L + HTLNGSG+AVGR L AILEN+   DG+V +P VLR YM   
Sbjct: 359 ARRANIRFRRKDGK-LDYVHTLNGSGLAVGRTLAAILENFQQKDGTVVVPEVLRRYM-GT 416

Query: 421 AVIK 424
            VIK
Sbjct: 417 DVIK 420


>gi|256751428|ref|ZP_05492306.1| seryl-tRNA synthetase [Thermoanaerobacter ethanolicus CCSD1]
 gi|256749647|gb|EEU62673.1| seryl-tRNA synthetase [Thermoanaerobacter ethanolicus CCSD1]
          Length = 423

 Score =  438 bits (1126), Expect = e-121,   Method: Composition-based stats.
 Identities = 201/426 (47%), Positives = 271/426 (63%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++ IR NPE + IA++ +  +   +  L LDEK R ++ ++E ++ RRN  S  I +
Sbjct: 1   MLDVKRIRNNPEAVRIAIELKGEKADIDRFLELDEKRRQMLVELETLKNRRNVESDNIAK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG       L  E   L +++  +E+E  EV   L++++  IPN+P E VPIG S  
Sbjct: 61  LKREGK--DASDLIAEMKELSDKIKEMEQEVKEVEEELERILWTIPNIPHESVPIGDSDE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ IR  G+        + H+EIGE LG++DF+ A +++G+RF+   G  A LERAL  
Sbjct: 119 DNVEIRRWGEPRKFDFEPKPHWEIGEELGILDFEAAARVTGSRFTFYKGLGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTNL 239
           FM+DLH  +HGYTEV  P +V   +M+GTGQ+PKF +D F      +  IPT+EV +TN+
Sbjct: 179 FMLDLHIEKHGYTEVFPPFMVHRRSMFGTGQLPKFEEDAFKVYGTDYFLIPTAEVPVTNM 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y   II+   LP+     +  FR EAGSAGRDTRG++RQHQF K ELV  T  + S+ E 
Sbjct: 239 YRDTIIDGDKLPIYHCAYSACFRQEAGSAGRDTRGLIRQHQFNKVELVKFTEPDKSYEEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E+M   AEE+L+ L L YRVV +CTGDLGF+A K YD+EVW+     Y EISSCS C +F
Sbjct: 299 EKMTRDAEEVLQALGLPYRVVVICTGDLGFTASKKYDIEVWMPSYGRYVEISSCSNCEDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N +YR  +    ++ HTLNGSGVAVGR   AILENY   DGSV IP VLRPYM  
Sbjct: 359 QARRANIKYRPKDGGKAQYVHTLNGSGVAVGRTFAAILENYQQEDGSVVIPEVLRPYMK- 417

Query: 420 LAVIKK 425
           + VIKK
Sbjct: 418 VDVIKK 423


>gi|229188301|ref|ZP_04315352.1| Seryl-tRNA synthetase [Bacillus cereus ATCC 10876]
 gi|228595169|gb|EEK52937.1| Seryl-tRNA synthetase [Bacillus cereus ATCC 10876]
          Length = 424

 Score =  438 bits (1126), Expect = e-121,   Method: Composition-based stats.
 Identities = 188/426 (44%), Positives = 268/426 (62%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+++R N E +   L+ R  +         LD + R L+ + E+++++RN  S QI 
Sbjct: 1   MLDIKFLRTNFEEVKAKLQHRGEDLTDFGRFEELDTRRRELLVQTEELKSKRNEVSQQIS 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      +AL  E   + E++  L+ E   V   L++L+  IPN+P E  P+G + 
Sbjct: 61  VLKREKK--DAEALILEMREVGEKVKDLDYELRTVEEDLERLMLSIPNIPHESAPVGETE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N++ R+ G+        + H+++   LG++DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 DDNVVARTWGEVKEFTFEPKPHWDLATDLGILDFERAGKVTGSRFVFYKGAGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLHT EHGY EV  P +V   +M GTGQ+PKF +D F      +  IPT+EV +TN
Sbjct: 179 SFMLDLHTDEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIESEDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           ++  EI+  + LP+R+   +  FRSEAGSAGRDTRG++RQHQF K ELV   + EDS+ E
Sbjct: 239 MHRDEILNKEQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++ + AE +L+ L+L YRV+S+CTGDLGF+A K YD+EVW+     YREISSCS    
Sbjct: 299 LEKLTNDAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVWIPSYGTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R   +   +  HTLNGSG+A+GR + AILENY   DG++ IP VLRPYM 
Sbjct: 359 FQARRANIRFRREPNGKPEHVHTLNGSGLAIGRTVAAILENYQQEDGTIIIPEVLRPYMG 418

Query: 419 NLAVIK 424
              VIK
Sbjct: 419 GKTVIK 424


>gi|161870532|ref|YP_001599704.1| seryl-tRNA synthetase [Neisseria meningitidis 053442]
 gi|189083575|sp|A9M1Q6|SYS_NEIM0 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|161596085|gb|ABX73745.1| seryl-tRNA synthetase [Neisseria meningitidis 053442]
 gi|254674222|emb|CBA10006.1| Seryl-tRNA synthetase [Neisseria meningitidis alpha275]
          Length = 431

 Score =  438 bits (1126), Expect = e-121,   Method: Composition-based stats.
 Identities = 203/433 (46%), Positives = 276/433 (63%), Gaps = 9/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L  R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLAARGYEFDAARFNALEEQRKAVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPAGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-------TTDGRWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F        T   ++LIPT+E
Sbjct: 180 FMLDTHTLQHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYETLEEMVGHAENILKALELPYRVITLCTGDMGFGAAKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIKKE 426
           +PYM  +A ++ +
Sbjct: 419 QPYMGGVAKLEVK 431


>gi|228898770|ref|ZP_04063054.1| Seryl-tRNA synthetase [Bacillus thuringiensis IBL 4222]
 gi|228860862|gb|EEN05238.1| Seryl-tRNA synthetase [Bacillus thuringiensis IBL 4222]
          Length = 424

 Score =  438 bits (1126), Expect = e-121,   Method: Composition-based stats.
 Identities = 187/426 (43%), Positives = 268/426 (62%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+++R N E +   L+ R  +         LD + R L+ + E+++++RN  S QI 
Sbjct: 1   MLDIKFLRTNFEEVKAKLQHRGEDLTDFGRFEELDTRRRELLVQTEELKSKRNEVSQQIS 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E   +  +AL  E   + E++   + E   V   L++L+  IPN+P E  P+G + 
Sbjct: 61  VLKREKKGA--EALILEMREVGEKVKDFDNELRTVEEDLERLMLSIPNIPHESAPVGETE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N++ R+ G+        + H+++   LG++DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 DDNVVARTWGEVKEFTFEPKPHWDLATDLGILDFERAGKVTGSRFVFYKGAGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLHT EHGY EV  P +V   +M GTGQ+PKF +D F      +  IPT+EV +TN
Sbjct: 179 SFMLDLHTDEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIESEDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           ++  EI+  + LP+R+   +  FRSEAGSAGRDTRG++RQHQF K ELV   + EDS+ E
Sbjct: 239 MHRDEILNKEQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++ + AE +L+ L+L YRV+S+CTGDLGF+A K YD+EVW+     YREISSCS    
Sbjct: 299 LEKLTNDAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVWIPSYGTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R   +   +  HTLNGSG+A+GR + AILENY   DG++ IP VLRPYM 
Sbjct: 359 FQARRANIRFRREPNGKPEHVHTLNGSGLAIGRTVAAILENYQQEDGTIIIPEVLRPYMG 418

Query: 419 NLAVIK 424
              VIK
Sbjct: 419 GKTVIK 424


>gi|222054291|ref|YP_002536653.1| seryl-tRNA synthetase [Geobacter sp. FRC-32]
 gi|254783028|sp|B9M3Q9|SYS_GEOSF RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|221563580|gb|ACM19552.1| seryl-tRNA synthetase [Geobacter sp. FRC-32]
          Length = 422

 Score =  438 bits (1126), Expect = e-121,   Method: Composition-based stats.
 Identities = 192/424 (45%), Positives = 268/424 (63%), Gaps = 4/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD+++IR+N E ++  LK R      E    LD + R L+++ E ++A RN  S +I +
Sbjct: 1   MLDVRYIRENLELVETRLKTRGTGIDLERFRQLDSQRRELLQQTETLKALRNKVSEEISR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
                + S       E   + +++  L++E   V  +L+  +  +PN+P    P+G S  
Sbjct: 61  VK---DKSQAQDRIAEMREVSQRVKGLDEELKGVEEALEYFLLTVPNIPSSATPVGASEA 117

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ IR  G+KP      + H+EIGE L ++DF+R  KL+GARF++  G  A LERAL  
Sbjct: 118 DNVEIRVWGEKPHLDFTPKPHWEIGEDLDILDFERGAKLTGARFTLYKGLGARLERALVN 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTNL 239
           FM+DLHT  H Y E+  P +V  E+M GTGQ+PKF DD+F   +  +  IPT+EV +TN+
Sbjct: 178 FMLDLHTGRHNYLEMLPPFMVNRESMTGTGQLPKFEDDLFHLGEVDYFLIPTAEVPVTNI 237

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +  EI++   LPL +T   P FR EAGS G+DTRG++RQHQF K ELV       S+ E 
Sbjct: 238 HRGEILKGSELPLCYTAYTPCFRKEAGSYGKDTRGLIRQHQFNKVELVKFVHPGHSYAEL 297

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           +++L  AEE+L+ L L YRVV LCTGD+GFSA +T+D+EVWL GQ+ YREISSCS   +F
Sbjct: 298 DKLLDNAEEVLRLLKLPYRVVELCTGDIGFSAARTFDIEVWLPGQDCYREISSCSNFEDF 357

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR + R+R+      +F HTLNGSG+AVGR ++AILENY   DGSV IP  LRPYM  
Sbjct: 358 QARRASIRFREDEKAKPEFVHTLNGSGLAVGRTVVAILENYQQQDGSVVIPEALRPYMGG 417

Query: 420 LAVI 423
              I
Sbjct: 418 AEKI 421


>gi|212709769|ref|ZP_03317897.1| hypothetical protein PROVALCAL_00817 [Providencia alcalifaciens DSM
           30120]
 gi|212687580|gb|EEB47108.1| hypothetical protein PROVALCAL_00817 [Providencia alcalifaciens DSM
           30120]
          Length = 430

 Score =  438 bits (1126), Expect = e-121,   Method: Composition-based stats.
 Identities = 195/431 (45%), Positives = 265/431 (61%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R   + +   L +R      E +  L+E+ ++L  + E ++A RNS S  IG 
Sbjct: 1   MLDPNLLRTELDAVATKLARRGFTLDVEKLRELEERRKVLQVETETLQADRNSRSKTIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E  ++   ++ +   IPN+P +EVP G   +
Sbjct: 61  AKARG--EDIEPLRLEVNQLGEKLDAAKAELDKLQQEIRDIALSIPNIPDDEVPDGKDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +   G+        ++H  +GE  G +DF  A KL+GARF V+ G +A + RAL Q
Sbjct: 119 ENLEVSRWGEPRQYDFEVKDHVSLGELAGGLDFPAAVKLTGARFVVMKGQIARMHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY E+  P LV    +YGTGQ+PKF +D+F T             LIPT+
Sbjct: 179 FMLDLHTEKHGYQELYVPYLVNHATLYGTGQLPKFGEDLFHTKPLEEEADSSTYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV +TNL   EI++  +LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I   
Sbjct: 239 EVPVTNLVRDEILDEDALPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQIVHP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E S    E +   AE++L+ L+L YR V LCTGD+GF + KTYDLEVWL  QN YREISS
Sbjct: 299 EKSMAALEELTGHAEKVLQLLNLPYRKVLLCTGDIGFGSRKTYDLEVWLPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R+R  + K  +  HTLNGSG+AVGR L+A+LENY  ADG + +P V
Sbjct: 359 CSNMWDFQARRMQARFRGKSDKKTQLVHTLNGSGLAVGRTLVAVLENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|259908927|ref|YP_002649283.1| seryl-tRNA synthetase [Erwinia pyrifoliae Ep1/96]
 gi|224964549|emb|CAX56061.1| Seryl-tRNA synthetase [Erwinia pyrifoliae Ep1/96]
          Length = 430

 Score =  438 bits (1126), Expect = e-121,   Method: Composition-based stats.
 Identities = 199/431 (46%), Positives = 268/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + + +E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGYKLDVDTLRAHEERRKVLQVETENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + +S+      IPN+P + VP+G   +
Sbjct: 61  AKARG--EDIEPLRQEVNALGERLDAAKAELDALLTSINDFSMAIPNIPADVVPLGKDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN  I   G         R+H E+GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 ENQEIGRWGVPRKFDFTVRDHVELGERAAGLDFAAAVKLTGSRFIVMKGQIALMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY E   P LV   ++YGTGQ+PKF +D+F T             LIPTS
Sbjct: 179 FMLDLHTEQHGYQETYVPYLVNHASLYGTGQLPKFGEDLFHTRPLDEEASSSNYALIPTS 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI+E +SLPL+ T   P FRSEAG+ GRDTRG++R HQF K E+V +TR 
Sbjct: 239 EVPLTNLVRDEILEEESLPLKMTAHTPCFRSEAGAYGRDTRGLIRMHQFDKVEMVHVTRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E ++  AE++L+ L+L YR V LCTGD+GF A KTYDLEVWL  Q+ YREISS
Sbjct: 299 EDSMDALEELVGHAEKVLQLLNLPYRKVLLCTGDMGFGAQKTYDLEVWLPAQDTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS  G+FQ+RRM +R R       +  HTLNGSG+AVGR L+A+LENY  ADG + +P V
Sbjct: 359 CSNMGDFQARRMKARCRPKGETKTRLVHTLNGSGLAVGRTLVAVLENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMKGLTFI 429


>gi|30260206|ref|NP_842583.1| seryl-tRNA synthetase [Bacillus anthracis str. Ames]
 gi|47525268|ref|YP_016617.1| seryl-tRNA synthetase [Bacillus anthracis str. 'Ames Ancestor']
 gi|49183051|ref|YP_026303.1| seryl-tRNA synthetase [Bacillus anthracis str. Sterne]
 gi|49478185|ref|YP_034372.1| seryl-tRNA synthetase [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|65317479|ref|ZP_00390438.1| COG0172: Seryl-tRNA synthetase [Bacillus anthracis str. A2012]
 gi|118475790|ref|YP_892941.1| seryl-tRNA synthetase [Bacillus thuringiensis str. Al Hakam]
 gi|165873234|ref|ZP_02217845.1| seryl-tRNA synthetase [Bacillus anthracis str. A0488]
 gi|167635026|ref|ZP_02393343.1| seryl-tRNA synthetase [Bacillus anthracis str. A0442]
 gi|167641731|ref|ZP_02399974.1| seryl-tRNA synthetase [Bacillus anthracis str. A0193]
 gi|170688939|ref|ZP_02880141.1| seryl-tRNA synthetase [Bacillus anthracis str. A0465]
 gi|170707501|ref|ZP_02897954.1| seryl-tRNA synthetase [Bacillus anthracis str. A0389]
 gi|177655686|ref|ZP_02937011.1| seryl-tRNA synthetase [Bacillus anthracis str. A0174]
 gi|190569337|ref|ZP_03022229.1| seryl-tRNA synthetase [Bacillus anthracis Tsiankovskii-I]
 gi|196036387|ref|ZP_03103784.1| seryl-tRNA synthetase [Bacillus cereus W]
 gi|196047691|ref|ZP_03114895.1| seryl-tRNA synthetase [Bacillus cereus 03BB108]
 gi|218901218|ref|YP_002449052.1| seryl-tRNA synthetase [Bacillus cereus AH820]
 gi|225862069|ref|YP_002747447.1| seryl-tRNA synthetase [Bacillus cereus 03BB102]
 gi|227812690|ref|YP_002812699.1| seryl-tRNA synthetase [Bacillus anthracis str. CDC 684]
 gi|228912755|ref|ZP_04076404.1| Seryl-tRNA synthetase [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228925270|ref|ZP_04088368.1| Seryl-tRNA synthetase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228931519|ref|ZP_04094427.1| Seryl-tRNA synthetase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228943823|ref|ZP_04106210.1| Seryl-tRNA synthetase [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|229089148|ref|ZP_04220432.1| Seryl-tRNA synthetase [Bacillus cereus Rock3-42]
 gi|229119679|ref|ZP_04248942.1| Seryl-tRNA synthetase [Bacillus cereus 95/8201]
 gi|229159191|ref|ZP_04287217.1| Seryl-tRNA synthetase [Bacillus cereus R309803]
 gi|229182411|ref|ZP_04309664.1| Seryl-tRNA synthetase [Bacillus cereus BGSC 6E1]
 gi|229194407|ref|ZP_04321212.1| Seryl-tRNA synthetase [Bacillus cereus m1293]
 gi|229600591|ref|YP_002864668.1| serine--tRNA ligase [Bacillus anthracis str. A0248]
 gi|254686605|ref|ZP_05150464.1| seryl-tRNA synthetase [Bacillus anthracis str. CNEVA-9066]
 gi|254724158|ref|ZP_05185943.1| seryl-tRNA synthetase [Bacillus anthracis str. A1055]
 gi|254737007|ref|ZP_05194712.1| seryl-tRNA synthetase [Bacillus anthracis str. Western North
           America USA6153]
 gi|254744205|ref|ZP_05201886.1| seryl-tRNA synthetase [Bacillus anthracis str. Kruger B]
 gi|254751196|ref|ZP_05203235.1| seryl-tRNA synthetase [Bacillus anthracis str. Vollum]
 gi|301051753|ref|YP_003789964.1| seryl-tRNA synthetase [Bacillus anthracis CI]
 gi|46577221|sp|Q81W25|SYS_BACAN RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|67461763|sp|Q6HPZ8|SYS_BACHK RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|166200600|sp|A0R891|SYS_BACAH RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|226701386|sp|B7JJC8|SYS_BACC0 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|254783003|sp|C3P9G2|SYS_BACAA RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|254783004|sp|C3LIY9|SYS_BACAC RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|254783005|sp|C1ES19|SYS_BACC3 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|30253527|gb|AAP24069.1| serine--tRNA ligase [Bacillus anthracis str. Ames]
 gi|47500416|gb|AAT29092.1| seryl-tRNA synthetase [Bacillus anthracis str. 'Ames Ancestor']
 gi|49176978|gb|AAT52354.1| seryl-tRNA synthetase [Bacillus anthracis str. Sterne]
 gi|49329741|gb|AAT60387.1| serine--tRNA ligase (seryl-tRNA synthetase) [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|118415015|gb|ABK83434.1| seryl-tRNA synthetase [Bacillus thuringiensis str. Al Hakam]
 gi|164711032|gb|EDR16598.1| seryl-tRNA synthetase [Bacillus anthracis str. A0488]
 gi|167510285|gb|EDR85688.1| seryl-tRNA synthetase [Bacillus anthracis str. A0193]
 gi|167529500|gb|EDR92250.1| seryl-tRNA synthetase [Bacillus anthracis str. A0442]
 gi|170127497|gb|EDS96371.1| seryl-tRNA synthetase [Bacillus anthracis str. A0389]
 gi|170667163|gb|EDT17924.1| seryl-tRNA synthetase [Bacillus anthracis str. A0465]
 gi|172080026|gb|EDT65126.1| seryl-tRNA synthetase [Bacillus anthracis str. A0174]
 gi|190559559|gb|EDV13552.1| seryl-tRNA synthetase [Bacillus anthracis Tsiankovskii-I]
 gi|195991017|gb|EDX54988.1| seryl-tRNA synthetase [Bacillus cereus W]
 gi|196021476|gb|EDX60179.1| seryl-tRNA synthetase [Bacillus cereus 03BB108]
 gi|218539339|gb|ACK91737.1| seryl-tRNA synthetase [Bacillus cereus AH820]
 gi|225785776|gb|ACO25993.1| serine--tRNA ligase [Bacillus cereus 03BB102]
 gi|227004875|gb|ACP14618.1| serine--tRNA ligase [Bacillus anthracis str. CDC 684]
 gi|228589063|gb|EEK47076.1| Seryl-tRNA synthetase [Bacillus cereus m1293]
 gi|228601057|gb|EEK58624.1| Seryl-tRNA synthetase [Bacillus cereus BGSC 6E1]
 gi|228624272|gb|EEK81072.1| Seryl-tRNA synthetase [Bacillus cereus R309803]
 gi|228663770|gb|EEL19347.1| Seryl-tRNA synthetase [Bacillus cereus 95/8201]
 gi|228694189|gb|EEL47868.1| Seryl-tRNA synthetase [Bacillus cereus Rock3-42]
 gi|228815847|gb|EEM62081.1| Seryl-tRNA synthetase [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228828137|gb|EEM73863.1| Seryl-tRNA synthetase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228834384|gb|EEM79923.1| Seryl-tRNA synthetase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228846882|gb|EEM91885.1| Seryl-tRNA synthetase [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|229264999|gb|ACQ46636.1| serine--tRNA ligase [Bacillus anthracis str. A0248]
 gi|300373922|gb|ADK02826.1| seryl-tRNA synthetase [Bacillus cereus biovar anthracis str. CI]
 gi|324324006|gb|ADY19266.1| seryl-tRNA synthetase [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 424

 Score =  438 bits (1126), Expect = e-121,   Method: Composition-based stats.
 Identities = 188/426 (44%), Positives = 268/426 (62%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+++R N E +   L+ R  +         LD + R L+ + E+++++RN  S QI 
Sbjct: 1   MLDIKFLRTNFEEVKAKLQHRGEDLTDFGRFEELDTRRRELLVQTEELKSKRNEVSQQIS 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      +AL  E   + E++  L+ E   V   L++L+  IPN+P E  P+G + 
Sbjct: 61  VLKREKK--DAEALILEMREVGEKVKDLDNELRTVEEDLERLMLSIPNIPHESAPVGETE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N++ R+ G+        + H+++   LG++DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 DDNVVARTWGEVKEFAFEPKPHWDLATDLGILDFERAGKVTGSRFVFYKGAGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLHT EHGY EV  P +V   +M GTGQ+PKF +D F      +  IPT+EV +TN
Sbjct: 179 SFMLDLHTDEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIESEDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           ++  EI+  + LP+R+   +  FRSEAGSAGRDTRG++RQHQF K ELV   + EDS+ E
Sbjct: 239 MHRDEILNKEQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++ + AE +L+ L+L YRV+S+CTGDLGF+A K YD+EVW+     YREISSCS    
Sbjct: 299 LEKLTNDAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVWIPSYGTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R   +   +  HTLNGSG+A+GR + AILENY   DG++ IP VLRPYM 
Sbjct: 359 FQARRANIRFRREPNGKPEHVHTLNGSGLAIGRTVAAILENYQQEDGTIIIPEVLRPYMG 418

Query: 419 NLAVIK 424
              VIK
Sbjct: 419 GKTVIK 424


>gi|260914213|ref|ZP_05920686.1| serine-tRNA ligase [Pasteurella dagmatis ATCC 43325]
 gi|260631846|gb|EEX50024.1| serine-tRNA ligase [Pasteurella dagmatis ATCC 43325]
          Length = 429

 Score =  438 bits (1126), Expect = e-121,   Method: Composition-based stats.
 Identities = 204/431 (47%), Positives = 271/431 (62%), Gaps = 8/431 (1%)

Query: 1   MLDIQWIRQNPEHLDIALK-KRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           M+D   +R N   +   LK KR+ +     +  L+E+ + L  K E ++A RN+ S  IG
Sbjct: 1   MIDPNILRSNLVEVAEKLKVKRNFDLDVALLSELEEQRKSLQVKTETLQAERNARSKNIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           +A A G    + +L  E   +  +L   + +  +V + + ++   IPN+P +EVP+G   
Sbjct: 61  KAKASG--EDISSLLAEVDDMGIELSTTKAKLDDVLAEINQIALSIPNLPADEVPLGKDD 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +EN+ +   G         ++H  +GE L  +DF    KLSG+RF+V+ G +A L RAL 
Sbjct: 119 SENLEVSRWGTPKKFDFEVKDHVTLGENLQGLDFSAGAKLSGSRFAVMKGQIAKLHRALS 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT-----DGRWLIPTSEV 234
           QFM+DLHT EHGYTE   P LV    +YGTGQ+PKF +D+F T          LIPT+EV
Sbjct: 179 QFMLDLHTQEHGYTEAYVPYLVNHATLYGTGQLPKFGEDLFHTNALEGEQPYALIPTAEV 238

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            +TNL   EI++   LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I   E 
Sbjct: 239 PVTNLVRDEILDESELPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQIVAPET 298

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCS 354
           S    E +   AE++L+ L+L YR V LCTGD+GF +CKTYDLEVWL  QN YREISSCS
Sbjct: 299 SMEALEELTGQAEKVLQLLELPYRKVLLCTGDMGFGSCKTYDLEVWLPAQNTYREISSCS 358

Query: 355 TCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR 414
              +FQ+RRM +RYR+   K  +  HTLNGSG+AVGR L+A+LENY NADGSVT+PTVLR
Sbjct: 359 NMWDFQARRMQARYRNKGDKKPRLVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPTVLR 418

Query: 415 PYMNNLAVIKK 425
           PYMN + VI K
Sbjct: 419 PYMNGIEVIGK 429


>gi|319655041|ref|ZP_08009111.1| seryl-tRNA synthetase [Bacillus sp. 2_A_57_CT2]
 gi|317393265|gb|EFV74033.1| seryl-tRNA synthetase [Bacillus sp. 2_A_57_CT2]
          Length = 425

 Score =  438 bits (1126), Expect = e-121,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 265/427 (62%), Gaps = 4/427 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+++R N E +   L+ R  +         LD K R LI + E ++++RN  S Q+ 
Sbjct: 1   MLDIKFLRANFEEVKNKLQHRGEDLTDLGKFEDLDVKRRELIVEAEQLKSKRNEVSQQVA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      D L  E   +  ++  L++E   V   L +L+  IPN+P E VP+G + 
Sbjct: 61  ALKREKQ--DADHLIAEMREVGGKIKALDEELRTVEEELDQLLLSIPNIPHESVPVGETE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+ IR  G+        + H+++   L L+DF+RA+K++G+RF    G  A LERAL 
Sbjct: 119 DDNVEIRKWGEVREFDFEPKPHWDVATDLDLLDFERASKVTGSRFVFYKGLGARLERALF 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLHT EHGY EV  P +V   +M GTGQ+PKF +D F      +  IPT+EV +TN
Sbjct: 179 NFMLDLHTDEHGYKEVLPPYMVNRTSMTGTGQLPKFEEDAFLIESEDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           ++  EI+ +  LP+ +   +  FRSEAGSAGRDTRG++RQHQF K ELV   + E+S+ E
Sbjct: 239 MHREEILNADELPINYAAFSACFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEESYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++   AE++L+ L L YRV+S+CTGDLGF+A K YD+EVW+   N YREISSCS    
Sbjct: 299 LEKLTGHAEKVLQMLGLPYRVMSMCTGDLGFTAAKKYDIEVWIPSYNTYREISSCSNFEG 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R       +  HTLNGSG+A+GR + AILENY  ADGSV IP VLRPYM 
Sbjct: 359 FQARRANIRFRREAKGKPEHVHTLNGSGLAIGRTVAAILENYQQADGSVIIPEVLRPYMG 418

Query: 419 NLAVIKK 425
           N  VIK 
Sbjct: 419 NREVIKP 425


>gi|228905813|ref|ZP_04069712.1| Seryl-tRNA synthetase [Bacillus thuringiensis IBL 200]
 gi|228853821|gb|EEM98579.1| Seryl-tRNA synthetase [Bacillus thuringiensis IBL 200]
          Length = 424

 Score =  438 bits (1126), Expect = e-121,   Method: Composition-based stats.
 Identities = 187/426 (43%), Positives = 266/426 (62%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+++R N E +   L+ R  +         LD + R L+ + E+++++RN  S QI 
Sbjct: 1   MLDIKFLRTNFEEVKAKLQHRGEDLTDFGRFEELDTRRRELLVQTEELKSKRNEVSQQIS 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      +AL  E   + E++   + E   V   L++L+  IPN+P E  P+G + 
Sbjct: 61  VLKREKK--DAEALILEMREVGEKVKDFDNELRTVEEDLERLMLSIPNIPHESAPVGETE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+  R+ G+        + H+++   LG++DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 DDNVEARTWGEVKEFTFEPKPHWDLATDLGILDFERAGKVTGSRFVFYKGAGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLHT EHGY EV  P +V   +M GTGQ+PKF +D F      +  IPT+EV +TN
Sbjct: 179 SFMLDLHTDEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIESEDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           ++  EI+  + LP+R+   +  FRSEAGSAGRDTRG++RQHQF K ELV   + EDS+ E
Sbjct: 239 MHRDEILNKEQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++ + AE +L+ L+L YRV+S+CTGDLGF+A K YD+EVW+     YREISSCS    
Sbjct: 299 LEKLTNDAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVWIPSYGTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R   +   +  HTLNGSG+A+GR + AILENY   DG++ IP VLRPYM 
Sbjct: 359 FQARRANIRFRREPNGKPEHVHTLNGSGLAIGRTVAAILENYQQEDGTIIIPEVLRPYMG 418

Query: 419 NLAVIK 424
              VIK
Sbjct: 419 GKTVIK 424


>gi|293398677|ref|ZP_06642855.1| seryl-tRNA synthetase [Neisseria gonorrhoeae F62]
 gi|291611148|gb|EFF40245.1| seryl-tRNA synthetase [Neisseria gonorrhoeae F62]
          Length = 431

 Score =  438 bits (1126), Expect = e-121,   Method: Composition-based stats.
 Identities = 201/433 (46%), Positives = 276/433 (63%), Gaps = 9/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L +R  +  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLARRGYDFDTARFDALEERRKSVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPPGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-------TTDGRWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F        T   ++LIPT+E
Sbjct: 180 FMLDTHTLQHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVAGSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GFSA KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYGALEEMVGHAENILKALELPYRVITLCTGDMGFSAAKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+ RM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQAHRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIKKE 426
           +PYM  +  ++ +
Sbjct: 419 QPYMGGVTKLEVK 431


>gi|146307407|ref|YP_001187872.1| seryl-tRNA synthetase [Pseudomonas mendocina ymp]
 gi|166223271|sp|A4XUX4|SYS_PSEMY RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|145575608|gb|ABP85140.1| seryl-tRNA synthetase [Pseudomonas mendocina ymp]
          Length = 426

 Score =  438 bits (1126), Expect = e-120,   Method: Composition-based stats.
 Identities = 199/427 (46%), Positives = 270/427 (63%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R     +   L  R          +L+ + + +  + E ++A RNS S  IGQ
Sbjct: 1   MLDSKLVRTQLTEIAERLATRGFALDVARFEALESQRKSVQVRTEQLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    +  L  E   +   L   ++E   + + L  L+  IPN+P E VP+G   +
Sbjct: 61  AKARG--EDIAPLLAEVDQMGSDLEAGKRELDAIQNELDNLLLNIPNLPHESVPVGADED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +   G   S     ++H  +GE  G +DF+ A KLSGARF++L G +A L RAL Q
Sbjct: 119 GNVEVARWGTPRSFDFEIKDHVALGEQHGWLDFETAAKLSGARFALLRGPIARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD----GRWLIPTSEVSL 236
           FMI+LHT EHGY E   P LV+  A+ GTGQ+PKF +D+F          +LIPT+EVSL
Sbjct: 179 FMINLHTGEHGYEEAYTPYLVQAPALQGTGQLPKFEEDLFKIRREDQADLYLIPTAEVSL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+ + EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I     SF
Sbjct: 239 TNIVAGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVEPSKSF 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
              E M + AE +L+ L+L YR ++LCTGD+GFSA KTYDLEVW+  Q+ YREISSCS C
Sbjct: 299 EALEGMTAHAERVLQLLELPYRKLALCTGDMGFSAVKTYDLEVWVPSQDKYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +RYR+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P VL+PY
Sbjct: 359 GDFQARRMQARYRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPEVLKPY 418

Query: 417 MNNLAVI 423
           M  + VI
Sbjct: 419 MGGIEVI 425


>gi|292670501|ref|ZP_06603927.1| serine-tRNA ligase [Selenomonas noxia ATCC 43541]
 gi|292647911|gb|EFF65883.1| serine-tRNA ligase [Selenomonas noxia ATCC 43541]
          Length = 423

 Score =  438 bits (1126), Expect = e-120,   Method: Composition-based stats.
 Identities = 196/425 (46%), Positives = 274/425 (64%), Gaps = 3/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++++R+N + +   LK R           LDE+ R +++ +E+ +ARRN+ S +IG 
Sbjct: 1   MLDMKFVRENLDAVRTMLKNRCNALDLSSFTELDERRRAILQDVEEKKARRNAVSKEIGV 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G     DA   E   L +++  L+++  +V   L++L+  IPN+P  +VPIG    
Sbjct: 61  RKKAG--ESADAAVAEMRELGDEIAALDEDLRDVELKLRELLLQIPNMPKADVPIGADET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN  +R  G   +     + H++IGE LG++D +RA K++GARF    G  A LERA   
Sbjct: 119 ENPEVRRWGTPRTFDFEPQAHWDIGEKLGVLDAERAAKVTGARFMFYKGLGARLERACIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-GRWLIPTSEVSLTNL 239
           FM+DLH  +HGYTE+ AP +V +++M GTGQ+PKFA+DMF       +L+PT+EV  TN 
Sbjct: 179 FMMDLHAEKHGYTEMLAPYIVNEDSMIGTGQLPKFAEDMFKLDGLDYYLVPTAEVPTTNY 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +  EI+E++ LP  +T+    FR+EAGSAGRDTRG++RQHQF K EL+     E S+ E 
Sbjct: 239 HRDEILEAEQLPEYYTSYTACFRAEAGSAGRDTRGLIRQHQFNKVELIKFVTPETSWDEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           ERM+  AE++LK L+L YRV+ LCTGD+ F++ KTYDLEVW+  QN YREISSCS C ++
Sbjct: 299 ERMVEAAEDVLKILELPYRVIQLCTGDMSFTSAKTYDLEVWMPAQNKYREISSCSNCTDY 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N +YR        F HTLNGSGVAVGR + AILEN   ADGSV +P  L PYM  
Sbjct: 359 QARRANIKYRPERGAKPAFLHTLNGSGVAVGRTVAAILENNQQADGSVLVPKALVPYMGG 418

Query: 420 LAVIK 424
           + VI+
Sbjct: 419 VTVIR 423


>gi|254805440|ref|YP_003083661.1| Seryl-tRNA synthetase [Neisseria meningitidis alpha14]
 gi|254668982|emb|CBA07314.1| Seryl-tRNA synthetase [Neisseria meningitidis alpha14]
 gi|325127114|gb|EGC50069.1| seryl-tRNA synthetase [Neisseria meningitidis N1568]
          Length = 431

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 202/433 (46%), Positives = 277/433 (63%), Gaps = 9/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L +R     +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLARRGYNFDTARFDALEERRKSVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E+VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLEAVQKELDAWLLSIPNLPHEDVPFGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-------TTDGRWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F        T   ++LIPT+E
Sbjct: 180 FMLDTHTLQHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYETLEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIKKE 426
           +PYM  +A ++ +
Sbjct: 419 QPYMGGVAKLEVK 431


>gi|83954200|ref|ZP_00962920.1| seryl-tRNA synthetase [Sulfitobacter sp. NAS-14.1]
 gi|83841237|gb|EAP80407.1| seryl-tRNA synthetase [Sulfitobacter sp. NAS-14.1]
          Length = 430

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 208/429 (48%), Positives = 281/429 (65%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP+  D AL +R   P S  +L+LDE  R  I   E  +A +N  S  +G 
Sbjct: 1   MHDIKAIRENPDAFDAALARRGDTPVSAQVLALDEARRAKISAAETAQAEQNKASKLVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+ +  + L+   S  K ++  ++ E  ++ + L  +++ IPN+P ++ P G    
Sbjct: 61  AKAKGDEAEFERLRTLVSDKKAEVTAMQAEAKDLDAQLTDMLARIPNLPADDAPDGADEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G  P+    ++EHFEI      MDF+ A K SGARF +L G +A + RAL Q
Sbjct: 121 DNVEVNRWGDVPAFDFKAKEHFEIASVAASMDFETAAKTSGARFVMLKGAVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMID H  E+G TE   P+LVRDEAMYGT ++PKF DD + TT+G WLIPTSEV+LT   
Sbjct: 181 FMIDTHVDENGLTEHMTPVLVRDEAMYGTDKLPKFGDDSYQTTNGWWLIPTSEVTLTYSV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + +++E  +LP R T     FRSEAGSAGRDT GMLRQHQF K E+VS+T  + S  E +
Sbjct: 241 AGDVLEEAALPRRMTAHTLCFRSEAGSAGRDTSGMLRQHQFEKVEMVSVTHPDQSDDEQK 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML CAE++L+RL + YR V LCTGD+GF A +T+D+E WL GQN YREISS ST G+FQ
Sbjct: 301 RMLRCAEDMLERLGVPYRTVILCTGDMGFGARRTFDIEAWLPGQNAYREISSVSTTGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++  N    +F HTLNGSG+AVGRCLIA+LEN   ADGSV +P VL PY+   
Sbjct: 361 ARRMNARFKPANGGKPQFVHTLNGSGLAVGRCLIAVLENGQQADGSVRLPDVLAPYLGGK 420

Query: 421 AVIKKEHIL 429
             +  +  L
Sbjct: 421 TTLGVDGTL 429


>gi|332535764|ref|ZP_08411506.1| seryl-tRNA synthetase [Pseudoalteromonas haloplanktis ANT/505]
 gi|332034832|gb|EGI71366.1| seryl-tRNA synthetase [Pseudoalteromonas haloplanktis ANT/505]
          Length = 434

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 195/436 (44%), Positives = 271/436 (62%), Gaps = 12/436 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD +++RQ+ E     L  R  E     + +L+EK + L  K ++++++RN+++  IGQ
Sbjct: 1   MLDSKFLRQDIEQTAARLAARGYELDVATVTALEEKRKTLQVKTQELQSQRNASAKAIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G       L +  + L  +L   + E+ EV +++  +   IPN+P E VP G   +
Sbjct: 61  AKAKG--EDAQPLLDAVANLGSELDAAKTEQDEVLAAINDIALAIPNLPDESVPAGKDED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I + G         ++H ++G+ L  +DF+   K+SGARF+V+ G +A + RAL Q
Sbjct: 119 DNVEILTWGTPKKFDFEVKDHVDVGQDLNGLDFEMGVKISGARFTVMRGQVARMHRALTQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT----------TDGRWLIP 230
           FM+D H  ++GYTE+  P LV   ++YGT Q+PKFA D+F T            G  LIP
Sbjct: 179 FMLDTHADKNGYTEMYVPYLVNSASLYGTSQLPKFAGDLFHTLGLVNDDGEQQAGFSLIP 238

Query: 231 TSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT 290
           T+EV LTN    EI +   LP+R     P FRSEAGS GRDTRG++RQHQF K ELV + 
Sbjct: 239 TAEVPLTNSARDEIYDESDLPIRLVAHTPCFRSEAGSYGRDTRGLIRQHQFDKVELVQLV 298

Query: 291 REEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREI 350
           + EDS    E +   AE+IL+ L+L YR V LC GD+GF + KTYDLEVWL  Q+ YREI
Sbjct: 299 KPEDSMATLEELTGHAEQILQALELPYRKVILCMGDMGFGSAKTYDLEVWLPAQDTYREI 358

Query: 351 SSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIP 410
           SSCS   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR L+AILENY  ADG+V +P
Sbjct: 359 SSCSNMADFQARRMQARFRREGVKKPELLHTLNGSGLAVGRTLVAILENYQQADGTVVVP 418

Query: 411 TVLRPYMNNLAVIKKE 426
            VLRPYM  L VI K+
Sbjct: 419 EVLRPYMGGLEVIGKQ 434


>gi|197116508|ref|YP_002136935.1| seryl-tRNA synthetase [Geobacter bemidjiensis Bem]
 gi|238690859|sp|B5E8F6|SYS_GEOBB RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|197085868|gb|ACH37139.1| seryl-tRNA synthetase [Geobacter bemidjiensis Bem]
          Length = 422

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 195/424 (45%), Positives = 271/424 (63%), Gaps = 4/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD ++IR+N E ++  LK R           LD + R L+++ E ++A RN  + +I +
Sbjct: 1   MLDARYIRENLETVEARLKTRGEGVDIALFKELDGRRRELLQQSETLKALRNKVTEEIAR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
                + S     K E   + +Q+  +++    V   L+  +  +PNVP E  PIG S  
Sbjct: 61  L---QDKSQAAERKTEMREVSQQIKGIDESLRSVEEELQNFLLTVPNVPNETTPIGKSEE 117

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+++R+ G+ P+     + H+EIGE LG++DF+R  KL+GARF++  G  A LERAL  
Sbjct: 118 DNVVVRTWGEVPTLSFEPKPHWEIGEGLGILDFERGAKLAGARFTLYRGAGARLERALIN 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDM-FCTTDGRWLIPTSEVSLTNL 239
           +M+DLHT EH Y E+  P +V  E M GTGQ+PKF +D+        +LIPT+EV +TN+
Sbjct: 178 YMLDLHTDEHKYIEMLPPFMVNRECMTGTGQLPKFEEDLFHMEGVDFFLIPTAEVPVTNI 237

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +  EI++   LP+ +    P FR EAGS G+DTRG++RQHQF K ELV  T  EDS+ + 
Sbjct: 238 HRGEILKGSDLPISYVAYTPCFRKEAGSYGKDTRGLIRQHQFNKVELVKFTSPEDSYQQL 297

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           +++L  AEE+L+RL + YRVV LCTGD+GFSA KT+D+EVWL GQN YREISSCS   +F
Sbjct: 298 QKLLGHAEEVLRRLQIPYRVVELCTGDIGFSAAKTFDIEVWLPGQNCYREISSCSCFEDF 357

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR   R+R       +F HTLNGSG+AVGR L+A+LENY  ADGSV IP VLRPYM  
Sbjct: 358 QARRAGIRFRPEEKAKPEFVHTLNGSGLAVGRTLVAVLENYQQADGSVLIPEVLRPYMGG 417

Query: 420 LAVI 423
              I
Sbjct: 418 AERI 421


>gi|312876134|ref|ZP_07736122.1| seryl-tRNA synthetase [Caldicellulosiruptor lactoaceticus 6A]
 gi|311797120|gb|EFR13461.1| seryl-tRNA synthetase [Caldicellulosiruptor lactoaceticus 6A]
          Length = 420

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 199/424 (46%), Positives = 281/424 (66%), Gaps = 4/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD+++IR NPE +   L KR+ +     IL LDEK R L+ ++E ++A +N  S ++ +
Sbjct: 1   MLDLKYIRANPEKVQGGLSKRNKDISIAPILELDEKRRKLLAEVESLKALQNQKSKEVPK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG    V  L NE   L +++  L+    EV   ++K++  IPN+P E VP+G    
Sbjct: 61  LKKEGK--DVTELMNELKELSDKIKELDSRVKEVEDEIEKILLTIPNIPHESVPVGKDDT 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G         + H+EIG +LG++DF+RA+K+SG+RF+   G  A LERAL  
Sbjct: 119 ENVEVRRWGDVRVPDFEVKPHWEIGMSLGILDFERASKVSGSRFTFYRGLGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLH  +HGYTE+  P LV  ++M GTGQ+PKF +D F TTD  +LIPT+EV +TN +
Sbjct: 179 FMLDLHIEKHGYTEIFPPFLVARKSMIGTGQLPKFEEDAFKTTDDYFLIPTAEVPVTNYH 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ + LP+++   +  FR+EAG+AG+DTRG++RQHQF K ELV   + EDS+ E E
Sbjct: 239 REEILKEEDLPIKYVAYSACFRAEAGAAGKDTRGLIRQHQFNKVELVKFAKPEDSYDELE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           ++ + AE++LK L L YRVV LC+GDLGFS+ KTYD+EVW+     Y EISSCS   ++Q
Sbjct: 299 KLTADAEDVLKELGLPYRVVLLCSGDLGFSSAKTYDIEVWMPSYGRYVEISSCSNFESYQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RR N R+R  + K L + HTLNGSG+AVGR + AILEN+   DG+V +P VLR YM   
Sbjct: 359 ARRANIRFRRKDGK-LDYVHTLNGSGLAVGRTVAAILENFQQKDGTVVVPEVLRKYM-GT 416

Query: 421 AVIK 424
            VIK
Sbjct: 417 DVIK 420


>gi|260655870|ref|ZP_05861339.1| serine--tRNA ligase [Jonquetella anthropi E3_33 E1]
 gi|260629486|gb|EEX47680.1| serine--tRNA ligase [Jonquetella anthropi E3_33 E1]
          Length = 430

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 188/429 (43%), Positives = 268/429 (62%), Gaps = 6/429 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++ IR+  + +   LK RH     + IL+LD + R ++ + E+++ARRN  S  +  
Sbjct: 1   MLDLKVIREQTDQVRAWLKARHSTVDLDAILALDGQRRDILGQSEELKARRNEGSKAVAM 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G  +   AL  +   L EQ+  L+ +  +V + + + +  IPN   E VP+G    
Sbjct: 61  AKKSG--ADAAALMEKMKELGEQVKELDDKLADVDTEIGRKLLEIPNKLHETVPLGADER 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G+        + H++IGE  G +D +R  KL+G+RF+VL+G  A LERA+  
Sbjct: 119 ENVEVRRWGEPKKFSFEPKAHWDIGELTGTIDSERGVKLAGSRFTVLSGLGARLERAMAN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT----TDGRWLIPTSEVSL 236
           +M+DLH  + GYTE + PL+V  E M GTGQ+PKFA+D++          WLIPT+EV L
Sbjct: 179 YMLDLHCLKQGYTEYNVPLMVSTETMTGTGQLPKFAEDLYKIGGDDDVPLWLIPTAEVPL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TNL+S E +    LP+  T   P FR EAGS G+D RG++R HQF K E+V +   E S+
Sbjct: 239 TNLHSGETLSEDDLPMYMTAYTPCFRREAGSYGKDVRGIMRLHQFDKVEMVKLCTPETSY 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            E E++ + AE +L+ L L YRV+ LC+GD+GF + KTYD+EVWL  QN YREISSCS C
Sbjct: 299 DELEKLTADAESVLQGLGLPYRVIVLCSGDIGFGSAKTYDVEVWLPSQNCYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
            +FQ+RRMN RYR      L++ H+LNGSG+A+GR ++A++ENY   DGSV IP  L PY
Sbjct: 359 EDFQTRRMNCRYRPAGGGKLRYPHSLNGSGLAIGRAVLAVIENYQQEDGSVVIPDALVPY 418

Query: 417 MNNLAVIKK 425
           M  + VI  
Sbjct: 419 MGGVKVIPP 427


>gi|172056058|ref|YP_001812518.1| seryl-tRNA synthetase [Exiguobacterium sibiricum 255-15]
 gi|229559948|sp|B1YGC4|SYS_EXIS2 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|171988579|gb|ACB59501.1| seryl-tRNA synthetase [Exiguobacterium sibiricum 255-15]
          Length = 425

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 190/426 (44%), Positives = 275/426 (64%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           M+DI+ +RQ+ + +   L  R  +       ++LDEK R LI K E ++A RN  + +I 
Sbjct: 1   MIDIKRLRQDFDAIQEKLAHRGEDLTDMNRFIALDEKRRELIAKTEVLKAERNEATKKIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           +     N    D        + +++  L++E  EV ++L  L+  IPN+P + VPIG++ 
Sbjct: 61  ELKR--NKENADEAIAAMRQVGDEVKALDEELREVEATLNLLLLGIPNIPHDSVPIGSTE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N++IR VG KP+    +  H+++ E L ++D +RA K++G+RF    G  A LERAL 
Sbjct: 119 DDNVVIREVGDKPAFDFEAVPHWDLMEQLKIVDVERAGKVTGSRFVFYRGAGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLH  ++GYTE+  PL+V  ++M GTGQ+PKF +D F   D  +  +PT+EV +TN
Sbjct: 179 NFMMDLHQDKNGYTEILPPLMVNRDSMTGTGQLPKFEEDAFKVEDTNYFLVPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           ++  EI+ +  LP+ +   +  FRSEAGSAGRDTRG++RQHQF K ELV   + E+S+ +
Sbjct: 239 MHRDEILSADQLPIGYAAYSQCFRSEAGSAGRDTRGLIRQHQFNKVELVRFVKPEESYEQ 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E +   AEE+LK L L Y+V+S+CT DLGF+A K YD+EVW+  Q +YREISSCS   +
Sbjct: 299 LELLTGQAEEVLKLLKLPYQVLSMCTADLGFTAAKKYDIEVWMPSQGVYREISSCSNFED 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   R+R   +   +F HTLNGS +AVGR + AILENY  ADGSV IP VLRPYM 
Sbjct: 359 FQARRAQIRFRREANAKPEFVHTLNGSALAVGRTVAAILENYQQADGSVVIPEVLRPYMG 418

Query: 419 NLAVIK 424
            L VI+
Sbjct: 419 GLEVIQ 424


>gi|329298236|ref|ZP_08255572.1| seryl-tRNA synthetase [Plautia stali symbiont]
          Length = 430

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 196/431 (45%), Positives = 269/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + SL+E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVDTLRSLEERRKVLQVETENLQAERNSRSKFIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++     +PN+P +EVP+G   +
Sbjct: 61  AKARG--EDIEPLRQEVNALGERLDAAKAELDTLQNEIRDFALALPNLPADEVPLGKDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN  +   G+        ++H E+GEA+  +DF  A KL+G+RF V+ G +A L RAL Q
Sbjct: 119 ENQEVSRWGQPRQFDFPVKDHVELGEAVKGLDFASAVKLTGSRFIVMQGQIARLHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FMIDLH+ +HGY E   P LV  E +YGTGQ+PKF +D+F T             LIPT+
Sbjct: 179 FMIDLHSQQHGYLETYVPYLVNHETLYGTGQLPKFGEDLFHTKPLGEEAGSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI+E +SLP++ T   P FRSEAGS GRDTRG++R HQF K E+V I   
Sbjct: 239 EVPLTNLVRDEIVEEESLPIKLTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVAP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E S    E ++  AE++L+ L+L YR V LCTGD+GF + KTYDLEVWL  Q+ YREISS
Sbjct: 299 ETSMDALEELVGHAEKVLQLLNLPYRKVLLCTGDMGFGSAKTYDLEVWLPAQDTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R    K  +  HTLNGSG+AVGR L+A+LE Y  ADG + +P V
Sbjct: 359 CSNMWDFQARRMQARCRSKTDKKPRLVHTLNGSGLAVGRTLVAVLEKYQQADGRIAVPDV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMGGLEYI 429


>gi|325130726|gb|EGC53464.1| seryl-tRNA synthetase [Neisseria meningitidis OX99.30304]
 gi|325136667|gb|EGC59267.1| seryl-tRNA synthetase [Neisseria meningitidis M0579]
 gi|325201659|gb|ADY97113.1| seryl-tRNA synthetase [Neisseria meningitidis M01-240149]
 gi|325208606|gb|ADZ04058.1| seryl-tRNA synthetase [Neisseria meningitidis NZ-05/33]
          Length = 431

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 202/433 (46%), Positives = 277/433 (63%), Gaps = 9/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L  R  +  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLAARGYKFDAARFNALEEQRKAVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E+VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLEAVQKELDAWLLSIPNLPHEDVPFGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T         ++LIPT+E
Sbjct: 180 FMLDTHTLKHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDESKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVAGSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYETLEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIKKE 426
           +PYM  +A ++ +
Sbjct: 419 QPYMGGVAKLEVK 431


>gi|292487821|ref|YP_003530696.1| seryl-tRNA synthetase [Erwinia amylovora CFBP1430]
 gi|292899049|ref|YP_003538418.1| seryl-tRNA synthetase [Erwinia amylovora ATCC 49946]
 gi|291198897|emb|CBJ46007.1| seryl-tRNA synthetase [Erwinia amylovora ATCC 49946]
 gi|291553243|emb|CBA20288.1| Seryl-tRNA synthetase [Erwinia amylovora CFBP1430]
          Length = 430

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 200/431 (46%), Positives = 267/431 (61%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + + +E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGYKLDVDTLRAHEERRKVLQVETENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + +S+      IPN+P + VP G   +
Sbjct: 61  AKARG--EDIEPLRQEVNALGERLDAAKAELDTLLTSINDFSMAIPNIPADVVPPGKDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN  I   G         R+H E+GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 ENQEISRWGVPRKFDFTVRDHVELGERAAGLDFAAAVKLTGSRFIVMKGQIALMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY E   P LV   ++YGTGQ+PKF +D+F T             LIPTS
Sbjct: 179 FMLDLHTEQHGYQETYVPYLVNHASLYGTGQLPKFGEDLFHTRPLDEEASSSNYALIPTS 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI+E +SLPL+ T   P FRSEAG+ GRDTRG++R HQF K E+V ITR 
Sbjct: 239 EVPLTNLVRDEILEEESLPLKMTAHTPCFRSEAGAYGRDTRGLIRMHQFDKVEMVHITRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E ++  AE++L+ L+L YR V LCTGD+GF A KTYDLEVWL  Q+ YREISS
Sbjct: 299 EDSMDALEELVGHAEKVLQLLNLPYRKVLLCTGDMGFGAQKTYDLEVWLPAQDTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS  G+FQ+RRM +R R       +  HTLNGSG+AVGR L+A+LENY  ADG + +P V
Sbjct: 359 CSNMGDFQARRMKARCRPKGESKTRLVHTLNGSGLAVGRTLVAVLENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMKGLTFI 429


>gi|326390337|ref|ZP_08211896.1| seryl-tRNA synthetase [Thermoanaerobacter ethanolicus JW 200]
 gi|325993614|gb|EGD52047.1| seryl-tRNA synthetase [Thermoanaerobacter ethanolicus JW 200]
          Length = 423

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 200/426 (46%), Positives = 271/426 (63%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++ IR NPE +  A++ +  +   +  L LDEK R ++ ++E ++ RRN  S  I +
Sbjct: 1   MLDVKRIRNNPEAVRRAVELKGEKADIDRFLELDEKRRQMLVELETLKNRRNVESDNIAK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG       L  E   L +++  +E+E  EV   L++++  IPN+P E VPIG S  
Sbjct: 61  LKREGK--DASDLIAEMKELSDKIKEMEQEVKEVEEELERILWTIPNIPHESVPIGDSDE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ IR  G+        + H+EIGE LG++DF+ A +++G+RF+   G  A LERAL  
Sbjct: 119 DNVEIRRWGEPRKFDFEPKPHWEIGEELGILDFEAAARVTGSRFTFYKGLGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTNL 239
           FM+DLH  +HGYTEV  P +V   +M+GTGQ+PKF +D F      +  IPT+EV +TN+
Sbjct: 179 FMLDLHIEKHGYTEVFPPFMVHRRSMFGTGQLPKFEEDAFKVYGTDYFLIPTAEVPVTNM 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y   II+   LP+     +  FR EAGSAGRDTRG++RQHQF K ELV  T  + S+ E 
Sbjct: 239 YRDTIIDGDKLPIYHCAYSACFRQEAGSAGRDTRGLIRQHQFNKVELVKFTEPDKSYEEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E+M   AEE+L+ L L YRVV++CTGDLGF+A K YD+EVW+     Y EISSCS C +F
Sbjct: 299 EKMTRDAEEVLQALGLPYRVVAICTGDLGFTASKKYDIEVWMPSYGRYVEISSCSNCEDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N +YR  +    ++ HTLNGSGVAVGR   AILENY   DGSV IP VLRPYM  
Sbjct: 359 QARRANIKYRPKDGGKAQYVHTLNGSGVAVGRTFAAILENYQQEDGSVVIPEVLRPYMK- 417

Query: 420 LAVIKK 425
           + VIKK
Sbjct: 418 VDVIKK 423


>gi|218768704|ref|YP_002343216.1| seryl-tRNA synthetase [Neisseria meningitidis Z2491]
 gi|30173212|sp|Q9JT77|SYS_NEIMA RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|121052712|emb|CAM09055.1| seryl-tRNA synthetase [Neisseria meningitidis Z2491]
 gi|319410937|emb|CBY91332.1| seryl-tRNA synthetase (serine-tRNA ligase; SerRS) [Neisseria
           meningitidis WUE 2594]
          Length = 431

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 201/433 (46%), Positives = 277/433 (63%), Gaps = 9/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L +R  +  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLARRGYDFDTARFDALEERRKSVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G         ++ + +K  L     +   V   L   +  IPN+P E+VP G    
Sbjct: 61  LKGQGKHEEAQVAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHEDVPFGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T         ++LIPT+E
Sbjct: 180 FMLDTHTLKHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDESKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVAGSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYETLEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIKKE 426
           +PYM  +A ++ +
Sbjct: 419 QPYMGGVAKLEVK 431


>gi|317047549|ref|YP_004115197.1| seryl-tRNA synthetase [Pantoea sp. At-9b]
 gi|316949166|gb|ADU68641.1| seryl-tRNA synthetase [Pantoea sp. At-9b]
          Length = 430

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 195/431 (45%), Positives = 267/431 (61%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   E + S +E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGFKLDVETLRSHEERRKVLQVETENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + ++     +PN+P +EVP+G    
Sbjct: 61  AKARG--EDIEPLRQEVNVLGERLDAAKAELDALQNEIRDFALALPNLPADEVPLGKDDT 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +   G+        ++H E+GE    +DF  A KL+G+RF V+ G +A L RAL Q
Sbjct: 119 ENLEVARWGEPRQFDFQVKDHVELGELAKGLDFASAVKLTGSRFVVMQGQIARLHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FMIDLHT +HGY E   P LV  + +YGTGQ+PKF +D+F T             LIPT+
Sbjct: 179 FMIDLHTQQHGYLETYVPYLVNHDTLYGTGQLPKFGEDLFHTKPLDEEAGSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI+E ++LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I   
Sbjct: 239 EVPLTNLVRDEIVEEENLPIKLTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVAP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E S    E ++  AE++L+ L+L YR V LCTGD+GF + KTYDLEVWL  QN YREISS
Sbjct: 299 ETSMQALEELVGHAEKVLQLLNLPYRKVLLCTGDMGFGSTKTYDLEVWLPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R    K  +  HTLNGSG+AVGR L+A+LENY  ADG + +P V
Sbjct: 359 CSNMWDFQARRMQARCRSKTEKKPRLLHTLNGSGLAVGRTLVAVLENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  +  I
Sbjct: 419 LRPYMGGIEFI 429


>gi|228989226|ref|ZP_04149220.1| Seryl-tRNA synthetase [Bacillus pseudomycoides DSM 12442]
 gi|228995409|ref|ZP_04155080.1| Seryl-tRNA synthetase [Bacillus mycoides Rock3-17]
 gi|229003023|ref|ZP_04160881.1| Seryl-tRNA synthetase [Bacillus mycoides Rock1-4]
 gi|228758223|gb|EEM07410.1| Seryl-tRNA synthetase [Bacillus mycoides Rock1-4]
 gi|228764335|gb|EEM13211.1| Seryl-tRNA synthetase [Bacillus mycoides Rock3-17]
 gi|228770501|gb|EEM19071.1| Seryl-tRNA synthetase [Bacillus pseudomycoides DSM 12442]
          Length = 424

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 188/426 (44%), Positives = 267/426 (62%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+++R N E +   L+ R  +         LD + R L+ + E+++++RN  S QI 
Sbjct: 1   MLDIKFLRANFEEVKAKLQHRGEDLTDFGRFEELDTRRRELLVQTEELKSKRNEVSQQIS 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      +AL  E   + E++   + E   V   L++L+  IPN+P E  PIG + 
Sbjct: 61  VLKREKK--DAEALILEMREVGEKVKDFDNELRIVEEDLERLMLSIPNIPHESAPIGETE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N++ R+ G+        + H+++   LG++DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 DDNVVARTWGEVKEFNFEPKPHWDLATDLGILDFERAAKVTGSRFVFYKGAGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLHT EHGY EV  P +V   +M GTGQ+PKF +D F      +  IPT+EV +TN
Sbjct: 179 SFMLDLHTDEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIESEDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           ++  EI+ S+ LP+R+   +  FRSEAGSAGRDTRG++RQHQF K ELV   + EDS+ E
Sbjct: 239 MHRDEILSSEQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++ + AE +L+ L L YRV+S+CTGDLGF+A K YD+EVW+     YREISSCS    
Sbjct: 299 LEKLTNDAERVLQLLGLPYRVMSMCTGDLGFTAAKKYDIEVWIPSYGTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R   +   +  HTLNGSG+A+GR + A+LENY   DG++ IP VLRPYM 
Sbjct: 359 FQARRANIRFRREPNAKPEPVHTLNGSGLAIGRTVAAVLENYQQEDGTIIIPEVLRPYMG 418

Query: 419 NLAVIK 424
              VIK
Sbjct: 419 GKTVIK 424


>gi|294636937|ref|ZP_06715263.1| serine--tRNA ligase [Edwardsiella tarda ATCC 23685]
 gi|291089855|gb|EFE22416.1| serine--tRNA ligase [Edwardsiella tarda ATCC 23685]
          Length = 430

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 194/431 (45%), Positives = 263/431 (61%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R   + +   L +R  +   + +   +E+ ++L  + E ++A RNS S  IG 
Sbjct: 1   MLDPNLLRNELDAVAEKLARRGYKLDVDTLRQQEERRKVLQVETESLQAERNSRSKSIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E  ++   ++ L   IPN+P + VP+G   N
Sbjct: 61  AKARG--EDIEPLRREVNELGEKLDAAKAELDQLQQEIRDLALSIPNLPDDSVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G+        R+H  +GE    +DF  A KL+GARF V+ G +A + RAL Q
Sbjct: 119 DNLEVSRWGEPRHYDFEVRDHVTLGEMADGLDFAAAVKLTGARFVVMKGQIARMHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY E   P LV  + +YGTGQ+PKF  D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYLETYVPYLVNHDTLYGTGQLPKFGADLFHTRPLEEEADSSTYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV +TNL   EI++   LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I R 
Sbjct: 239 EVPVTNLVRGEILDESELPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E +   AE++L+ L+L YR V LCTGD+GF + KTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEELTGHAEKVLQLLNLPYRKVLLCTGDMGFGSSKTYDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +RYR    K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P V
Sbjct: 359 CSNMWDFQARRMQARYRSKEDKKPRLLHTLNGSGLAVGRTLVAVMENYQQADGRIQVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|163731955|ref|ZP_02139402.1| seryl-tRNA synthetase [Roseobacter litoralis Och 149]
 gi|161395409|gb|EDQ19731.1| seryl-tRNA synthetase [Roseobacter litoralis Och 149]
          Length = 430

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 210/429 (48%), Positives = 285/429 (66%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D AL +R   P S+ IL+LD   R  I   E+ +A +N  S ++GQ
Sbjct: 1   MHDIRAIRENPAAFDAALARRGEAPMSQAILALDTARRAKINAAENAQAEQNKASKEVGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+ +  + L+   S  K  +  ++ +   + + L + +S I N+P ++VP G   +
Sbjct: 61  AKAKGDEATFEQLRALVSEKKALIAQMQADAKTLDAELTEKLSWIANIPADDVPDGADED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G  P      +EH+EIG     MDFD A K SGARF +L G +A + RAL Q
Sbjct: 121 DNVEVRRWGHLPDFEFTPKEHYEIGGVAASMDFDTAAKTSGARFVMLKGAVARIHRALSQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMID H   +G TE+++P+LVRD+AMYGT ++PKFA+D + TT+G WL+ TSE+ LT   
Sbjct: 181 FMIDTHVDHNGLTEINSPVLVRDDAMYGTDKLPKFAEDSYQTTNGWWLVSTSEIPLTYTV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + +I+++ +LP+R T     FRSEAGSAGRDT GMLRQHQF K E+VSIT  + S  E +
Sbjct: 241 AGDILDAAALPIRMTAHTLCFRSEAGSAGRDTAGMLRQHQFEKVEMVSITEPDQSEAEQQ 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML CAE+IL+RL L YR V LCTGD+GF A +T+D+E WL GQN YREISS ST G+FQ
Sbjct: 301 RMLRCAEDILERLGLPYRTVLLCTGDMGFGARRTFDIEAWLPGQNNYREISSVSTTGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RY+  +    +F HTLNGSG+AVGRCLIA+LEN   ADGSV +P VL  Y+   
Sbjct: 361 ARRMNARYKPADGGKPQFVHTLNGSGLAVGRCLIAVLENGQQADGSVVLPPVLASYLGGK 420

Query: 421 AVIKKEHIL 429
            V+  E  L
Sbjct: 421 TVLSAEGTL 429


>gi|325204646|gb|ADZ00100.1| seryl-tRNA synthetase [Neisseria meningitidis M01-240355]
          Length = 431

 Score =  438 bits (1125), Expect = e-120,   Method: Composition-based stats.
 Identities = 202/433 (46%), Positives = 275/433 (63%), Gaps = 9/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L  R  +  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLAARGYDFDTARFDALEERRKSVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A   + + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMVQVAQIKTDLEQTAADLEAVQKELDAWLLSIPNLPHESVPAGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-------TTDGRWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F        T   ++LIPT+E
Sbjct: 180 FMLDTHTLQHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDETKTTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIIPSEQLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYETLEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIKKE 426
           +PYM  +A ++ +
Sbjct: 419 QPYMGGVAKLEVK 431


>gi|312171939|emb|CBX80196.1| Seryl-tRNA synthetase [Erwinia amylovora ATCC BAA-2158]
          Length = 430

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 200/431 (46%), Positives = 267/431 (61%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + + +E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGYKLDVDTLRAHEERRKVLQVETENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + +S+      IPN+P + VP G   +
Sbjct: 61  AKARG--EDIEPLRQEVNALGERLDAAKAELDTLLTSINDFSMAIPNIPADVVPAGKDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN  I   G         R+H E+GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 ENQEISRWGVPRKFDFTVRDHVELGERAAGLDFAAAVKLTGSRFIVMKGQIALMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY E   P LV   ++YGTGQ+PKF +D+F T             LIPTS
Sbjct: 179 FMLDLHTEQHGYQETYVPYLVNHASLYGTGQLPKFGEDLFHTRPLDEEASSSNYALIPTS 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI+E +SLPL+ T   P FRSEAG+ GRDTRG++R HQF K E+V ITR 
Sbjct: 239 EVPLTNLVRDEILEEESLPLKMTAHTPCFRSEAGAYGRDTRGLIRMHQFDKVEMVHITRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E ++  AE++L+ L+L YR V LCTGD+GF A KTYDLEVWL  Q+ YREISS
Sbjct: 299 EDSMDALEELVGHAEKVLQLLNLPYRKVLLCTGDMGFGAQKTYDLEVWLPAQDTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS  G+FQ+RRM +R R       +  HTLNGSG+AVGR L+A+LENY  ADG + +P V
Sbjct: 359 CSNMGDFQARRMKARCRPKGESKTRLVHTLNGSGLAVGRTLVAVLENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMKGLTFI 429


>gi|89073400|ref|ZP_01159924.1| seryl-tRNA synthetase [Photobacterium sp. SKA34]
 gi|89050887|gb|EAR56361.1| seryl-tRNA synthetase [Photobacterium sp. SKA34]
          Length = 435

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 193/434 (44%), Positives = 266/434 (61%), Gaps = 11/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   +     L +R      E + +L+EK + L  K E+++A+RNS S  IGQ
Sbjct: 1   MLDSKLLRTELDETAEKLARRGFNLDVETLRNLEEKRKSLQVKTEELQAQRNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+    + +  E   L  +L   +K   E+ + L  +   +PN+P + VP G   +
Sbjct: 61  AKAKGDHEEAERIMAEVGNLGSELDDAKKALAELQAELDVITQSVPNIPDDSVPAGKDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ I   G+  +     ++H ++GE  G +DF  A K++GARF V+ G  A L RA+ Q
Sbjct: 121 ENVEISRWGEPKAYDFDVKDHVDLGEMAGGLDFASAVKITGARFIVMKGRFARLHRAIAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-----------GRWLI 229
           FM+DLHT EHGYTE+  P LV  ++++GTGQ+PKF +D+F T                LI
Sbjct: 181 FMLDLHTEEHGYTEMYVPYLVNADSLFGTGQLPKFGEDLFHTQPLTEKVNDEEPRVLSLI 240

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV +TN+    I +   LP++ T   P FRSEAGS GRDTRG++R HQF K ELV I
Sbjct: 241 PTAEVPVTNMMRDTITDEADLPVKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQI 300

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
           T+ EDS    E +   AE++L+ L+L YR V LCTGD+GF ACKTYDLEVW+  Q  YRE
Sbjct: 301 TKPEDSMAALEELTGHAEKVLQLLELPYRKVVLCTGDMGFGACKTYDLEVWVPAQETYRE 360

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR ++AILEN   +DG + I
Sbjct: 361 ISSCSNMWDFQARRMQARFRRKGEKKPELLHTLNGSGLAVGRTMVAILENNQQSDGRIEI 420

Query: 410 PTVLRPYMNNLAVI 423
           P VLR YMN +  I
Sbjct: 421 PEVLRKYMNGMTHI 434


>gi|139438647|ref|ZP_01772131.1| Hypothetical protein COLAER_01130 [Collinsella aerofaciens ATCC
           25986]
 gi|133775727|gb|EBA39547.1| Hypothetical protein COLAER_01130 [Collinsella aerofaciens ATCC
           25986]
          Length = 436

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 195/426 (45%), Positives = 279/426 (65%), Gaps = 2/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+++R+NP+ +D+A+  R      E    LD++ R +I ++E+++A RN+ S +IG 
Sbjct: 10  MLDIKFVRENPDAIDVAMANRQTSWDREKFFELDDERRAVITEVEELQATRNAESKKIGA 69

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            + EG     +A K     + E++  L +    +       ++ +PN+P E  P G   +
Sbjct: 70  LMKEGKKDEAEAAKEAVRAVNEKIDGLAERRTALEQEQYDFMAHLPNIPCEATPYGKDED 129

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           ENI  R  G         + H+++G  L ++DF+R  KLSG+RF+VL G  A LERAL  
Sbjct: 130 ENIERRRWGTPREFDFDFKPHWDLGTDLDILDFERGNKLSGSRFTVLGGAGARLERALIN 189

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           F +D HT   G+ E   P++V+ + M+GTGQ+PKF DD +  +   +LIPT+EV LTNL+
Sbjct: 190 FFLDTHT-SRGFKEWWPPIVVKRQTMFGTGQLPKFEDDAYHVSGDNFLIPTAEVVLTNLH 248

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + E++++ +LP R+T   P FR EAGSAGRDTRG++RQH+F K E+V   + E+S  E E
Sbjct: 249 AGEVLDADTLPRRYTAFTPCFREEAGSAGRDTRGIIRQHEFDKVEMVKFAKPEESDEELE 308

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
            M + AE +L++L L YRV+SLCTGDLGFSA +TYD+EVWL   N Y+EISSCS CG+FQ
Sbjct: 309 SMTAEAEYLLQQLGLPYRVISLCTGDLGFSARQTYDVEVWLPSYNAYKEISSCSNCGDFQ 368

Query: 361 SRRMNSRYRDPNS-KSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           +RR N +YRDP + K  ++ HTLNGSG+  GR + AILENY NADG++TIP VLRPYM  
Sbjct: 369 ARRANIKYRDPENFKGSRYLHTLNGSGLPAGRTMAAILENYQNADGTITIPEVLRPYMGG 428

Query: 420 LAVIKK 425
           L  I+ 
Sbjct: 429 LEKIEP 434


>gi|226309605|ref|YP_002769499.1| seryl-tRNA synthetase [Brevibacillus brevis NBRC 100599]
 gi|254783010|sp|C0ZH54|SYS_BREBN RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|226092553|dbj|BAH40995.1| seryl-tRNA synthetase [Brevibacillus brevis NBRC 100599]
          Length = 426

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 180/428 (42%), Positives = 273/428 (63%), Gaps = 4/428 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQ-SEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ +RQ+ E +   L  R+ +    +  + +DEK R +I++ E ++ +RN+ S Q+ 
Sbjct: 1   MLDVKVLRQDLEEVKRRLAHRNEDISALDQFVEVDEKRREVIQEAEALKNKRNTVSEQVA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
                 N    D L  E   + E++  L++E  ++   L+ ++  +PN+P E  PIGT+ 
Sbjct: 61  VMKR--NKENADHLIAEMKEVNERIKALDEELRQLDEQLEFILLSLPNLPHESTPIGTTE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N++  + G+  +     + H+E+    G++DF+ A K++G+RF    G  A LERAL 
Sbjct: 119 DDNVIAWTWGEPRAFDFEIKPHWELASQAGILDFETAAKVTGSRFVFYKGLGARLERALM 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLH++EHGY EV  P +V   +M GTGQ+PKF +D F      +  IPT+EV +TN
Sbjct: 179 NFMMDLHSNEHGYEEVIPPFIVNRTSMTGTGQLPKFEEDAFKIEGPDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           ++  EI++   LP  +T  +  FRSEAGSAGRDTRG++RQHQF K ELV   + E+S+ E
Sbjct: 239 MHRDEIMDGADLPRYYTAFSACFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEESYDE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            ++++  AE++L+ L L YRV+S+CTGDLGF+A K +D+EVW+   + YREISSCS   +
Sbjct: 299 LDKLVKNAEKVLQLLGLPYRVLSMCTGDLGFTAAKKFDIEVWIPSGDTYREISSCSNFED 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R       +F HTLNGSG+A+GR + AILENY  ADG++ IP VLRPYM 
Sbjct: 359 FQARRANIRFRRDTKSKPEFVHTLNGSGLAIGRTVAAILENYQEADGAIVIPEVLRPYMG 418

Query: 419 NLAVIKKE 426
            +  I  +
Sbjct: 419 GVDKIAPK 426


>gi|22126673|ref|NP_670096.1| seryl-tRNA synthetase [Yersinia pestis KIM 10]
 gi|45441041|ref|NP_992580.1| seryl-tRNA synthetase [Yersinia pestis biovar Microtus str. 91001]
 gi|51595744|ref|YP_069935.1| seryl-tRNA synthetase [Yersinia pseudotuberculosis IP 32953]
 gi|108806666|ref|YP_650582.1| seryl-tRNA synthetase [Yersinia pestis Antiqua]
 gi|108812762|ref|YP_648529.1| seryl-tRNA synthetase [Yersinia pestis Nepal516]
 gi|145599588|ref|YP_001163664.1| seryl-tRNA synthetase [Yersinia pestis Pestoides F]
 gi|149366636|ref|ZP_01888670.1| seryl-tRNA synthetase [Yersinia pestis CA88-4125]
 gi|153948058|ref|YP_001401558.1| seryl-tRNA synthetase [Yersinia pseudotuberculosis IP 31758]
 gi|162418210|ref|YP_001606120.1| seryl-tRNA synthetase [Yersinia pestis Angola]
 gi|165924544|ref|ZP_02220376.1| seryl-tRNA synthetase [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165938994|ref|ZP_02227547.1| seryl-tRNA synthetase [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166009792|ref|ZP_02230690.1| seryl-tRNA synthetase [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166211248|ref|ZP_02237283.1| seryl-tRNA synthetase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167400076|ref|ZP_02305594.1| seryl-tRNA synthetase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167419704|ref|ZP_02311457.1| seryl-tRNA synthetase [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167424036|ref|ZP_02315789.1| seryl-tRNA synthetase [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|170024906|ref|YP_001721411.1| seryl-tRNA synthetase [Yersinia pseudotuberculosis YPIII]
 gi|186894822|ref|YP_001871934.1| seryl-tRNA synthetase [Yersinia pseudotuberculosis PB1/+]
 gi|218928527|ref|YP_002346402.1| seryl-tRNA synthetase [Yersinia pestis CO92]
 gi|229841348|ref|ZP_04461507.1| Seryl-tRNA synthetase [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229843453|ref|ZP_04463599.1| Seryl-tRNA synthetase [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229895825|ref|ZP_04510995.1| Seryl-tRNA synthetase [Yersinia pestis Pestoides A]
 gi|229903171|ref|ZP_04518284.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Yersinia pestis Nepal516]
 gi|270486966|ref|ZP_06204040.1| serine--tRNA ligase [Yersinia pestis KIM D27]
 gi|294503369|ref|YP_003567431.1| seryl-tRNA synthetase [Yersinia pestis Z176003]
 gi|30173194|sp|Q8ZGC4|SYS_YERPE RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|67461725|sp|Q66CJ9|SYS_YERPS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|123072932|sp|Q1CA85|SYS_YERPA RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|123246327|sp|Q1CGF1|SYS_YERPN RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|166223311|sp|A4TN29|SYS_YERPP RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|166987319|sp|A7FJY0|SYS_YERP3 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|238687315|sp|A9R5V2|SYS_YERPG RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|238688567|sp|B1JRF0|SYS_YERPY RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|238691445|sp|B2KA12|SYS_YERPB RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|21959689|gb|AAM86347.1|AE013883_1 serine tRNA synthetase [Yersinia pestis KIM 10]
 gi|45435900|gb|AAS61457.1| seryl-tRNA synthetase [Yersinia pestis biovar Microtus str. 91001]
 gi|51589026|emb|CAH20644.1| seryl-tRNA synthetase [Yersinia pseudotuberculosis IP 32953]
 gi|108776410|gb|ABG18929.1| seryl-tRNA synthetase [Yersinia pestis Nepal516]
 gi|108778579|gb|ABG12637.1| seryl-tRNA synthetase [Yersinia pestis Antiqua]
 gi|115347138|emb|CAL20031.1| seryl-tRNA synthetase [Yersinia pestis CO92]
 gi|145211284|gb|ABP40691.1| seryl-tRNA synthetase [Yersinia pestis Pestoides F]
 gi|149291010|gb|EDM41085.1| seryl-tRNA synthetase [Yersinia pestis CA88-4125]
 gi|152959553|gb|ABS47014.1| seryl-tRNA synthetase [Yersinia pseudotuberculosis IP 31758]
 gi|162351025|gb|ABX84973.1| seryl-tRNA synthetase [Yersinia pestis Angola]
 gi|165913141|gb|EDR31765.1| seryl-tRNA synthetase [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165923604|gb|EDR40736.1| seryl-tRNA synthetase [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165991188|gb|EDR43489.1| seryl-tRNA synthetase [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166207019|gb|EDR51499.1| seryl-tRNA synthetase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166962445|gb|EDR58466.1| seryl-tRNA synthetase [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167050784|gb|EDR62192.1| seryl-tRNA synthetase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167056885|gb|EDR66648.1| seryl-tRNA synthetase [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169751440|gb|ACA68958.1| seryl-tRNA synthetase [Yersinia pseudotuberculosis YPIII]
 gi|186697848|gb|ACC88477.1| seryl-tRNA synthetase [Yersinia pseudotuberculosis PB1/+]
 gi|229678941|gb|EEO75044.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Yersinia pestis Nepal516]
 gi|229689800|gb|EEO81861.1| Seryl-tRNA synthetase [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229697714|gb|EEO87761.1| Seryl-tRNA synthetase [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229700748|gb|EEO88777.1| Seryl-tRNA synthetase [Yersinia pestis Pestoides A]
 gi|262361409|gb|ACY58130.1| seryl-tRNA synthetase [Yersinia pestis D106004]
 gi|262365054|gb|ACY61611.1| seryl-tRNA synthetase [Yersinia pestis D182038]
 gi|270335470|gb|EFA46247.1| serine--tRNA ligase [Yersinia pestis KIM D27]
 gi|294353828|gb|ADE64169.1| seryl-tRNA synthetase [Yersinia pestis Z176003]
 gi|320015764|gb|ADV99335.1| Seryl-tRNA synthetase [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 430

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 199/431 (46%), Positives = 269/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R   + +   L +R  +   E +   +E+ ++L  + E ++A RNS S QIG 
Sbjct: 1   MLDPNMLRNELDAVAEKLARRGFKLDVEVLRQQEERRKVLQVETESLQAERNSRSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E  ++ + ++ L   IPN+P + VP+G + N
Sbjct: 61  AKARG--EDIEPLRLEVNALGEKLDAAKAELDKLQNEIRDLALSIPNLPDDSVPVGKNEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +NI +   G+        ++H  +GE  G +DF  A KL+GARF V+ G +A + RAL Q
Sbjct: 119 DNIEVSRWGEPRKYDFDVKDHVSLGEMAGGLDFAAAVKLTGARFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY E   P LV    +YGTGQ+PKF +D+F T             LIPT+
Sbjct: 179 FMLDLHTEKHGYLEAYVPYLVNHATLYGTGQLPKFGEDLFHTKPLAEESDNSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI+E  SLPL+ T   P FRSEAGS GRDTRG++R HQF K E+V ITR 
Sbjct: 239 EVPLTNLVRDEILEEDSLPLKLTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQITRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E +   AE++L+ L+L YR V LCTGD+GF + KTYDLEVWL  Q+ YREISS
Sbjct: 299 EDSMAALEELTGHAEKVLQLLELPYRKVLLCTGDMGFGSSKTYDLEVWLPAQDTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +RYR+   +  +  HTLNGSG+AVGR L+A+LENY  ADG + +P V
Sbjct: 359 CSNMWDFQARRMQARYRNKTDRKTRLVHTLNGSGLAVGRTLVAVLENYQQADGRIQVPDV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMGGLEYI 429


>gi|269792616|ref|YP_003317520.1| seryl-tRNA synthetase [Thermanaerovibrio acidaminovorans DSM 6589]
 gi|269100251|gb|ACZ19238.1| seryl-tRNA synthetase [Thermanaerovibrio acidaminovorans DSM 6589]
          Length = 427

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 208/426 (48%), Positives = 277/426 (65%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M+DI+W+R N E     L+ R  +   + +L LDE+ R ++ ++E+I+ARRN  S ++G+
Sbjct: 1   MMDIKWVRDNVEAAREYLRNRRSDFPLDRLLELDERRRQILGEVEEIKARRNEGSKRVGE 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G      AL  +  +L +++  LE E   V   L  L+  +PN P   VP+G    
Sbjct: 61  MKRRG--EDASALMEDMRSLGDRVSQLEAELGSVQGELDDLMLRMPNRPHSTVPVGEDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N ++R+ G+        R H+EIGE LG+MDF+RA +L+ +RF VL G  A LERAL Q
Sbjct: 119 SNPVVRTWGEPRRFDFEPRPHWEIGEILGIMDFERAVRLAESRFVVLKGLGARLERALVQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGRWLIPTSEVSLTNL 239
           +M+DLHT  +G+ EVS P LV    M GTGQ+PKF++D++ C  D  WLIPT+EV LTNL
Sbjct: 179 YMLDLHT-SNGFIEVSPPFLVSSATMTGTGQLPKFSEDLYRCANDDLWLIPTAEVPLTNL 237

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +S EI++  SLPL +T   P FR EAGS GRD +GMLR HQF K ELV I R E+S+ E 
Sbjct: 238 HSGEILDEDSLPLHYTAHTPCFRREAGSYGRDVKGMLRVHQFPKVELVKICRPEESYDEL 297

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E + + AE +LK L L YRVV LCTGD+GF++ KTYD+EVWL  Q  YREISSCS C +F
Sbjct: 298 ESLTASAESVLKGLGLPYRVVCLCTGDMGFASSKTYDIEVWLPSQGCYREISSCSNCEDF 357

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RRMN+RYR       +F HTLNGSG+AVGRCL+AI+EN+   DGS+ IP  L PYM  
Sbjct: 358 QARRMNTRYRPKEGGRPRFVHTLNGSGIAVGRCLLAIVENFQREDGSIEIPEALVPYMGG 417

Query: 420 LAVIKK 425
           +  I  
Sbjct: 418 VREITP 423


>gi|227498855|ref|ZP_03928995.1| seryl-tRNA synthetase [Acidaminococcus sp. D21]
 gi|226904307|gb|EEH90225.1| seryl-tRNA synthetase [Acidaminococcus sp. D21]
          Length = 424

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 201/426 (47%), Positives = 269/426 (63%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++++R+N + +  A+K RH E   +    LD++ R L++++E  ++ RNS SA+I +
Sbjct: 1   MLDLKFVRENLDKVAEAMKNRHTEVDLDAFRKLDQERRDLLQEVEADKSMRNSVSAEISK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G             TL +++   +K+  EV   L+ ++  IPN+P   VP+G    
Sbjct: 61  MKKNG--EDASEKILSMRTLGDKIAETDKKLKEVEQGLRDIMLTIPNMPDASVPVGKDDT 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN  +R  G+        + H+++GE LG++D +RA K+SG RF    G  A LERA+  
Sbjct: 119 ENPEVRKWGEPTHFDFEPKAHWDLGEDLGILDSNRAAKVSGGRFYYYLGLGARLERAVYN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-RWLIPTSEVSLTNL 239
           FM+D HT + GYTEV  P +V  E M GTGQ+PKF +DM+       +LIPT+EV LTN 
Sbjct: 179 FMLDQHTQKDGYTEVIPPYIVNRETMTGTGQLPKFHEDMYRLEGMEMYLIPTAEVPLTNY 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y  EII+   LP+  T   P FR+EAGSAGRDTRG++RQHQF K E+V  T+ EDSF E 
Sbjct: 239 YRDEIIDGAKLPIYLTAFTPCFRAEAGSAGRDTRGLIRQHQFHKVEMVKFTKPEDSFDEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++   AE IL+ L L Y VV LCTGDLGFSA K YD+EVW   QN YREISSCS C +F
Sbjct: 299 EKLTHDAEGILQALGLPYHVVCLCTGDLGFSATKCYDIEVWFPAQNKYREISSCSNCVDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N R+R  +    +F HTLNGSG+AVGR + AILENY  ADGS+ +P VLRPYM  
Sbjct: 359 QARRANIRFRRDSKSKPEFVHTLNGSGLAVGRTVAAILENYQQADGSIVVPEVLRPYM-G 417

Query: 420 LAVIKK 425
             VI K
Sbjct: 418 CDVIAK 423


>gi|330446442|ref|ZP_08310094.1| seryl-tRNA synthetase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328490633|dbj|GAA04591.1| seryl-tRNA synthetase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 435

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 193/434 (44%), Positives = 266/434 (61%), Gaps = 11/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   +     L +R      E + +L+EK + L  K E+++A RNS S  IGQ
Sbjct: 1   MLDSKLLRTELDETAEKLARRGFTLDVETLRNLEEKRKSLQVKTEELQALRNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+    + +  E   L  +L   +K   E+ + L  +   +PN+P + VP+G   +
Sbjct: 61  AKAKGDHEEAERIMAEVGNLGSELDEAKKALAELQAELDVITQSVPNIPDDSVPVGKDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ I   G+  +     ++H ++GE  G +DF  A K++GARF V+ G  A L RA+ Q
Sbjct: 121 ENVEISRWGEPKTYDFEVKDHVDLGEMAGGLDFASAVKITGARFIVMKGQFARLHRAIAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-----------GRWLI 229
           FM+DLHT EHGYTE+  P LV  ++++GTGQ+PKF +D+F T                LI
Sbjct: 181 FMLDLHTEEHGYTEMYVPYLVNADSLFGTGQLPKFGEDLFHTQPLTEKVNDEEPRTLSLI 240

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV +TN+    I +   LP++ T   P FRSEAGS GRDTRG++R HQF K ELV I
Sbjct: 241 PTAEVPVTNMMRDTITDEADLPVKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQI 300

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
           T+ EDS    E +   AE++L+ L+L YR V LCTGD+GF +CKTYDLEVW+  Q  YRE
Sbjct: 301 TKPEDSMAALEELTGHAEKVLQLLELPYRKVVLCTGDMGFGSCKTYDLEVWVPAQETYRE 360

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR ++AILEN   ADG + I
Sbjct: 361 ISSCSNMWDFQARRMQARFRRKGEKKPELLHTLNGSGLAVGRTMVAILENNQQADGRIEI 420

Query: 410 PTVLRPYMNNLAVI 423
           P VLR YMN +  I
Sbjct: 421 PEVLRKYMNGMTHI 434


>gi|238920371|ref|YP_002933886.1| seryl-tRNA synthetase [Edwardsiella ictaluri 93-146]
 gi|259511668|sp|C5BE90|SYS_EDWI9 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|238869940|gb|ACR69651.1| seryl-tRNA synthetase, putative [Edwardsiella ictaluri 93-146]
          Length = 430

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 196/431 (45%), Positives = 264/431 (61%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R   + +   L +R  +   + +   +E+ ++L  + E ++A RNS S  IG 
Sbjct: 1   MLDPNLLRNELDAVAEKLARRGYKLDVDTLRQQEERRKVLQVETESLQAERNSRSKSIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   +   ++ L   IPN+P + VP+G   N
Sbjct: 61  AKARG--EDIEPLRREVNELGEKLDAAKAELDRLQQEIRDLALSIPNLPDDSVPVGRDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N  I   G+  S     R+H  +GE    +DF  A KL+GARF V+ G +A + RAL Q
Sbjct: 119 DNQEICRWGEPRSYNFDVRDHVTLGEMAEGLDFAAAVKLTGARFVVMKGQIARMHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY E   P LV  + +YGTGQ+PKF  D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYLETYVPYLVNHDTLYGTGQLPKFGADLFHTRPLEEEADSSIYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV +TNL   EI+E  +LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I R 
Sbjct: 239 EVPVTNLVRGEILEESALPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E + + AE++L+ L+L YR V LCTGD+GF + KTYDLEVW+  QN YREISS
Sbjct: 299 EDSMAALEELTAHAEKVLQLLNLPYRKVLLCTGDMGFGSSKTYDLEVWVPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +RYR  + K  +  HTLNGSG+AVGR L+A++ENY  ADG + +P  
Sbjct: 359 CSNMWDFQARRMQARYRSKDDKKPRLVHTLNGSGLAVGRTLVAVMENYQQADGRIQVPEA 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|42779094|ref|NP_976341.1| seryl-tRNA synthetase [Bacillus cereus ATCC 10987]
 gi|67461814|sp|Q73FJ3|SYS_BACC1 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|42735009|gb|AAS38949.1| seryl-tRNA synthetase [Bacillus cereus ATCC 10987]
          Length = 424

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 187/426 (43%), Positives = 268/426 (62%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+++R N E +   L+ R  +         LD + R L+ + E+++++RN  S QI 
Sbjct: 1   MLDIKFLRTNFEEVKAKLQHRGEDLTDFGRFEELDTRRRELLVQTEELKSKRNEVSQQIS 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      ++L  E   + E++  L+ E   V   L++L+  IPN+P E  P+G + 
Sbjct: 61  VLKREKK--DAESLILEMREVGEKVKDLDNELRTVEEDLERLMLSIPNIPHESAPVGETE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N++ R+ G+        + H+++   LG++DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 DDNVVARTWGEVKEFAFEPKPHWDLATDLGILDFERAGKVTGSRFVFYKGAGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLHT EHGY EV  P +V   +M GTGQ+PKF +D F      +  IPT+EV +TN
Sbjct: 179 SFMLDLHTDEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIESEDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           ++  EI+  + LP+R+   +  FRSEAGSAGRDTRG++RQHQF K ELV   + EDS+ E
Sbjct: 239 MHRDEILNKEQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++ + AE +L+ L+L YRV+S+CTGDLGF+A K YD+EVW+     YREISSCS    
Sbjct: 299 LEKLXNDAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVWIPSYGTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R   +   +  HTLNGSG+A+GR + AILENY   DG++ IP VLRPYM 
Sbjct: 359 FQARRANIRFRREPNGKPEHVHTLNGSGLAIGRTVAAILENYQQEDGTIIIPEVLRPYMG 418

Query: 419 NLAVIK 424
              VIK
Sbjct: 419 GKTVIK 424


>gi|254761666|ref|ZP_05213684.1| seryl-tRNA synthetase [Bacillus anthracis str. Australia 94]
          Length = 424

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 187/426 (43%), Positives = 267/426 (62%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+++R N E +   L+ R  +         LD + R L+ + E+++++RN  S QI 
Sbjct: 1   MLDIKFLRTNFEEVKAKLQHRGEDLTDFGRFEELDTRRRELLVQTEELKSKRNEVSQQIS 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
                      +AL  E   + E++  L+ E   V   L++L+  IPN+P E  P+G + 
Sbjct: 61  VLKRXKK--DAEALILEMREVGEKVKDLDNELRTVEEDLERLMLSIPNIPHESAPVGETE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N++ R+ G+        + H+++   LG++DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 DDNVVARTWGEVKEFAFEPKPHWDLATDLGILDFERAGKVTGSRFVFYKGAGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLHT EHGY EV  P +V   +M GTGQ+PKF +D F      +  IPT+EV +TN
Sbjct: 179 SFMLDLHTDEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIESEDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           ++  EI+  + LP+R+   +  FRSEAGSAGRDTRG++RQHQF K ELV   + EDS+ E
Sbjct: 239 MHRDEILNKEQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++ + AE +L+ L+L YRV+S+CTGDLGF+A K YD+EVW+     YREISSCS    
Sbjct: 299 LEKLTNDAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVWIPSYGTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R   +   +  HTLNGSG+A+GR + AILENY   DG++ IP VLRPYM 
Sbjct: 359 FQARRANIRFRREPNGKPEHVHTLNGSGLAIGRTVAAILENYQQEDGTIIIPEVLRPYMG 418

Query: 419 NLAVIK 424
              VIK
Sbjct: 419 GKTVIK 424


>gi|283478928|emb|CAY74844.1| serS [Erwinia pyrifoliae DSM 12163]
          Length = 447

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 199/431 (46%), Positives = 268/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + + +E+ ++L  + E+++A RNS S  IGQ
Sbjct: 18  MLDPNLLRNEPDAVAEKLARRGYKLDVDTLRAHEERRKVLQVETENLQAERNSRSKSIGQ 77

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + +S+      IPN+P + VP+G   +
Sbjct: 78  AKARG--EDIEPLRQEVNALGERLDAAKAELDALLTSINDFSMAIPNIPADVVPLGKDDS 135

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN  I   G         R+H E+GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 136 ENQEIGRWGVPRKFDFTVRDHVELGERAAGLDFAAAVKLTGSRFIVMKGQIALMHRALSQ 195

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY E   P LV   ++YGTGQ+PKF +D+F T             LIPTS
Sbjct: 196 FMLDLHTEQHGYQETYVPYLVNHASLYGTGQLPKFGEDLFHTRPLDEEASSSNYALIPTS 255

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI+E +SLPL+ T   P FRSEAG+ GRDTRG++R HQF K E+V +TR 
Sbjct: 256 EVPLTNLVRDEILEEESLPLKMTAHTPCFRSEAGAYGRDTRGLIRMHQFDKVEMVHVTRP 315

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E ++  AE++L+ L+L YR V LCTGD+GF A KTYDLEVWL  Q+ YREISS
Sbjct: 316 EDSMDALEELVGHAEKVLQLLNLPYRKVLLCTGDMGFGAQKTYDLEVWLPAQDTYREISS 375

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS  G+FQ+RRM +R R       +  HTLNGSG+AVGR L+A+LENY  ADG + +P V
Sbjct: 376 CSNMGDFQARRMKARCRPKGETKTRLVHTLNGSGLAVGRTLVAVLENYQQADGRIEVPEV 435

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 436 LRPYMKGLTFI 446


>gi|255318826|ref|ZP_05360052.1| seryl-tRNA synthetase [Acinetobacter radioresistens SK82]
 gi|255304082|gb|EET83273.1| seryl-tRNA synthetase [Acinetobacter radioresistens SK82]
          Length = 423

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 192/425 (45%), Positives = 272/425 (64%), Gaps = 5/425 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M+D + +R N E +++AL KR ++   E   +L+ + + + +K E+++A RN+ + Q+GQ
Sbjct: 1   MIDPKLLRNNIEAVNLALAKRGVQLDVEEWAALEVRRKEIQQKTENLQAERNAGAKQVGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G       +    S + +++   E    E+ + L+     IPN+P E VP G   +
Sbjct: 61  LKKAG--EDASEIMTRMSAIGDEIKAAELALAELQAELETKSMNIPNLPDESVPAGKDES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I + G         ++H ++GE +G ++F+ ATKL+G+RFSVL G LA L+RAL Q
Sbjct: 119 DNVEILTWGTPRQFDFEIKDHTDLGEWMGGLEFETATKLTGSRFSVLKGPLARLQRALTQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT--DGRWLIPTSEVSLTN 238
           FM+D HT ++GYTE   P LV  +++ GTGQ+PKF +D+F        +LIPT+EV +TN
Sbjct: 179 FMLDTHTLKNGYTEAYVPYLVNADSLRGTGQLPKFEEDLFKLQGEKEYYLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
               EII++  LPL++    P FRSEAGS GRDTRG++RQHQF K E+V I + E S   
Sbjct: 239 FVRDEIIDTARLPLKYAAHTPCFRSEAGSYGRDTRGLIRQHQFDKVEMVQIVKPETSMQA 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E + + AE IL+ L L YR + LC GD+GF A KTYDLEVW+  QN YREISSCS  G+
Sbjct: 299 LEELTAHAEGILQALGLPYRKILLCGGDMGFGATKTYDLEVWVPSQNTYREISSCSNMGD 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRM +RYR  + K  +F HTLNGSG+AVGR L+A++ENY  ADGS+ IP VLRPYM 
Sbjct: 359 FQARRMKARYR-VDQKKTEFVHTLNGSGLAVGRTLLAVMENYQRADGSIEIPEVLRPYMG 417

Query: 419 NLAVI 423
               I
Sbjct: 418 GQEFI 422


>gi|74317247|ref|YP_314987.1| seryl-tRNA synthetase [Thiobacillus denitrificans ATCC 25259]
 gi|123611947|sp|Q3SJH9|SYS_THIDA RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|74056742|gb|AAZ97182.1| seryl-tRNA synthetase, class IIa [Thiobacillus denitrificans ATCC
           25259]
          Length = 427

 Score =  437 bits (1124), Expect = e-120,   Method: Composition-based stats.
 Identities = 200/429 (46%), Positives = 271/429 (63%), Gaps = 7/429 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++   +   L  R     +    +L+ + + +  + +D ++RRN+ S QIG 
Sbjct: 1   MLDIQLLRKDAALVAERLAARGFAFDAARFDALEAERKTIQTRTQDAQSRRNTLSKQIGM 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A+  E   L ++L  LE    E+ + L   +  IPN+P E V  G    
Sbjct: 61  LKGKG--EDTTAVMAEVGGLGDELKQLETRLSELQAELNDFLMGIPNLPHESVAPGKDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +   G         R+H ++GE LG +DF  A K++G+RFSV+ G LA L RAL Q
Sbjct: 119 ANVEVSRWGTPRQFDFAVRDHVDLGEGLGQLDFAAAVKITGSRFSVMRGGLARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD----GRWLIPTSEVSL 236
           FM+DLHT+EHGYTEV  P +V  E+M GTGQ+PKF +D+F          +LIPT+EV +
Sbjct: 179 FMLDLHTTEHGYTEVYVPYVVNAESMRGTGQLPKFEEDLFHVPRSDADRLYLIPTAEVPV 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TNL   EI+ +++LPL+F    P FRSEAGS GRDTRGM+RQHQF K ELV + R EDS+
Sbjct: 239 TNLVRDEIVAAEALPLKFVAHTPCFRSEAGSYGRDTRGMIRQHQFDKVELVQMVRPEDSY 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
              E + + AE +L+RL L YR ++LC+GD+GFSA KTYDLEVWL  QN YREISSCS  
Sbjct: 299 AALEGLAAHAETVLQRLGLPYRKMALCSGDMGFSAAKTYDLEVWLPAQNTYREISSCSNF 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
             FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+AILENY NADGS+T+P  LRP+
Sbjct: 359 EAFQARRMQARFREGQGK-PELLHTLNGSGLAVGRTLVAILENYQNADGSITVPEALRPW 417

Query: 417 MNNLAVIKK 425
           M  +  +  
Sbjct: 418 MGGVERLTP 426


>gi|218710023|ref|YP_002417644.1| seryl-tRNA synthetase [Vibrio splendidus LGP32]
 gi|254783502|sp|B7VH19|SYS_VIBSL RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|218323042|emb|CAV19219.1| Seryl-tRNA synthetase [Vibrio splendidus LGP32]
          Length = 435

 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 195/434 (44%), Positives = 265/434 (61%), Gaps = 11/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   +     L +R      E I  L+EK + L  K E+++A RNS S  IGQ
Sbjct: 1   MLDSKLLRAELDETAAKLARRGFPLDVETIRELEEKRKSLQMKTEELQALRNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+    + +  E   L  +L   +    E+ S L+ +   IPN+P  EVP G   +
Sbjct: 61  AKAKGDHEEAERILAEVGNLGAELDQAKVTLAELQSELETITMSIPNLPDAEVPDGKDED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G+  +     ++H ++GE  G +DF  A K+SG+RF V+ G  A L RA+ Q
Sbjct: 121 DNVEVSRWGQPKTYDFEVKDHVDLGEMSGGLDFASAVKISGSRFIVMKGKFARLHRAIAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-----------GRWLI 229
           FM+DLHT EHGYTE+  P LV  +++YGTGQ+PKF +D+F T+               LI
Sbjct: 181 FMLDLHTDEHGYTEMYVPYLVNHDSLYGTGQLPKFGEDLFHTSPLTEQVSDVPLKTLSLI 240

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV +TN+    I +   LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I
Sbjct: 241 PTAEVPVTNMVRDTITDEAELPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQI 300

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
           T+ EDS    E +   AE++L+ L+L YR V LCTGD+GF + KTYDLEVW+  Q  YRE
Sbjct: 301 TKPEDSMAALEELTGHAEKVLQLLELPYRKVILCTGDMGFGSAKTYDLEVWVPAQETYRE 360

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR ++AILEN   ADG + I
Sbjct: 361 ISSCSNMWDFQARRMQARFRRKGEKKPELVHTLNGSGLAVGRTMVAILENNQEADGRIAI 420

Query: 410 PTVLRPYMNNLAVI 423
           PTVL+PYM  +  I
Sbjct: 421 PTVLQPYMGGVTHI 434


>gi|163938025|ref|YP_001642909.1| seryl-tRNA synthetase [Bacillus weihenstephanensis KBAB4]
 gi|229009527|ref|ZP_04166756.1| Seryl-tRNA synthetase [Bacillus mycoides DSM 2048]
 gi|229053863|ref|ZP_04195300.1| Seryl-tRNA synthetase [Bacillus cereus AH603]
 gi|229131024|ref|ZP_04259940.1| Seryl-tRNA synthetase [Bacillus cereus BDRD-ST196]
 gi|229165006|ref|ZP_04292804.1| Seryl-tRNA synthetase [Bacillus cereus AH621]
 gi|163860222|gb|ABY41281.1| seryl-tRNA synthetase [Bacillus weihenstephanensis KBAB4]
 gi|228618458|gb|EEK75485.1| Seryl-tRNA synthetase [Bacillus cereus AH621]
 gi|228652436|gb|EEL08357.1| Seryl-tRNA synthetase [Bacillus cereus BDRD-ST196]
 gi|228721473|gb|EEL72990.1| Seryl-tRNA synthetase [Bacillus cereus AH603]
 gi|228751738|gb|EEM01535.1| Seryl-tRNA synthetase [Bacillus mycoides DSM 2048]
          Length = 424

 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 189/426 (44%), Positives = 269/426 (63%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+++R N E +   L+ R  +         LD + R L+ + E+++++RN  S QI 
Sbjct: 1   MLDIKFLRTNFEEVKAKLQHRGEDLTDFGRFEELDTRRRELLVQTEELKSKRNEVSQQIS 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      +AL  E   + E++  L+ E   V   L++L+  IPN+P E  PIG + 
Sbjct: 61  VLKREKK--DAEALILEMREVGEKVKDLDNELRTVEEDLERLMLSIPNIPHESAPIGETE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N++ R+ G+     +  + H+++   LG++DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 DDNVVARTWGEVKEFTYEPKPHWDLATDLGILDFERAGKVTGSRFVFYKGAGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLHT EHGY EV  P +V   +M GTGQ+PKF +D F      +  IPT+EV +TN
Sbjct: 179 SFMLDLHTDEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIESEDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           ++  EI+  + LP+R+   +  FRSEAGSAGRDTRG++RQHQF K ELV   + EDS+ E
Sbjct: 239 MHRDEIVSKEQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++ + AE +L+ L+L YRV+S+CTGDLGF+A K YD+EVW+     YREISSCS    
Sbjct: 299 LEKLTNDAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVWIPSYGTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R   +   +  HTLNGSG+A+GR + AILENY   DG++ IP VLRPYM 
Sbjct: 359 FQARRANIRFRREPNGKPEHVHTLNGSGLAIGRTVAAILENYQQEDGTIIIPEVLRPYMG 418

Query: 419 NLAVIK 424
              VIK
Sbjct: 419 GKTVIK 424


>gi|328543816|ref|YP_004303925.1| Seryl-tRNA synthetase [polymorphum gilvum SL003B-26A1]
 gi|326413560|gb|ADZ70623.1| Seryl-tRNA synthetase [Polymorphum gilvum SL003B-26A1]
          Length = 426

 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 234/425 (55%), Positives = 308/425 (72%), Gaps = 2/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+WIR N +  D AL +R  E  +E +LSLD+  R  I ++++ + RRN+ S ++G+
Sbjct: 1   MFDIKWIRDNADAFDRALARRGHESAAERLLSLDDARRAHIARLQEAQERRNAASKEVGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +   AL +E + +K  +   E+EE  + +++   ++ IPN+PL+EVP G    
Sbjct: 61  AKASGDEAAAQALIDEVAKIKSFIQQGEEEERRLVAAVDAALAVIPNLPLDEVPDGADET 120

Query: 121 ENILIRSVGKKPSAIHL--SREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
            N++    G+K +       +EHFE+  A   MDF  A KLSG+RF +L G LA LERAL
Sbjct: 121 GNVVHHVWGEKLAFDFDHAPKEHFELAAAEADMDFATAAKLSGSRFVLLKGQLARLERAL 180

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTN 238
           GQFM+DLHT EHGYTEV+ PLLVR +A+YGT Q+PKF +D+F T+   +L+PT+EV LTN
Sbjct: 181 GQFMLDLHTGEHGYTEVAPPLLVRADALYGTSQLPKFEEDLFKTSSDHYLVPTAEVPLTN 240

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           + + EI+    LPLR + L   FRSEAGSAGRD RGMLRQHQF KCELVS+TR EDS +E
Sbjct: 241 MVAGEILGEGDLPLRVSALTHCFRSEAGSAGRDVRGMLRQHQFVKCELVSVTRPEDSLSE 300

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            ERML CAE +L++L LHYRVV+LCTGD+GF++ KTYD+EVWL GQN YREISSCS CG+
Sbjct: 301 LERMLGCAETVLQKLGLHYRVVTLCTGDMGFASQKTYDIEVWLPGQNAYREISSCSVCGD 360

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRMN+RYR  + K+L+  HTLNGSGVAVGR +IA++ENY NADGSVT+P  LRPYMN
Sbjct: 361 FQARRMNARYRLTDGKALRHVHTLNGSGVAVGRAMIAVMENYQNADGSVTVPEALRPYMN 420

Query: 419 NLAVI 423
            +  I
Sbjct: 421 GIERI 425


>gi|312622837|ref|YP_004024450.1| seryl-tRNA synthetase [Caldicellulosiruptor kronotskyensis 2002]
 gi|312203304|gb|ADQ46631.1| seryl-tRNA synthetase [Caldicellulosiruptor kronotskyensis 2002]
          Length = 420

 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 199/424 (46%), Positives = 282/424 (66%), Gaps = 4/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD+++IR NPE +   L KR+ +     IL LDE+ R L+ ++E ++A +N  S ++ +
Sbjct: 1   MLDLKYIRANPEKVQEGLSKRNKDISIAPILELDERRRKLLAEVESLKALQNQKSKEVPK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG    V  L NE   L +++  L+ +  EV   ++ ++  IPN+P E VP+G    
Sbjct: 61  LKKEGK--DVTDLMNELKDLSDKIKELDCKVKEVEDEIENILLTIPNIPHESVPVGKDDT 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G+        + H+EIG  LG++DF+RA+K+SG+RF+   G  A LERAL  
Sbjct: 119 ENVEVRRWGEVREPEFEIKPHWEIGINLGILDFERASKVSGSRFTFYRGLGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLH  +HGYTE+  P LV  ++M GTGQ+PKF +D F TTD  +LIPT+EV +TN +
Sbjct: 179 FMLDLHIEKHGYTELFPPFLVVRKSMIGTGQLPKFEEDAFKTTDDYFLIPTAEVPVTNYH 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ + LP+++   +  FR+EAG+AG+DTRG++RQHQF K ELV  T+ EDS+ E E
Sbjct: 239 REEILKEEDLPIKYVAYSACFRAEAGAAGKDTRGLIRQHQFNKVELVKFTKPEDSYDELE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           ++ + AE++LK L L YRVV LC+GDLGFS+ KTYD+EVW+     Y EISSCS   ++Q
Sbjct: 299 KLTADAEDVLKELGLPYRVVLLCSGDLGFSSAKTYDIEVWMPSYGRYVEISSCSNFESYQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RR N R+R  + K L + HTLNGSG+AVGR L AILEN+   DG+V +P VLR YM   
Sbjct: 359 ARRANIRFRRKDGK-LDYVHTLNGSGLAVGRTLAAILENFQQKDGTVVVPEVLRKYM-GT 416

Query: 421 AVIK 424
            VIK
Sbjct: 417 DVIK 420


>gi|262378914|ref|ZP_06072071.1| seryl-tRNA synthetase [Acinetobacter radioresistens SH164]
 gi|262300199|gb|EEY88111.1| seryl-tRNA synthetase [Acinetobacter radioresistens SH164]
          Length = 425

 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 192/425 (45%), Positives = 272/425 (64%), Gaps = 5/425 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M+D + +R N E +++AL KR ++   E   +L+ + + + +K E+++A RN+ + Q+GQ
Sbjct: 3   MIDPKLLRNNIEAVNLALAKRGVQLDVEEWAALEVRRKEIQQKTENLQAERNAGAKQVGQ 62

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G       +    S + +++   E    E+ + L+     IPN+P E VP G   +
Sbjct: 63  LKKAG--EDASEIMTRMSAIGDEIKAAELALAELQAELETKSMNIPNLPDESVPAGKDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I + G         ++H ++GE +G ++F+ ATKL+G+RFSVL G LA L+RAL Q
Sbjct: 121 DNVEILTWGTPRQFDFEIKDHTDLGEWMGGLEFETATKLTGSRFSVLKGPLARLQRALTQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT--DGRWLIPTSEVSLTN 238
           FM+D HT ++GYTE   P LV  +++ GTGQ+PKF +D+F        +LIPT+EV +TN
Sbjct: 181 FMLDTHTLKNGYTEAYVPYLVNADSLRGTGQLPKFEEDLFKLQGEKEYYLIPTAEVPVTN 240

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
               EII++  LPL++    P FRSEAGS GRDTRG++RQHQF K E+V I + E S   
Sbjct: 241 FVRDEIIDTARLPLKYAAHTPCFRSEAGSYGRDTRGLIRQHQFDKVEMVQIVKPETSMQA 300

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E + + AE IL+ L L YR + LC GD+GF A KTYDLEVW+  QN YREISSCS  G+
Sbjct: 301 LEELTAHAEGILQALGLPYRKILLCGGDMGFGATKTYDLEVWVPSQNTYREISSCSNMGD 360

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRM +RYR  + K  +F HTLNGSG+AVGR L+A++ENY  ADGS+ IP VLRPYM 
Sbjct: 361 FQARRMKARYR-VDQKKTEFVHTLNGSGLAVGRTLLAVMENYQRADGSIEIPEVLRPYMG 419

Query: 419 NLAVI 423
               I
Sbjct: 420 GQEFI 424


>gi|167036460|ref|YP_001664038.1| seryl-tRNA synthetase [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|167038703|ref|YP_001661688.1| seryl-tRNA synthetase [Thermoanaerobacter sp. X514]
 gi|300913738|ref|ZP_07131055.1| seryl-tRNA synthetase [Thermoanaerobacter sp. X561]
 gi|307723246|ref|YP_003902997.1| seryl-tRNA synthetase [Thermoanaerobacter sp. X513]
 gi|320114885|ref|YP_004185044.1| seryl-tRNA synthetase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|238687557|sp|B0K0Z5|SYS_THEPX RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|238687674|sp|B0KAI8|SYS_THEP3 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|166852943|gb|ABY91352.1| seryl-tRNA synthetase [Thermoanaerobacter sp. X514]
 gi|166855294|gb|ABY93702.1| seryl-tRNA synthetase [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|300890423|gb|EFK85568.1| seryl-tRNA synthetase [Thermoanaerobacter sp. X561]
 gi|307580307|gb|ADN53706.1| seryl-tRNA synthetase [Thermoanaerobacter sp. X513]
 gi|319927976|gb|ADV78661.1| seryl-tRNA synthetase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 423

 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 199/426 (46%), Positives = 270/426 (63%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++ IR NPE + IA++ +  +   +  L LDEK R ++ ++E ++ RRN  S  I +
Sbjct: 1   MLDVKRIRNNPEAVRIAIELKGEKADIDRFLELDEKRRQMLVELETLKNRRNVESDNIAK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG       L  E   L +++  +E+E  EV   L++++  IPN+P E VPIG S  
Sbjct: 61  LKREGK--DASDLIAEMKELSDKIKEMEQEVKEVEEELERILWTIPNIPHESVPIGDSDE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ IR  G+        + H+EIG+ L ++DF+ A +++G+RF+   G  A LERAL  
Sbjct: 119 DNVEIRRWGEPRKFDFEPKPHWEIGQELDILDFEAAARVTGSRFTFYKGLGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTNL 239
           FM+DLH  +HGYTEV  P +V   +M+GTGQ+PKF +D F      +  IPT+EV +TN+
Sbjct: 179 FMLDLHIEKHGYTEVFPPFMVHRRSMFGTGQLPKFEEDAFKVYGTDYFLIPTAEVPVTNM 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y   II+   LP+     +  FR EAGSAGRDTRG++RQHQF K ELV  T  + S+ E 
Sbjct: 239 YRDTIIDGDKLPIYHCAYSACFRQEAGSAGRDTRGLIRQHQFNKVELVKFTEPDKSYEEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E+M   AEE+L+ L L YRVV +CTGDLGF+A K YD+EVW+     Y EISSCS C +F
Sbjct: 299 EKMTRDAEEVLQALGLPYRVVVICTGDLGFTASKKYDIEVWMPSYGRYVEISSCSNCEDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N +YR  +    ++ HTLNGSGVAVGR   AILENY   DGSV IP VLRPYM  
Sbjct: 359 QARRANIKYRPKDGGKAQYVHTLNGSGVAVGRTFAAILENYQQEDGSVVIPEVLRPYMK- 417

Query: 420 LAVIKK 425
           + VIKK
Sbjct: 418 VDVIKK 423


>gi|194288886|ref|YP_002004793.1| seryl-tRNA synthetase [Cupriavidus taiwanensis LMG 19424]
 gi|238692754|sp|B3R376|SYS_CUPTR RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|193222721|emb|CAQ68724.1| serine tRNA synthetase; also charges selenocystein tRNA with serine
           [Cupriavidus taiwanensis LMG 19424]
          Length = 434

 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 198/437 (45%), Positives = 268/437 (61%), Gaps = 15/437 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ  R++ + +   L  R  +       +L+ + + L  + E+++ARRNS S QIG 
Sbjct: 1   MLDIQLFRKDIDAVAQRLATRGFQLDVAAFQALEAERKQLQTQTEELQARRNSLSKQIGM 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A+  E   + + L        E+ + L +L+  IPN+P E VP+G    
Sbjct: 61  LKGKG--EDASAVMAEVGGIGDTLKASAARLDEIQAHLGELMLSIPNLPHESVPVGNDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R VG+        R+H ++GE LG +DFD A K++G+RFS+L G +A L RAL Q
Sbjct: 119 QNVEVRRVGEPRQFDFAVRDHVDVGEKLG-LDFDTAVKVTGSRFSMLRGGMARLHRALVQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-----------GRWLI 229
            M+D HT EHGYTE+  P +V   +M GTGQ+PKF +D+F                 +LI
Sbjct: 178 LMLDTHTQEHGYTEMYVPYIVNAASMRGTGQLPKFEEDLFKVPRKVGSEEGERIENFYLI 237

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV LTN+    I+    LPLRF    P FRSEAGS G+DTRGM+RQHQF K ELV +
Sbjct: 238 PTAEVPLTNIVRDAIVAGDKLPLRFVAHTPCFRSEAGSYGKDTRGMIRQHQFDKVELVQV 297

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
              + SF   E++   AE ILK+L+L +R + LCTGD+GF + KTYDLEVW+  QN YRE
Sbjct: 298 VPADQSFDALEQLTGHAEAILKKLELPFRTIVLCTGDMGFGSTKTYDLEVWIPAQNTYRE 357

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS  G+FQ+RRM +R R    K  +  HTLNGSG+AVGR L+AILENY NADGSVT+
Sbjct: 358 ISSCSNMGDFQARRMQARMRTGQGK-PELVHTLNGSGLAVGRTLVAILENYQNADGSVTV 416

Query: 410 PTVLRPYMNNLAVIKKE 426
           P  L+PYM     ++ E
Sbjct: 417 PAALQPYMGGTTRLEPE 433


>gi|296840775|ref|ZP_06863421.2| serine--tRNA ligase [Neisseria polysaccharea ATCC 43768]
 gi|296839997|gb|EFH23935.1| serine--tRNA ligase [Neisseria polysaccharea ATCC 43768]
          Length = 441

 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 199/433 (45%), Positives = 275/433 (63%), Gaps = 9/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L +R  +  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 11  MLDIQLLRSNTAAVAERLARRGYDFDTARFDALEERRKSVQVKTEELQASRNSISKQIGA 70

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +       A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 71  LKGQSKHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPAGKDET 130

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 131 ENVEVRKVGTPRKFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMRGQIARLHRALAQ 189

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T         ++LIPT+E
Sbjct: 190 FMLDTHTLKHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDESKTTQYLIPTAE 249

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  I++   LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I   E
Sbjct: 250 VTLTNTVADSILDEGGLPLKLTAHSPCFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVHPE 309

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 310 KSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGAAKTYDLEVWVPAQNTYREISSC 369

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 370 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 428

Query: 414 RPYMNNLAVIKKE 426
           +PYM  +A ++ +
Sbjct: 429 QPYMGGVAKLEDK 441


>gi|330810440|ref|YP_004354902.1| Serine--tRNA ligase (seryl-tRNA synthetase) [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327378548|gb|AEA69898.1| Serine--tRNA ligase (seryl-tRNA synthetase) [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 426

 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 274/427 (64%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R N + +   L  R        I +L+E+ + +  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRSNLQDVADRLASRGFALDVARIEALEEQRKTVQTRTEALQAERNARSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G    +  L  +   +  +L   + E   + + L  ++  IPN+P E VP+G    
Sbjct: 61  AKQRG--EDIAPLMADVERMAGELSAGKVELDAIQTELDSILLGIPNLPHESVPVGEDEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G   +     ++H  +GE  G +DF+ A KLSGARF++L G +A L RAL Q
Sbjct: 119 GNVEVRRWGTPKAFDFPVQDHVALGEKFGWLDFETAAKLSGARFALLRGPIARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD----GRWLIPTSEVSL 236
           FMI+LH +EHGY E   P LV+  A+ GTGQ+PKF +D+F  +       +LIPT+EVSL
Sbjct: 179 FMINLHVTEHGYEEAYTPYLVQAPALQGTGQLPKFEEDLFKISREGEADLYLIPTAEVSL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+ + EI+++K LP++F    P FRSEAG++GRDTRGM+RQHQF K E+V I     S 
Sbjct: 239 TNIVAGEIVDAKQLPIKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVEPSKSM 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
              E + + AE++L+ L+L YR ++LCTGD+GFSA KTYDLEVW+  Q+ YREISSCS C
Sbjct: 299 EALESLTANAEKVLQLLELPYRTLALCTGDMGFSAVKTYDLEVWIPSQDKYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P VL+PY
Sbjct: 359 GDFQARRMQARFRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPEVLKPY 418

Query: 417 MNNLAVI 423
           M  + VI
Sbjct: 419 MGGIEVI 425


>gi|307254703|ref|ZP_07536531.1| Seryl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 9
           str. CVJ13261]
 gi|307256921|ref|ZP_07538699.1| Seryl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 10
           str. D13039]
 gi|307259145|ref|ZP_07540875.1| Seryl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 11
           str. 56153]
 gi|306862376|gb|EFM94342.1| Seryl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 9
           str. CVJ13261]
 gi|306864655|gb|EFM96560.1| Seryl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 10
           str. D13039]
 gi|306866812|gb|EFM98670.1| Seryl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 11
           str. 56153]
          Length = 435

 Score =  437 bits (1123), Expect = e-120,   Method: Composition-based stats.
 Identities = 200/436 (45%), Positives = 269/436 (61%), Gaps = 14/436 (3%)

Query: 1   MLDIQWIRQNPEHLDIALK-KRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           M+D   +R N + +  ALK KR      E + +L+EK + L  K E ++A RN+ S  IG
Sbjct: 1   MIDQNLLRTNLDDVANALKVKRGFTLDVERVKALEEKRKALQVKTETLQAERNARSKNIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
            A A G    + AL  E   +  +L   +    +V + +++L+  +PN+P +EVP+G   
Sbjct: 61  AAKARG--EDISALLAEVDNMGNELNEAKVALDQVQAEIRELLLSVPNLPADEVPLGKDD 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            EN+ +   G+        ++H  +GEAL  +DF    KL+ +RF V+ G LA L RAL 
Sbjct: 119 TENLEVSRWGEPRQFDFEVKDHVALGEALNGLDFAAGVKLTASRFVVMKGKLARLHRALS 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-----------GRWL 228
           QFM+DLHT +HGY E + P LV  + ++GTGQ+PKF +D+F T                L
Sbjct: 179 QFMLDLHTEQHGYVETNVPFLVNHDTLFGTGQLPKFGEDLFHTQPLTGQDPNETQRPFSL 238

Query: 229 IPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVS 288
           IPT+EV +TNL   EII+  SLPLR+T   P FRSEAGS GRDTRG++R HQF K E+V 
Sbjct: 239 IPTAEVPVTNLVRDEIIDEDSLPLRYTAHTPCFRSEAGSYGRDTRGLIRMHQFEKVEMVQ 298

Query: 289 ITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYR 348
           I   E S    E +   AE++L+ L L YR V LCTGD+GF + KTYDLEVWL  QN YR
Sbjct: 299 IVAPEKSMEALEELTGHAEKVLQLLGLPYRKVLLCTGDMGFGSAKTYDLEVWLPAQNTYR 358

Query: 349 EISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVT 408
           EISSCS   +FQ+RRM++R +    K  +  HTLNGSG+AVGR L+A+LENY NADGS+T
Sbjct: 359 EISSCSNMWDFQARRMSARCKAKGDKKTRLVHTLNGSGLAVGRTLVAVLENYQNADGSIT 418

Query: 409 IPTVLRPYMNNLAVIK 424
           +P VLRPYM  + VI 
Sbjct: 419 VPEVLRPYMGGVEVIT 434


>gi|209695311|ref|YP_002263240.1| seryl-tRNA synthetase [Aliivibrio salmonicida LFI1238]
 gi|238065094|sp|B6ENN5|SYS_ALISL RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|208009263|emb|CAQ79529.1| seryl-tRNA synthetase [Aliivibrio salmonicida LFI1238]
          Length = 435

 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 193/434 (44%), Positives = 264/434 (60%), Gaps = 11/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   +     L +R  +   E + +L+E+ + L    ED++A+RNS S  IGQ
Sbjct: 1   MLDSKLLRTELDETAEKLARRGFKLDVETLRTLEEQRKSLQVITEDLQAQRNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+    D +  + +TL  +L   +    E+   ++ +   +PN+P E VP G   +
Sbjct: 61  AKAKGDHEEADRIMADVATLGSELDDAKAGLAELQQQIESIALSVPNLPDESVPYGKDED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +   G   +     R+H  +GE    +DF  A K+SG+RF V+ G  A L RAL Q
Sbjct: 121 ENVEVLRWGTPLTYDFEVRDHVALGELADGLDFASAVKISGSRFIVMKGQFARLHRALSQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-----------GRWLI 229
           FM+DLHT EHGY E+  P LV  +++YGTGQ+PKF +D+F T+               LI
Sbjct: 181 FMLDLHTEEHGYMEMYVPYLVNHDSLYGTGQLPKFGEDLFHTSPLTEQVSDVPLKMLSLI 240

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV +TN+    I E   LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I
Sbjct: 241 PTAEVPVTNMVRDTITEEADLPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQI 300

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
           T+ EDS    E +   AE++L+ L+L YR V LCTGD+GF + KTYDLEVW+  Q  YRE
Sbjct: 301 TKPEDSMAALEELTGHAEKVLQLLELPYRKVILCTGDMGFGSRKTYDLEVWVPAQETYRE 360

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR ++AILEN+  ADG + I
Sbjct: 361 ISSCSNMWDFQARRMQARFRRQGEKKPELVHTLNGSGLAVGRTMVAILENFQQADGKIAI 420

Query: 410 PTVLRPYMNNLAVI 423
           P VLR YMN +  I
Sbjct: 421 PEVLRKYMNGVEFI 434


>gi|253698745|ref|YP_003019934.1| seryl-tRNA synthetase [Geobacter sp. M21]
 gi|259511671|sp|C6E7Z3|SYS_GEOSM RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|251773595|gb|ACT16176.1| seryl-tRNA synthetase [Geobacter sp. M21]
          Length = 422

 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 194/424 (45%), Positives = 270/424 (63%), Gaps = 4/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD ++IR+N E ++  LK R           LD + R L+++ E ++A RN  + +I +
Sbjct: 1   MLDARYIRENLETVEARLKTRGEGVDIALFKELDGRRRELLQQSETLKALRNKVTEEIAR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
                + S     K E   + +Q+  +++    V   L+  +  +PNVP E  PIG S  
Sbjct: 61  L---QDKSQAAERKTEMREVSQQIKGIDESLRSVEEELQNFLLTVPNVPNETTPIGRSEE 117

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+++R+ G+ P+     + H+EIGE LG++DF+R  KL+GARF++  G  A LERAL  
Sbjct: 118 DNVVVRTWGEVPALSFEPKPHWEIGEGLGILDFERGAKLAGARFTLYRGAGARLERALIN 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDM-FCTTDGRWLIPTSEVSLTNL 239
           +M+DLH  EH Y E+  P +V  E M GTGQ+PKF +D+        +LIPT+EV +TN+
Sbjct: 178 YMLDLHIDEHKYIEMLPPFMVNRECMTGTGQLPKFEEDLFHMEGVDFFLIPTAEVPVTNI 237

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +  EI++   LP+ +    P FR EAGS G+DTRG++RQHQF K ELV  T  EDS+ + 
Sbjct: 238 HRGEILKGSDLPISYVAYTPCFRKEAGSYGKDTRGLIRQHQFNKVELVKFTSPEDSYEQL 297

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           +++L  AEE+L+RL + YRVV LCTGD+GFSA KT+D+EVWL GQN YREISSCS   +F
Sbjct: 298 QKLLGHAEEVLRRLQIPYRVVELCTGDIGFSAAKTFDIEVWLPGQNCYREISSCSCFEDF 357

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR   R+R       +F HTLNGSG+AVGR L+A+LENY  ADGSV IP VLRPYM  
Sbjct: 358 QARRAGIRFRPEEKAKPEFVHTLNGSGLAVGRTLVAVLENYQQADGSVLIPEVLRPYMGG 417

Query: 420 LAVI 423
              I
Sbjct: 418 AERI 421


>gi|254786029|ref|YP_003073458.1| seryl-tRNA synthetase [Teredinibacter turnerae T7901]
 gi|259516191|sp|C5BIK4|SYS_TERTT RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|237685707|gb|ACR12971.1| serine--tRNA ligase [Teredinibacter turnerae T7901]
          Length = 426

 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 194/425 (45%), Positives = 269/425 (63%), Gaps = 4/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD +  R     +   L KR      E I  L++  +++  + E+++  RN+ S  IG+
Sbjct: 1   MLDPKLFRTQLPEIAAKLAKRGFTLDVERIQQLEDTRKVVQVECENLQQERNTRSKSIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    +  L  E   LK  L   E++   V + L ++I+ +PNV  +EVP G + +
Sbjct: 61  AKAAG--EDIAPLLKEVDNLKSALSEAEQKLGAVQAELDEIIAGVPNVLADEVPEGKNED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         ++H ++G  L  +DF+ A K++G+RF+V+TG +A L RAL Q
Sbjct: 119 DNVEVSQWGTPREFDFEVKDHVDVGAGLKGLDFETAGKITGSRFAVMTGAVARLHRALIQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGR--WLIPTSEVSLTN 238
           FM++ HT EHGY E+  P +V  +++YGTGQ+PKF +D+F   D R  +LIPT+EV +TN
Sbjct: 179 FMLNTHTGEHGYDEIYVPYIVNKDSLYGTGQLPKFEEDLFKLRDDRDFYLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           +   EII+ K LP+RF    P FRSEAGS GRDTRGM+RQHQF K ELV   +  +S   
Sbjct: 239 MMRDEIIDEKQLPVRFACHTPCFRSEAGSYGRDTRGMIRQHQFEKVELVQFVKPGESMAA 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E ++  AE IL++L L YR V LC GD GFS+ KTYDLEVWL  QN YREISSCS  G+
Sbjct: 299 LESLVGHAETILQKLSLPYRKVILCGGDTGFSSTKTYDLEVWLPSQNTYREISSCSNFGD 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRM +RYR+  +   +  HTLNGSG+A+GR L+AILENY  ADGS+ IP VL+P+MN
Sbjct: 359 FQARRMKARYRNAETGKPELLHTLNGSGLAIGRTLVAILENYQQADGSLAIPEVLQPFMN 418

Query: 419 NLAVI 423
               I
Sbjct: 419 GQTSI 423


>gi|50121568|ref|YP_050735.1| seryl-tRNA synthetase [Pectobacterium atrosepticum SCRI1043]
 gi|67461745|sp|Q6D3V0|SYS_ERWCT RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|49612094|emb|CAG75544.1| seryl-tRNA synthetase [Pectobacterium atrosepticum SCRI1043]
          Length = 431

 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 200/432 (46%), Positives = 267/432 (61%), Gaps = 11/432 (2%)

Query: 1   MLDIQWIRQNPEHLDIAL-KKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD   +R   + +   L  +R  +   E +   +E+ ++L  + E ++A RNS S +IG
Sbjct: 1   MLDPNLLRNELDAVAEKLLARRGFKLDVETLRKQEERRKVLQVETESLQAERNSRSKEIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
            A A G    ++ L+ E +TL E+L   + E  ++ + ++ L   IPN+P + VP+G   
Sbjct: 61  AAKARG--EDIEPLRREVNTLGEKLDTAKAELDQLQNEIRDLALTIPNLPDDSVPLGKDE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N  +   G+        R+H E+GE  G +DF  A KL+GARF V+ G +A L RAL 
Sbjct: 119 SQNKEVTRWGEPRKYDFAVRDHVELGEMAGGLDFAAAVKLTGARFVVMKGQIARLHRALA 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPT 231
           QFM+DLHT +HGY E   P LV    +YGTGQ+PKF +D+F T             LIPT
Sbjct: 179 QFMLDLHTQQHGYQEAYVPYLVNHATLYGTGQLPKFGEDLFHTNPLSEEAESSQYALIPT 238

Query: 232 SEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITR 291
           +EV LTNL   EI++ +SLPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I R
Sbjct: 239 AEVPLTNLVRDEILDEESLPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQIVR 298

Query: 292 EEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREIS 351
            EDS    E + + AE +L+ L L YR V LCTGD+GF + KTYDLEVWL  Q+ YREIS
Sbjct: 299 PEDSMQALEELTTHAETVLQLLKLPYRKVLLCTGDMGFGSTKTYDLEVWLPAQDTYREIS 358

Query: 352 SCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPT 411
           SCS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A+LENY  ADG + IP 
Sbjct: 359 SCSNMWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVLENYQQADGRIEIPE 418

Query: 412 VLRPYMNNLAVI 423
           VLRPYM  L  I
Sbjct: 419 VLRPYMGGLEFI 430


>gi|163752526|ref|ZP_02159712.1| seryl-tRNA synthetase [Shewanella benthica KT99]
 gi|161327581|gb|EDP98779.1| seryl-tRNA synthetase [Shewanella benthica KT99]
          Length = 428

 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 198/429 (46%), Positives = 268/429 (62%), Gaps = 8/429 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD ++ R   E     L  R      E +  L+EK + L    E+++A RN+ S  IGQ
Sbjct: 1   MLDPKFFRNELEVTAERLATRGFILDVERLSKLEEKRKSLQMATEELQASRNAISKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G    V  +  +  +L  +L   + E   + + L  +   +PN+P E VP G   +
Sbjct: 61  AKAKG--EDVAPIMAKVGSLGSELDAKKSELSALLAELNVIAMSVPNLPDESVPFGADES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ IR  G         ++H ++GEALG +DF  A K++G+RF ++ G +A + RAL Q
Sbjct: 119 ENVEIRRWGTPKEFSFEVKDHVDLGEALGGLDFKSAVKITGSRFIIMKGQIARMHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG------RWLIPTSEV 234
           FM+DLHT EHGYTEV  PLLV ++++ GT Q+PKF +D+F T           LIPT+EV
Sbjct: 179 FMLDLHTDEHGYTEVYVPLLVNEDSLLGTSQLPKFGEDLFHTKPATEEGQGLSLIPTAEV 238

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            LTN+    II+   LP++ T   P FRSEAGS GRDTRG++RQHQF K ELV + + ED
Sbjct: 239 PLTNMARDTIIDEDELPVKLTAHTPCFRSEAGSYGRDTRGLIRQHQFDKVELVQLVKPED 298

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCS 354
           S    + +   AE +L++L L YR V LCTGD+GF A KTYD+EVWL  Q+ YREISSCS
Sbjct: 299 SMAALDALTGHAETVLQKLALPYRTVILCTGDMGFGASKTYDIEVWLPAQDTYREISSCS 358

Query: 355 TCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR 414
              +FQ+RRM +RY+  ++K     HTLNGSG+AVGR L+A+LENY N DGS+T+P VLR
Sbjct: 359 NMQDFQARRMQARYKAKSAKKPALLHTLNGSGLAVGRTLVAVLENYQNEDGSITVPEVLR 418

Query: 415 PYMNNLAVI 423
           PYMN L  I
Sbjct: 419 PYMNGLEKI 427


>gi|283138943|gb|ADB12546.1| seryl-tRNA synthetase [uncultured bacterium 9F08]
          Length = 428

 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 202/427 (47%), Positives = 273/427 (63%), Gaps = 4/427 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD +  R   +     L +R  E   E I  L+ + + +  + +++++ RN  S  IGQ
Sbjct: 1   MLDPRLFRGELDTTAAQLARRGFELDVEAIARLEAERKAVQVRTQELQSERNQRSKAIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G    V  L +  + L ++L   E+    +   L  ++  +PN+P + VP G S  
Sbjct: 61  AKAKG--EDVQPLLDAVADLGDKLKQAEERLSALQDELCAILMGVPNIPDQSVPDGKSEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +NI +R  G+         +H +IG+ LG +DFD A+KL+G+RF+V++G LA L RAL Q
Sbjct: 119 DNIEVRRWGEPAVFDFEPLDHVDIGQRLGGLDFDAASKLTGSRFAVMSGPLARLHRALIQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT--DGRWLIPTSEVSLTN 238
           FM+DLHT+EHGY E   P +V  +++ GTGQ+PKF +D+F        +LIPT+EV +TN
Sbjct: 179 FMLDLHTTEHGYRETYVPYIVNSDSLRGTGQLPKFEEDLFALQGEHDYYLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L   EIIE+  LPL F    P FRSEAGS GRDTRGM+RQHQF K ELV I   E SF  
Sbjct: 239 LVREEIIEAAQLPLCFAAHTPCFRSEAGSYGRDTRGMIRQHQFEKVELVQIVHPEHSFEA 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E +   AE +L+RL L YR+++LCTGD+GFSACKTYDLEVWL GQ  YREISSCS   +
Sbjct: 299 LEALTGHAEVVLQRLGLPYRLMNLCTGDIGFSACKTYDLEVWLPGQEKYREISSCSNFRD 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRM +R+R P  K  +  HT+NGSG+AVGR L+AILENY  ADGSVT+P  L PYM 
Sbjct: 359 FQARRMQARWRSPEMKKPELVHTVNGSGLAVGRTLVAILENYQQADGSVTVPDALHPYMA 418

Query: 419 NLAVIKK 425
            + V++ 
Sbjct: 419 GIRVLRP 425


>gi|255262643|ref|ZP_05341985.1| seryl-tRNA synthetase [Thalassiobium sp. R2A62]
 gi|255104978|gb|EET47652.1| seryl-tRNA synthetase [Thalassiobium sp. R2A62]
          Length = 430

 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 207/429 (48%), Positives = 272/429 (63%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP   D AL +R   P S  +L LDE  R +I   E  +A +N  S ++G 
Sbjct: 1   MHDIRTIRDNPAAFDAALSRRGDAPMSSQVLELDEARRAMILAAETAQAEQNKASKEVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G+ +  + L+   +  K Q+  L ++     + L  L++ IPN+P E+VP G    
Sbjct: 61  AKGRGDDAEFERLRALVAEKKAQVAQLNEDAKTKDAELTDLLAVIPNLPYEDVPDGADEG 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ I   G   +      EHFEI      MDF+ A K+SG+RF +L+G +A + RA+ Q
Sbjct: 121 YNVEINRWGTPRAFDFKPVEHFEIAGVASSMDFETAAKMSGSRFVLLSGAVARVNRAIAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMID H  ++G  E   P+LVRDEAMYGT ++PKF +D + TT+G WL+PTSEV LT + 
Sbjct: 181 FMIDTHVDKNGLIETVPPVLVRDEAMYGTDKLPKFGEDSYRTTEGMWLVPTSEVPLTYIA 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + E+IE   LP R+T     FRSEAGSAGRDT GMLRQHQF K E+VS+T  + S  E +
Sbjct: 241 AGEMIEQSYLPRRYTAHTLCFRSEAGSAGRDTSGMLRQHQFEKVEMVSVTHPDASDDEQK 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML CAE IL+ L + YR V LCTGD+GF A +TYD+E WL GQ+ YREISS ST G+FQ
Sbjct: 301 RMLGCAEGILEALKIPYRTVILCTGDMGFGARRTYDIEAWLPGQDAYREISSVSTTGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++       +F HTLNGSG+AVGRCLIA+LEN   ADGSVT+P  L PY+   
Sbjct: 361 ARRMNARFKPEGGGKPQFVHTLNGSGLAVGRCLIAVLENGQQADGSVTLPDALAPYLGGK 420

Query: 421 AVIKKEHIL 429
             I  E +L
Sbjct: 421 TSITVEGVL 429


>gi|149241134|pdb|2DQ3|A Chain A, Crystal Structure Of Aq_298
 gi|149241135|pdb|2DQ3|B Chain B, Crystal Structure Of Aq_298
          Length = 425

 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 203/428 (47%), Positives = 280/428 (65%), Gaps = 7/428 (1%)

Query: 2   LDIQWIRQNPEHLDIALKKRHLEP--QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           +DI  IR+ P+++   L  R  E     + +L LD++ R +IK++E +R+ RN  S +IG
Sbjct: 2   IDINLIREKPDYVKERLATRDKELVSLVDKVLELDKRRREIIKRLEALRSERNKLSKEIG 61

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           +   EG  +    ++N    LKE++  LE+E  +V   LK  +  IPN+P   VP+G   
Sbjct: 62  KLKREGKDT--TEIQNRVKELKEEIDRLEEELRKVEEELKNTLLWIPNLPHPSVPVGEDE 119

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            +N+ +R  G+        + H+EIGE LG++DF R  KLSG+RF+V+ G  A LERAL 
Sbjct: 120 KDNVEVRRWGEPRKFDFEPKPHWEIGERLGILDFKRGAKLSGSRFTVIAGWGARLERALI 179

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGRWLIPTSEVSLTN 238
            F +DLHT + GY E+  P LV+ E + GTGQ+PKF +D++ C  D  +LIPT+EV LTN
Sbjct: 180 NFXLDLHT-KKGYKEICPPHLVKPEILIGTGQLPKFEEDLYKCERDNLYLIPTAEVPLTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           LY  EI++ ++LP+  T   P +R EAG+ G+D RG++RQHQF K ELV I   + S+ E
Sbjct: 239 LYREEILKEENLPIYLTAYTPCYRREAGAYGKDIRGIIRQHQFDKVELVKIVHPDTSYDE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+++  AEE+L+ L L YRVV LCTGDLGFSA KTYD+EVW   QN YREISSCS C +
Sbjct: 299 LEKLVKDAEEVLQLLGLPYRVVELCTGDLGFSAAKTYDIEVWFPSQNKYREISSCSNCED 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N+R++D  +   +F HTLNGSG+AVGR L AILENY   DGSV +P VLR Y+ 
Sbjct: 359 FQARRXNTRFKDSKTGKNRFVHTLNGSGLAVGRTLAAILENYQQEDGSVVVPEVLRDYV- 417

Query: 419 NLAVIKKE 426
              VI+ E
Sbjct: 418 GTDVIRPE 425


>gi|229074077|ref|ZP_04207126.1| Seryl-tRNA synthetase [Bacillus cereus Rock4-18]
 gi|229094737|ref|ZP_04225745.1| Seryl-tRNA synthetase [Bacillus cereus Rock3-29]
 gi|229100803|ref|ZP_04231621.1| Seryl-tRNA synthetase [Bacillus cereus Rock3-28]
 gi|229113691|ref|ZP_04243128.1| Seryl-tRNA synthetase [Bacillus cereus Rock1-3]
 gi|228669757|gb|EEL25162.1| Seryl-tRNA synthetase [Bacillus cereus Rock1-3]
 gi|228682610|gb|EEL36669.1| Seryl-tRNA synthetase [Bacillus cereus Rock3-28]
 gi|228688675|gb|EEL42545.1| Seryl-tRNA synthetase [Bacillus cereus Rock3-29]
 gi|228709040|gb|EEL61164.1| Seryl-tRNA synthetase [Bacillus cereus Rock4-18]
          Length = 424

 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 188/426 (44%), Positives = 268/426 (62%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ +R N E +   L+ R  +  +      LD + R L+ + E+++++RN  S QI 
Sbjct: 1   MLDIKLLRTNFEEVKAKLQHRGEDLTEFGRFEELDTRRRELLVQTEELKSKRNEVSQQIS 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      +AL  E   + E++  L+ E   V   L++L+  IPN+P E  P+G + 
Sbjct: 61  VLKREKK--DAEALILEMREVGEKVKDLDNELRTVEEDLERLMLSIPNIPHESAPVGETE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N++ R+ G+        + H+++   LG++DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 DDNVVARTWGEVKEFAFEPKPHWDLATDLGVLDFERAGKVTGSRFVFYKGAGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLHT EHGY EV  P +V   +M GTGQ+PKF +D F      +  IPT+EV +TN
Sbjct: 179 SFMLDLHTDEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIESEDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           ++  EI+  + LP+R+   +  FRSEAGSAGRDTRG++RQHQF K ELV   + EDS+ E
Sbjct: 239 MHRDEILNKEQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++ + AE +L+ L+L YRV+S+CTGDLGF+A K YD+EVW+     YREISSCS    
Sbjct: 299 LEKLTNDAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVWIPSYGTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R   +   +  HTLNGSG+A+GR + AILENY   DG++ IP VLRPYM 
Sbjct: 359 FQARRANIRFRREPNGKPEHVHTLNGSGLAIGRTVAAILENYQQEDGTIIIPEVLRPYMG 418

Query: 419 NLAVIK 424
              VIK
Sbjct: 419 GKTVIK 424


>gi|86147113|ref|ZP_01065430.1| seryl-tRNA synthetase [Vibrio sp. MED222]
 gi|85835178|gb|EAQ53319.1| seryl-tRNA synthetase [Vibrio sp. MED222]
          Length = 435

 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 195/434 (44%), Positives = 265/434 (61%), Gaps = 11/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   +     L +R      E I  L+EK + L  K E+++A RNS S  IGQ
Sbjct: 1   MLDSKLLRAELDETAAKLARRGFTLDVETIRELEEKRKSLQMKTEELQALRNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+    + +  E   L  +L   +    E+ S L+ +   IPN+P  EVP G   +
Sbjct: 61  AKAKGDHEEAERILAEVGNLGAELDQAKVTLAELQSELEAITMSIPNLPDAEVPDGKDED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G+  +     ++H ++GE  G +DF  A K+SG+RF V+ G  A L RA+ Q
Sbjct: 121 DNVEVSRWGQPKTYDFEVKDHVDLGEMSGGLDFASAVKISGSRFIVMKGKFARLHRAIAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-----------GRWLI 229
           FM+DLHT EHGYTE+  P LV  +++YGTGQ+PKF +D+F T+               LI
Sbjct: 181 FMLDLHTDEHGYTEMYVPYLVNHDSLYGTGQLPKFGEDLFHTSPLTEQVSDVPLKTLSLI 240

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV +TN+    I +   LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I
Sbjct: 241 PTAEVPVTNMVRDTITDEAELPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQI 300

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
           T+ EDS    E +   AE++L+ L+L YR V LCTGD+GF + KTYDLEVW+  Q  YRE
Sbjct: 301 TKPEDSMAALEELTGHAEKVLQLLELPYRKVILCTGDMGFGSAKTYDLEVWVPAQETYRE 360

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR ++AILEN   ADG + I
Sbjct: 361 ISSCSNMWDFQARRMQARFRRKGEKKPELVHTLNGSGLAVGRTMVAILENNQEADGRIAI 420

Query: 410 PTVLRPYMNNLAVI 423
           PTVL+PYM  +  I
Sbjct: 421 PTVLQPYMGGVTHI 434


>gi|258544668|ref|ZP_05704902.1| serine--tRNA ligase [Cardiobacterium hominis ATCC 15826]
 gi|258520086|gb|EEV88945.1| serine--tRNA ligase [Cardiobacterium hominis ATCC 15826]
          Length = 426

 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 205/428 (47%), Positives = 274/428 (64%), Gaps = 7/428 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M+D + +RQ+   +   L+ R      +    L++  +    K E ++A RNS SAQIGQ
Sbjct: 1   MIDSKLLRQDAAAIAARLQSRGYTFPLDEYQRLEDARKTAQVKAEQLQATRNSLSAQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G     DAL  + + L  +    E++  E+ ++L  L++ +PN P E VP+G   +
Sbjct: 61  AKKNG--ENADALMAQVAALDSEQKDSEQQYAEIQNALDALLATVPNPPHESVPVGKDED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G         +EH ++      +DFD   KL+GARF+VL G LA L RA+ Q
Sbjct: 119 DNLEVRRWGTPRVFDFPPKEHADLENI--GLDFDAGAKLAGARFTVLRGDLARLHRAIAQ 176

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT---TDGRWLIPTSEVSLT 237
           FM+D HT + GYTE+  P L   +A++GTGQ+PKF +D+F T       +LIPTSEVSLT
Sbjct: 177 FMLDTHTRDEGYTEMYVPYLANAQALFGTGQLPKFEEDLFKTALGERHFYLIPTSEVSLT 236

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           NL +  ++E   LPL +T   P FRSEAGS GRD RGM+RQHQF K E+V I   E S+ 
Sbjct: 237 NLVADSVLEEADLPLYYTAHTPCFRSEAGSHGRDVRGMIRQHQFDKVEMVKIVAPETSYD 296

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E E++ + AE IL++L+L YRVV LCTGD+GFSA KTYDLEVWL GQ  YREISSCS C 
Sbjct: 297 ELEKLTANAENILQKLNLPYRVVLLCTGDMGFSAAKTYDLEVWLPGQGKYREISSCSNCT 356

Query: 358 NFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +FQ+RRM +RYR  +SK  +  HTLNGSG+AVGR L+AILENY NADGS+TIP  L PYM
Sbjct: 357 DFQARRMQARYRPKDSKKPQPVHTLNGSGLAVGRTLVAILENYQNADGSITIPEALLPYM 416

Query: 418 NNLAVIKK 425
             +  I+ 
Sbjct: 417 GGITEIRP 424


>gi|30018290|ref|NP_829921.1| seryl-tRNA synthetase [Bacillus cereus ATCC 14579]
 gi|218233674|ref|YP_002364867.1| seryl-tRNA synthetase [Bacillus cereus B4264]
 gi|228918967|ref|ZP_04082348.1| Seryl-tRNA synthetase [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
 gi|228956457|ref|ZP_04118255.1| Seryl-tRNA synthetase [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|229039921|ref|ZP_04189687.1| Seryl-tRNA synthetase [Bacillus cereus AH676]
 gi|229107702|ref|ZP_04237340.1| Seryl-tRNA synthetase [Bacillus cereus Rock1-15]
 gi|229125533|ref|ZP_04254567.1| Seryl-tRNA synthetase [Bacillus cereus BDRD-Cer4]
 gi|229142822|ref|ZP_04271266.1| Seryl-tRNA synthetase [Bacillus cereus BDRD-ST24]
 gi|229148425|ref|ZP_04276683.1| Seryl-tRNA synthetase [Bacillus cereus m1550]
 gi|296500850|ref|YP_003662550.1| seryl-tRNA synthetase [Bacillus thuringiensis BMB171]
 gi|46577219|sp|Q81JC4|SYS_BACCR RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|226701388|sp|B7HII5|SYS_BACC4 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|29893830|gb|AAP07122.1| Seryl-tRNA synthetase [Bacillus cereus ATCC 14579]
 gi|218161631|gb|ACK61623.1| serine--tRNA ligase [Bacillus cereus B4264]
 gi|228635034|gb|EEK91605.1| Seryl-tRNA synthetase [Bacillus cereus m1550]
 gi|228640636|gb|EEK97022.1| Seryl-tRNA synthetase [Bacillus cereus BDRD-ST24]
 gi|228657917|gb|EEL13721.1| Seryl-tRNA synthetase [Bacillus cereus BDRD-Cer4]
 gi|228675742|gb|EEL30948.1| Seryl-tRNA synthetase [Bacillus cereus Rock1-15]
 gi|228727411|gb|EEL78602.1| Seryl-tRNA synthetase [Bacillus cereus AH676]
 gi|228803214|gb|EEM50034.1| Seryl-tRNA synthetase [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228840682|gb|EEM85942.1| Seryl-tRNA synthetase [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
 gi|296321902|gb|ADH04830.1| seryl-tRNA synthetase [Bacillus thuringiensis BMB171]
          Length = 424

 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 188/426 (44%), Positives = 269/426 (63%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+++R N E +   L+ R  +         LD + R L+ + E+++++RN  S QI 
Sbjct: 1   MLDIKFLRTNFEEVKAKLQHRGEDLTDFGRFEELDTRRRELLVQTEELKSKRNEVSQQIS 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      +AL  E   + E++  L+ E   V   L++L+  IPN+P E  P+G + 
Sbjct: 61  VLKREKK--DAEALILEMREVGEKVKDLDNELRTVEEDLERLMLSIPNIPHESAPVGETE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N++ R+ G+     +  + H+++   LG++DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 DDNVVARTWGEVKEFTYEPKPHWDLATDLGILDFERAGKVTGSRFVFYKGAGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLHT EHGY EV  P +V   +M GTGQ+PKF +D F      +  IPT+EV +TN
Sbjct: 179 SFMLDLHTDEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIESEDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           ++  EI+  + LP+R+   +  FRSEAGSAGRDTRG++RQHQF K ELV   + EDS+ E
Sbjct: 239 MHRDEILNKEQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++ + AE +L+ L+L YRV+S+CTGDLGF+A K YD+EVW+     YREISSCS    
Sbjct: 299 LEKLTNDAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVWIPSYGTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R   +   +  HTLNGSG+A+GR + AILENY   DG++ IP VLRPYM 
Sbjct: 359 FQARRANIRFRREPNGKPEHVHTLNGSGLAIGRTVAAILENYQQEDGTIIIPEVLRPYMG 418

Query: 419 NLAVIK 424
              VIK
Sbjct: 419 GKTVIK 424


>gi|167624137|ref|YP_001674431.1| seryl-tRNA synthetase [Shewanella halifaxensis HAW-EB4]
 gi|189083586|sp|B0TUP4|SYS_SHEHH RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|167354159|gb|ABZ76772.1| seryl-tRNA synthetase [Shewanella halifaxensis HAW-EB4]
          Length = 428

 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 193/429 (44%), Positives = 267/429 (62%), Gaps = 8/429 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD +++R   E     L  R      E +  L++K + L    E+++A RN+ S  IGQ
Sbjct: 1   MLDPKFLRNELEVTAERLATRGFILDVERLGKLEDKRKSLQVATEELQASRNAISKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G    V  +  +  +L E+L   + E   +   L  +   +PN+P E  PIG   +
Sbjct: 61  AKAKG--EDVAPIMAQVGSLGEELDAKKAELASLLDELNSIAMSVPNLPDESAPIGADES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G         ++H E+GE +G +DF  A K++G+RF V+ G +A + RAL Q
Sbjct: 119 ENVEVRRWGTPKEYDFEVKDHVELGENIGGLDFKNAVKITGSRFIVMKGQIARMHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG------RWLIPTSEV 234
           FM+DLHT+EHGYTE   PLLV ++++ GTGQ+PKF +D+F T           LIPT+EV
Sbjct: 179 FMLDLHTTEHGYTEAYVPLLVNEDSLMGTGQLPKFGEDLFHTKPATEEGQGLSLIPTAEV 238

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            LTNL    I++ + LP++ T   P FRSEAGS GRDTRG++RQHQF K ELV + + E+
Sbjct: 239 PLTNLVRDTIVDEEELPIKLTAHTPCFRSEAGSYGRDTRGLIRQHQFDKVELVQLVKPEN 298

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCS 354
           S    E + + AE +L++L L YR V LCTGD+GF + KTYD+EVWL  QN +REISSCS
Sbjct: 299 SMQALEELTAHAETVLQKLGLPYRTVVLCTGDMGFGSSKTYDIEVWLPAQNTFREISSCS 358

Query: 355 TCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR 414
              +FQ+RRM +RY+    K     HTLNGSG+AVGR L+A++ENY NADGS+T+P  LR
Sbjct: 359 NMQDFQARRMQARYKAKTDKKPSLLHTLNGSGLAVGRTLVAVIENYQNADGSITVPEALR 418

Query: 415 PYMNNLAVI 423
            YM  L  I
Sbjct: 419 GYMGGLEKI 427


>gi|332703094|ref|ZP_08423182.1| Seryl-tRNA synthetase [Desulfovibrio africanus str. Walvis Bay]
 gi|332553243|gb|EGJ50287.1| Seryl-tRNA synthetase [Desulfovibrio africanus str. Walvis Bay]
          Length = 426

 Score =  436 bits (1122), Expect = e-120,   Method: Composition-based stats.
 Identities = 196/427 (45%), Positives = 277/427 (64%), Gaps = 3/427 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++++R N + +  AL  R+     ++   LD K R L+ + E +++ RN  S ++ +
Sbjct: 1   MLDLKFLRGNMDLVRQALANRNSSLSLDHFEELDRKRRELLLESETLKSERNKASGEVAR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG      +L  E S   E++ IL+     V   ++  +  IPN+P   VP+G S  
Sbjct: 61  LKREGQ--DAQSLLGELSAKSERIKILDDLLKGVDDEVQGFLLTIPNIPHASVPVGKSEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N ++R+ G+  +     +EH+E+G ALG +DF+RA KL+G+RF VL G  A LERAL  
Sbjct: 119 DNQVVRTWGEPKTFDFTPKEHWELGTALGGLDFERAAKLAGSRFVVLRGWAARLERALAA 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-GRWLIPTSEVSLTNL 239
           FM+D+ T EHGYTE+  P +V  + M GTGQ+PKF +D+F       +LIPT+EV LTNL
Sbjct: 179 FMLDVQTCEHGYTEIVPPYMVNRQTMTGTGQLPKFEEDLFKLEGCDYYLIPTAEVPLTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           ++ E ++   LPL F    P FRSEAGS G+DT+G++R HQF K ELV I   + S+ + 
Sbjct: 239 HADETLDEDKLPLTFCAFTPCFRSEAGSYGKDTKGLVRLHQFHKVELVRIAHPDRSYEDL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E M S AE IL++L L YRV++LCTGD+GFSA KTYDLEVWL GQ  YREISSCS C +F
Sbjct: 299 ELMTSHAETILQKLGLPYRVLALCTGDMGFSATKTYDLEVWLPGQGKYREISSCSNCEDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR   R ++ ++K  + THTLNGSG+AVGR ++A+LENY  ADGS+ +P  L+ YM  
Sbjct: 359 QARRAGIRCKEKSAKKSRLTHTLNGSGLAVGRTMVAVLENYQQADGSILVPEALKSYMGG 418

Query: 420 LAVIKKE 426
           L +I+ E
Sbjct: 419 LDIIRPE 425


>gi|295106322|emb|CBL03865.1| seryl-tRNA synthetase [Gordonibacter pamelaeae 7-10-1-b]
          Length = 429

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 193/430 (44%), Positives = 271/430 (63%), Gaps = 5/430 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+++R N   +  A++ RH    +     LDE  R  I K E ++A RN+ S  IG 
Sbjct: 1   MLDIKYVRDNQAAVAEAMENRHASWDAARFSELDETRRAAIAKEEALQAERNAASKSIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +  G     +A K     + ++L ++ KE      +L+ L+   PN+P +  P+G S +
Sbjct: 61  MMGAGQKDEAEAAKERVRAINDELAVIGKEREAADEALRDLLLATPNMPADSTPVGASED 120

Query: 121 ENILIRSVGKKPSA---IHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
           +N  +R  G            + H+++G  LG++DF+RA KL+ +RF +L G  A LERA
Sbjct: 121 DNPEVRRWGTPRDFAAEGFEMKPHWDLGPELGIIDFERAVKLARSRFILLGGLGARLERA 180

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLT 237
           L  FM D H    GY E   P +   E + GTGQ+PKF +D+F TT+G +LIPT+EV LT
Sbjct: 181 LINFMADTHA-SRGYKEWWCPAMANAETLTGTGQLPKFEEDLFHTTEGLYLIPTAEVQLT 239

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           N+++ E++++  LPL++    P FR EAGSAGRDTRG++R HQF K E+V   + E+SF 
Sbjct: 240 NIHAGEVLDAGQLPLKYCAFTPCFREEAGSAGRDTRGLIRVHQFDKVEMVKYAKPEESFD 299

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           + E M++ AE IL+ L L YRV+SLCTGD+GFSA KTYDLEVWL   N Y+EISSCS C 
Sbjct: 300 DLEAMVADAENILQLLGLPYRVISLCTGDIGFSAAKTYDLEVWLPSYNGYKEISSCSNCT 359

Query: 358 NFQSRRMNSRYRDPNS-KSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           +FQ+RR N +YRDP + K  ++ HTLNGSG+AVGR + A++ENY   DG+V +P VL PY
Sbjct: 360 DFQARRANIKYRDPAAFKGSRYVHTLNGSGLAVGRTMAAVIENYQQPDGTVRVPDVLVPY 419

Query: 417 MNNLAVIKKE 426
           M  + VI  E
Sbjct: 420 MGGVEVIAPE 429


>gi|187776522|ref|ZP_02992995.1| hypothetical protein CLOSPO_00019 [Clostridium sporogenes ATCC
           15579]
 gi|187775181|gb|EDU38983.1| hypothetical protein CLOSPO_00019 [Clostridium sporogenes ATCC
           15579]
          Length = 426

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 187/428 (43%), Positives = 270/428 (63%), Gaps = 6/428 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQS---EYILSLDEKNRILIKKIEDIRARRNSNSAQ 57
           MLD++ IR NP  +  AL  R  +      + +L LDE+ R ++ K+E ++++RN  S++
Sbjct: 1   MLDLKRIRNNPNEIKEALNNRGEKFDVTVIDEVLKLDEERRNILVKVEVLKSKRNQVSSE 60

Query: 58  IGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGT 117
           + +   EG    V  +  E   L E++   +    ++   ++ ++  IPN+P  +VP G 
Sbjct: 61  VPKLKKEGK--DVSNIVAEMKNLSEEIKEFDATLAKIDEKIQYIMLRIPNIPNPQVPDGE 118

Query: 118 SANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
           +  +N+ IR+  +        + H++IG  L ++DF+RA K++G+RF+   G  A LERA
Sbjct: 119 TDEDNVEIRNWSEPTKFDFEPKAHWDIGTNLNILDFERAGKVTGSRFTFYKGLGARLERA 178

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSL 236
           +  + +D HT +HGYTE+  P +V   +M GTGQ+PKF +D F  ++  +  IPT+EV +
Sbjct: 179 VISYFLDTHTEKHGYTEILPPYMVNRTSMIGTGQLPKFEEDAFKISEDDYFLIPTAEVPV 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TNLY  EI++   LPL+    +  FRSEAGSAGRDTRG++RQHQF K ELV  T+ E S+
Sbjct: 239 TNLYRDEILKGDELPLKHVAYSACFRSEAGSAGRDTRGLVRQHQFNKVELVKFTKPEQSY 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            E E++ + AE +LK L + YRVV +C GDLGF+A   YDLEVW+   N Y EISSCS  
Sbjct: 299 EELEKLTNDAETVLKELGIPYRVVRICKGDLGFTAALKYDLEVWMPSYNRYVEISSCSNF 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
            +FQSRR N RY++      ++ HTLNGSGVA+GR + AILENY N DGS+TIP VLRPY
Sbjct: 359 EDFQSRRANIRYKEDAKAKPQYVHTLNGSGVAIGRTVAAILENYQNEDGSITIPEVLRPY 418

Query: 417 MNNLAVIK 424
           M    VIK
Sbjct: 419 MGGREVIK 426


>gi|146282637|ref|YP_001172790.1| seryl-tRNA synthetase [Pseudomonas stutzeri A1501]
 gi|166223273|sp|A4VLU7|SYS_PSEU5 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|145570842|gb|ABP79948.1| seryl-tRNA synthetase [Pseudomonas stutzeri A1501]
          Length = 426

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 198/427 (46%), Positives = 275/427 (64%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R  +     I +L+ + + +  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLVRTQLQDVAARLATRGYQLDVARIEALEAQRKTVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G    +  L  +   +  +L   ++E   + S L +L+  IPN+P + VP+G    
Sbjct: 61  AKQRG--EDIAPLLADVDRMGSELESGKQELDRIQSELDQLMLSIPNLPHDSVPVGADEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G   +     ++H  +GE  G +DF+ A KLSGARF+++ G +A L RAL Q
Sbjct: 119 ENVEVRRWGTPKAFDFPVQDHVALGEQHGWLDFETAAKLSGARFALMRGPIARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD----GRWLIPTSEVSL 236
           FMIDLHT EHGY E   P LV+  A+ GTGQ+PKF DD+F  +       +LIPT+EVSL
Sbjct: 179 FMIDLHTREHGYEEAYTPYLVQAPALQGTGQLPKFEDDLFKISREGEADFYLIPTAEVSL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+ + EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I     SF
Sbjct: 239 TNIVAGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVEPSKSF 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
              E +   AE++L+ L+L YRV+SLCTGD+GF A KTYDLEVW+  Q+ YREISSCS C
Sbjct: 299 EALEELTGNAEKVLQLLELPYRVLSLCTGDMGFGATKTYDLEVWVPSQDKYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +RYR+P +   +  HTLNGSG+AVGR L+A+LENY  ADG + +P VL+PY
Sbjct: 359 GDFQARRMQARYRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGRILVPEVLKPY 418

Query: 417 MNNLAVI 423
           M  + VI
Sbjct: 419 MGGIEVI 425


>gi|303251272|ref|ZP_07337450.1| seryl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|307252495|ref|ZP_07534391.1| Seryl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|302649814|gb|EFL79992.1| seryl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|306860087|gb|EFM92104.1| Seryl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
          Length = 435

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 200/436 (45%), Positives = 268/436 (61%), Gaps = 14/436 (3%)

Query: 1   MLDIQWIRQNPEHLDIALK-KRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           M+D   +R N + +  ALK KR      E + +L+EK + L  K E ++A RN+ S  IG
Sbjct: 1   MIDQNLLRTNLDDVANALKVKRGFTLDVESVKALEEKRKALQVKTETLQAERNARSKNIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
            A A G    + AL  E   +  +L   +    +V   +++L+  +PN+P +EVP+G   
Sbjct: 61  AAKARG--EDISALLAEVDNMGNELNEAKVALDQVQEEIRELLLSVPNLPADEVPLGKDD 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            EN+ +   G+        ++H  +GEAL  +DF    KL+ +RF V+ G LA L RAL 
Sbjct: 119 TENLEVSRWGEPRQFDFEVKDHVALGEALNGLDFAAGVKLTASRFVVMKGKLARLHRALS 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-----------GRWL 228
           QFM+DLHT +HGY E + P LV  + ++GTGQ+PKF +D+F T                L
Sbjct: 179 QFMLDLHTEQHGYVETNVPFLVNHDTLFGTGQLPKFGEDLFHTQPLTGQDPNETQRPFSL 238

Query: 229 IPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVS 288
           IPT+EV +TNL   EII+  SLPLR+T   P FRSEAGS GRDTRG++R HQF K E+V 
Sbjct: 239 IPTAEVPVTNLVRDEIIDEDSLPLRYTAHTPCFRSEAGSYGRDTRGLIRMHQFEKVEMVQ 298

Query: 289 ITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYR 348
           I   E S    E +   AE++L+ L L YR V LCTGD+GF + KTYDLEVWL  QN YR
Sbjct: 299 IVAPEKSMEALEELTGHAEKVLQLLGLPYRKVLLCTGDMGFGSAKTYDLEVWLPAQNTYR 358

Query: 349 EISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVT 408
           EISSCS   +FQ+RRM++R +    K  +  HTLNGSG+AVGR L+A+LENY NADGS+T
Sbjct: 359 EISSCSNMWDFQARRMSARCKAKGDKKTRLVHTLNGSGLAVGRTLVAVLENYQNADGSIT 418

Query: 409 IPTVLRPYMNNLAVIK 424
           +P VLRPYM  + VI 
Sbjct: 419 VPEVLRPYMGGVEVIT 434


>gi|229170865|ref|ZP_04298470.1| Seryl-tRNA synthetase [Bacillus cereus MM3]
 gi|228612600|gb|EEK69817.1| Seryl-tRNA synthetase [Bacillus cereus MM3]
          Length = 424

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 188/426 (44%), Positives = 269/426 (63%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+++R N E +   L+ R  +         LD + R L+ + E+++++RN  S QI 
Sbjct: 1   MLDIKFLRTNFEEVKAKLQHRGEDLTDFGRFEELDTRRRELLVQTEELKSKRNEVSQQIS 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      +AL  E   + E++  L+ E   V   L++L+  IPN+P E  P+G + 
Sbjct: 61  VLKREKK--DAEALILEMREVGEKVKDLDNELRTVEEDLERLMLSIPNIPHESAPVGETE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N++ R+ G+     +  + H+++   LG++DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 DDNVVARTWGEVKEFAYEPKPHWDLATDLGILDFERAGKVTGSRFVFYKGAGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLHT EHGY EV  P +V   +M GTGQ+PKF +D F      +  IPT+EV +TN
Sbjct: 179 SFMLDLHTDEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIESEDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           ++  EI+  + LP+R+   +  FRSEAGSAGRDTRG++RQHQF K ELV   + EDS+ E
Sbjct: 239 MHRDEILNKEQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++ + AE +L+ L+L YRV+S+CTGDLGF+A K YD+EVW+     YREISSCS    
Sbjct: 299 LEKLTNDAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVWIPSYGTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R   +   +  HTLNGSG+A+GR + AILENY   DG++ IP VLRPYM 
Sbjct: 359 FQARRANIRFRREPNGKPEHVHTLNGSGLAIGRTVAAILENYQQEDGTIIIPEVLRPYMG 418

Query: 419 NLAVIK 424
              VIK
Sbjct: 419 GKTVIK 424


>gi|227112001|ref|ZP_03825657.1| seryl-tRNA synthetase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
 gi|227328169|ref|ZP_03832193.1| seryl-tRNA synthetase [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 431

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 199/432 (46%), Positives = 267/432 (61%), Gaps = 11/432 (2%)

Query: 1   MLDIQWIRQNPEHLDIAL-KKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD   +R   + +   L  +R  +   E +   +E+ ++L  + E+++A RNS S +IG
Sbjct: 1   MLDPNLLRNELDAVAEKLLARRGFKLDVETLRKQEERRKVLQVETENLQAERNSRSKEIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
            A A G    ++ L+ E +TL E+L   + E  ++ + ++ L   IPN+P + VP+G   
Sbjct: 61  AAKARG--EDIEPLRREVNTLGEKLDAAKAELDQLQNEIRDLALTIPNLPDDSVPLGKDD 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            +N  +   G+        R+H E+GE    +DF  A KL+GARF V+ G +A L RAL 
Sbjct: 119 TQNQEVTRWGEPRKYDFPVRDHVELGEMAAGLDFAAAVKLTGARFVVMKGQIARLHRALA 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPT 231
           QFM+DLHT +HGY E   P LV    +YGTGQ+PKF +D+F TT            LIPT
Sbjct: 179 QFMLDLHTQQHGYQEAYVPYLVNHATLYGTGQLPKFGEDLFHTTPLSEEAESSSYALIPT 238

Query: 232 SEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITR 291
           +EV LTNL   EI++ +SLPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I R
Sbjct: 239 AEVPLTNLVRDEILDEESLPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQIVR 298

Query: 292 EEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREIS 351
            EDS    E + + AE +L+ L L YR V LCTGD+GF + KTYDLEVWL  Q+ YREIS
Sbjct: 299 PEDSMQALEELTTHAETVLQLLKLPYRKVLLCTGDMGFGSTKTYDLEVWLPAQDTYREIS 358

Query: 352 SCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPT 411
           SCS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A+LENY  ADG + +P 
Sbjct: 359 SCSNMWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVLENYQQADGRIEVPE 418

Query: 412 VLRPYMNNLAVI 423
           VLRPYM  L  I
Sbjct: 419 VLRPYMGGLEFI 430


>gi|56697184|ref|YP_167548.1| seryl-tRNA synthetase [Ruegeria pomeroyi DSS-3]
 gi|67461635|sp|Q5LR07|SYS_SILPO RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|56678921|gb|AAV95587.1| seryl-tRNA synthetase [Ruegeria pomeroyi DSS-3]
          Length = 430

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 208/429 (48%), Positives = 282/429 (65%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D AL +R   P S  IL+LDE  R  I   E  +A +N  S ++G 
Sbjct: 1   MHDIRAIRENPAAFDAALSRRGSAPVSSDILALDEARRGKILAAETAQADQNKASKEVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  + L+   +  K ++  ++ E  E+ + L +L++ +PN+P E+VP G    
Sbjct: 61  AKARGDEAEFERLRALVAEKKAEIAAMQAEAKELDTQLSELLAGLPNLPAEDVPQGADEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         +EHF++      MDF+ A KLSGARF +L+G +A + RAL Q
Sbjct: 121 DNVELHRWGTPREMDFAPKEHFDLASVQDGMDFETAAKLSGARFVLLSGAVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H+ ++G TEV+ P+LV  E MYGTGQ+PKF +D + T +G WLIPTSEVSLTN+ 
Sbjct: 181 FMLDTHSEQNGLTEVNGPVLVLSEMMYGTGQLPKFGEDSYQTREGWWLIPTSEVSLTNIV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           +   I    LP R+T  +  FRSEAGSAG+DTRGMLRQHQF K E+VS+T  + S  E +
Sbjct: 241 NGSTIAEDYLPRRYTAHSLCFRSEAGSAGKDTRGMLRQHQFEKVEMVSVTHPDHSDAEQK 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML CAE IL+ L + YR + LCTGD+GF A +TYD+E WL GQN YREISS STCG+FQ
Sbjct: 301 RMLRCAEGILEALGIPYRTIVLCTGDMGFGARRTYDIEAWLPGQNTYREISSVSTCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++  +    +F HTLNGSG+AVGRCLIA+LEN  NADGSVT+P  L PY+   
Sbjct: 361 ARRMNARFKPADGGKPQFVHTLNGSGLAVGRCLIAVLENGQNADGSVTLPQALAPYLGGK 420

Query: 421 AVIKKEHIL 429
             +  +  L
Sbjct: 421 LTLNTDGTL 429


>gi|84394178|ref|ZP_00992909.1| seryl-tRNA synthetase [Vibrio splendidus 12B01]
 gi|84375198|gb|EAP92114.1| seryl-tRNA synthetase [Vibrio splendidus 12B01]
          Length = 435

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 195/434 (44%), Positives = 265/434 (61%), Gaps = 11/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   +     L +R      E I  L+EK + L  K E+++A RNS S  IGQ
Sbjct: 1   MLDSKLLRAELDETAAKLARRGFTLDVETIRELEEKRKSLQMKTEELQALRNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+    + +  E   L  +L   +    E+ S L+ +   IPN+P  EVP G   +
Sbjct: 61  AKAKGDHEEAERILAEVGNLGAELDQAKVTLAELQSELETITMSIPNLPDAEVPDGKDED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G+  +     ++H ++GE  G +DF  A K+SG+RF V+ G  A L RA+ Q
Sbjct: 121 DNVEVSRWGQPKTYDFEVKDHVDLGEMSGGLDFASAVKISGSRFIVMKGKFARLHRAIAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-----------GRWLI 229
           FM+DLHT EHGYTE+  P LV  +++YGTGQ+PKF +D+F T+               LI
Sbjct: 181 FMLDLHTDEHGYTEMYVPYLVNHDSLYGTGQLPKFGEDLFHTSPLTEQVSDVPLKTLSLI 240

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV +TN+    I +   LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I
Sbjct: 241 PTAEVPVTNMVRDTITDEAELPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQI 300

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
           T+ EDS    E +   AE++L+ L+L YR V LCTGD+GF + KTYDLEVW+  Q  YRE
Sbjct: 301 TKPEDSMAALEELTGHAEKVLQLLELPYRKVILCTGDMGFGSAKTYDLEVWVPAQETYRE 360

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR ++AILEN   ADG + I
Sbjct: 361 ISSCSNMWDFQARRMQARFRRKGEKKPELVHTLNGSGLAVGRTMVAILENNQEADGRIAI 420

Query: 410 PTVLRPYMNNLAVI 423
           PTVL+PYM  +  I
Sbjct: 421 PTVLQPYMGGVTHI 434


>gi|32033510|ref|ZP_00133837.1| COG0172: Seryl-tRNA synthetase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|126208344|ref|YP_001053569.1| seryl-tRNA synthetase [Actinobacillus pleuropneumoniae L20]
 gi|166200593|sp|A3N0M8|SYS_ACTP2 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|126097136|gb|ABN73964.1| seryl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 5b
           str. L20]
          Length = 435

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 200/436 (45%), Positives = 269/436 (61%), Gaps = 14/436 (3%)

Query: 1   MLDIQWIRQNPEHLDIALK-KRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           M+D   +R N + +  ALK KR      E + +L+EK + L  K E ++A RN+ S  IG
Sbjct: 1   MIDQNLLRTNLDDVANALKVKRGFTLDVESVKALEEKRKALQVKTETLQAERNARSKNIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
            A A G    + AL  E   +  +L   +    +V + +++L+  +PN+P +EVP+G   
Sbjct: 61  AAKARG--EDISALLAEVDNMGNELNEAKVALDQVQAEIRELLLSVPNLPADEVPLGKDD 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            EN+ +   G+        ++H  +GEAL  +DF    KL+ +RF V+ G LA L RAL 
Sbjct: 119 TENLEVSRWGEPRQFDFEVKDHVALGEALNGLDFAAGVKLTASRFVVMKGKLARLHRALS 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-----------GRWL 228
           QFM+DLHT +HGY E + P LV  + ++GTGQ+PKF +D+F T                L
Sbjct: 179 QFMLDLHTEQHGYVETNVPFLVNHDTLFGTGQLPKFGEDLFHTQPLTGQDPNETQRPFSL 238

Query: 229 IPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVS 288
           IPT+EV +TNL   EII+  SLPLR+T   P FRSEAGS GRDTRG++R HQF K E+V 
Sbjct: 239 IPTAEVPVTNLVRDEIIDENSLPLRYTAHTPCFRSEAGSYGRDTRGLIRMHQFEKVEMVQ 298

Query: 289 ITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYR 348
           I   E S    E +   AE++L+ L L YR V LCTGD+GF + KTYDLEVWL  QN YR
Sbjct: 299 IVAPEKSMEALEELTGHAEKVLQLLGLPYRKVLLCTGDMGFGSAKTYDLEVWLPAQNTYR 358

Query: 349 EISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVT 408
           EISSCS   +FQ+RRM++R +    K  +  HTLNGSG+AVGR L+A+LENY NADGS+T
Sbjct: 359 EISSCSNMWDFQARRMSARCKAKGDKKTRLVHTLNGSGLAVGRTLVAVLENYQNADGSIT 418

Query: 409 IPTVLRPYMNNLAVIK 424
           +P VLRPYM  + VI 
Sbjct: 419 VPEVLRPYMGGVEVIT 434


>gi|327480895|gb|AEA84205.1| seryl-tRNA synthetase [Pseudomonas stutzeri DSM 4166]
          Length = 426

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 199/427 (46%), Positives = 275/427 (64%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R  +     I +L+ + + +  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLVRTQLQDVAARLATRGYQLDVARIEALEAQRKTVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G    +  L  +   +  +L   ++E   + S L +L+  IPN+P E VP+G    
Sbjct: 61  AKQRG--EDIAPLLADVDRMGSELESGKQELDRIQSELDQLMLSIPNLPHESVPVGADEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G   +     ++H  +GE  G +DF+ A KLSGARF+++ G +A L RAL Q
Sbjct: 119 ENVEVRRWGTPKAFDFPVQDHVALGEQHGWLDFETAAKLSGARFALMRGPIARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD----GRWLIPTSEVSL 236
           FMIDLHT EHGY E   P LV+  A+ GTGQ+PKF DD+F  +       +LIPT+EVSL
Sbjct: 179 FMIDLHTREHGYEEAYTPYLVQAPALQGTGQLPKFEDDLFKISREGEADFYLIPTAEVSL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+ + EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I     SF
Sbjct: 239 TNIVAGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVEPSKSF 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
              E +   AE++L+ L+L YRV+SLCTGD+GF A KTYDLEVW+  Q+ YREISSCS C
Sbjct: 299 EALEELTGNAEKVLQLLELPYRVLSLCTGDMGFGATKTYDLEVWVPSQDKYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +RYR+P +   +  HTLNGSG+AVGR L+A+LENY  ADG + +P VL+PY
Sbjct: 359 GDFQARRMQARYRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGRILVPEVLKPY 418

Query: 417 MNNLAVI 423
           M  + VI
Sbjct: 419 MGGIEVI 425


>gi|307261353|ref|ZP_07543028.1| Seryl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 12
           str. 1096]
 gi|306869084|gb|EFN00886.1| Seryl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 12
           str. 1096]
          Length = 435

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 200/436 (45%), Positives = 269/436 (61%), Gaps = 14/436 (3%)

Query: 1   MLDIQWIRQNPEHLDIALK-KRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           M+D   +R N + +  ALK KR      E + +L+EK + L  K E ++A RN+ S  IG
Sbjct: 1   MIDQNLLRTNLDDVANALKVKRGFTLDVESVKALEEKRKALQVKTETLQAERNARSKNIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
            A A G    + AL  E   +  +L   +    +V + +++L+  +PN+P +EVP+G   
Sbjct: 61  AAKARG--EDISALLAEVDNMGNELNEAKVALDQVQAEIRELLLSVPNLPADEVPLGKDD 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            EN+ +   G+        ++H  +GEAL  +DF    KL+ +RF V+ G LA L RAL 
Sbjct: 119 TENLEVSRWGEPRQFDFEVKDHVALGEALNGLDFAAGVKLTASRFVVMKGKLARLHRALS 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-----------GRWL 228
           QFM+DLHT +HGY E + P LV  + ++GTGQ+PKF +D+F T                L
Sbjct: 179 QFMLDLHTEQHGYVETNVPFLVNHDTLFGTGQLPKFGEDLFHTQPLTGQDPNETQRPFSL 238

Query: 229 IPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVS 288
           IPT+EV +TNL   EII+  SLPLR+T   P FRSEAGS GRDTRG++R HQF K E+V 
Sbjct: 239 IPTAEVPVTNLVRDEIIDEDSLPLRYTAHTPCFRSEAGSYGRDTRGLIRMHQFEKVEMVQ 298

Query: 289 ITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYR 348
           I   E S    E +   AE++L+ L L YR V LCTGD+GF + KTYDLEVWL  QN YR
Sbjct: 299 IVAPEKSMKALEELTGHAEKVLQLLGLPYRKVLLCTGDMGFGSAKTYDLEVWLPAQNTYR 358

Query: 349 EISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVT 408
           EISSCS   +FQ+RRM++R +    K  +  HTLNGSG+AVGR L+A+LENY NADGS+T
Sbjct: 359 EISSCSNMWDFQARRMSARCKAKGDKKTRLVHTLNGSGLAVGRTLVAVLENYQNADGSIT 418

Query: 409 IPTVLRPYMNNLAVIK 424
           +P VLRPYM  + VI 
Sbjct: 419 VPEVLRPYMGGVEVIT 434


>gi|165976289|ref|YP_001651882.1| seryl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
 gi|190150196|ref|YP_001968721.1| seryl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|303252866|ref|ZP_07339025.1| seryl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 2
           str. 4226]
 gi|307247856|ref|ZP_07529892.1| Seryl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 2
           str. S1536]
 gi|307250109|ref|ZP_07532071.1| Seryl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 4
           str. M62]
 gi|307263534|ref|ZP_07545149.1| Seryl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 13
           str. N273]
 gi|238687564|sp|B0BPF3|SYS_ACTPJ RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|238692394|sp|B3H1K7|SYS_ACTP7 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|165876390|gb|ABY69438.1| seryl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
 gi|189915327|gb|ACE61579.1| seryl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|302648296|gb|EFL78493.1| seryl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 2
           str. 4226]
 gi|306855658|gb|EFM87825.1| Seryl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 2
           str. S1536]
 gi|306857840|gb|EFM89934.1| Seryl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 4
           str. M62]
 gi|306871177|gb|EFN02906.1| Seryl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 13
           str. N273]
          Length = 435

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 200/436 (45%), Positives = 269/436 (61%), Gaps = 14/436 (3%)

Query: 1   MLDIQWIRQNPEHLDIALK-KRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           M+D   +R N + +  ALK KR      E + +L+EK + L  K E ++A RN+ S  IG
Sbjct: 1   MIDQNLLRTNLDDVANALKVKRGFTLDVESVKALEEKRKALQVKTETLQAERNARSKNIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
            A A G    + AL  E   +  +L   +    +V + +++L+  +PN+P +EVP+G   
Sbjct: 61  AAKARG--EDISALLAEVDNMGNELNEAKVALDQVQAEIRELLLSVPNLPADEVPLGKDD 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            EN+ +   G+        ++H  +GEAL  +DF    KL+ +RF V+ G LA L RAL 
Sbjct: 119 TENLEVSRWGEPRQFDFEVKDHVALGEALNGLDFAAGVKLTASRFVVMKGKLARLHRALS 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-----------GRWL 228
           QFM+DLHT +HGY E + P LV  + ++GTGQ+PKF +D+F T                L
Sbjct: 179 QFMLDLHTEQHGYVETNVPFLVNHDTLFGTGQLPKFGEDLFHTQPLTGQDPNETQRPFSL 238

Query: 229 IPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVS 288
           IPT+EV +TNL   EII+  SLPLR+T   P FRSEAGS GRDTRG++R HQF K E+V 
Sbjct: 239 IPTAEVPVTNLVRDEIIDEDSLPLRYTAHTPCFRSEAGSYGRDTRGLIRMHQFEKVEMVQ 298

Query: 289 ITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYR 348
           I   E S    E +   AE++L+ L L YR V LCTGD+GF + KTYDLEVWL  QN YR
Sbjct: 299 IVAPEKSMEALEELTGHAEKVLQLLGLPYRKVLLCTGDMGFGSAKTYDLEVWLPAQNTYR 358

Query: 349 EISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVT 408
           EISSCS   +FQ+RRM++R +    K  +  HTLNGSG+AVGR L+A+LENY NADGS+T
Sbjct: 359 EISSCSNMWDFQARRMSARCKAKGDKKTRLVHTLNGSGLAVGRTLVAVLENYQNADGSIT 418

Query: 409 IPTVLRPYMNNLAVIK 424
           +P VLRPYM  + VI 
Sbjct: 419 VPEVLRPYMGGVEVIT 434


>gi|89100960|ref|ZP_01173806.1| seryl-tRNA synthetase [Bacillus sp. NRRL B-14911]
 gi|89084331|gb|EAR63486.1| seryl-tRNA synthetase [Bacillus sp. NRRL B-14911]
          Length = 426

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 192/427 (44%), Positives = 262/427 (61%), Gaps = 4/427 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+++R N E +   L+ R  +         LD + R LI + E +++RRN  S Q+ 
Sbjct: 1   MLDIKYLRSNFEEVKNRLQHRGEDLGDLGKFEDLDVRRRELIMETEQLKSRRNEVSQQVA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      D+L  E   + +++   ++E   V  SL  L+  IPN+P E VP+G + 
Sbjct: 61  VLKREKK--DADSLIAEMREVGDKIKAFDEELRTVEESLDSLLMSIPNIPHESVPVGETE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+  R  G         + H++I   L ++DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 DDNVEARKWGNVRDFSFEPKPHWDIATDLDILDFERAGKVTGSRFVFYKGLGARLERALF 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLHT EHGY EV  P +V   +M GTGQ+PKF +D F      +  IPT+EV +TN
Sbjct: 179 NFMLDLHTEEHGYMEVLPPYMVNRASMTGTGQLPKFEEDAFLIESEDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           ++  EI+ ++ LP+ +   +  FRSEAGSAGRDTRG++RQHQF K ELV   R EDS+ E
Sbjct: 239 MHRDEILTNEQLPINYAAFSACFRSEAGSAGRDTRGLIRQHQFNKVELVKFVRPEDSYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++   AE++L+ L L YRV+S+CTGDLGF+A K YD+EVW+     YREISSCS    
Sbjct: 299 LEKLTGHAEKVLQLLGLPYRVLSMCTGDLGFTAAKKYDIEVWIPSYGTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R       +  HTLNGSG+A+GR + AILENY   DGSV IP VLRPYM 
Sbjct: 359 FQARRANIRFRREPKGKPEHLHTLNGSGLAIGRTVAAILENYQQEDGSVIIPEVLRPYMG 418

Query: 419 NLAVIKK 425
           N  VI K
Sbjct: 419 NKEVIGK 425


>gi|134295006|ref|YP_001118741.1| seryl-tRNA synthetase [Burkholderia vietnamiensis G4]
 gi|166201241|sp|A4JCA3|SYS_BURVG RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|134138163|gb|ABO53906.1| seryl-tRNA synthetase [Burkholderia vietnamiensis G4]
          Length = 433

 Score =  436 bits (1121), Expect = e-120,   Method: Composition-based stats.
 Identities = 196/430 (45%), Positives = 272/430 (63%), Gaps = 11/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R +  + E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDLDGVAKRLADRGYTLDVAAFSALEAERRAIQTRTEELQARRNSLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A+  E   + +++   E +  E+ S L  L+  +PN+  E VP+G    
Sbjct: 61  MKGKG--EDTSAVMAEVGGIGDEMKASEVKLGEIQSRLSDLMLGMPNIAHESVPVGKDEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G         ++H ++G  LG +DF+   KL+GARF++L G +A L RAL Q
Sbjct: 119 DNVELRRWGTPRQFDFDVKDHVDVGTPLG-LDFETGAKLAGARFTMLRGPIARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM+D HT  HGY+E   P +V  E +YGTGQ+PKFADDMF            ++LI TSE
Sbjct: 178 FMLDTHTQLHGYSETYTPYIVNPEILYGTGQLPKFADDMFRVEKGGAENTITQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     I+++ +LP++ T  +P FRSEAGS GRDTRGM+RQHQF K E+V +   +
Sbjct: 238 ISLTNTVRESIVDASALPIKLTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQVVAPD 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   + M+  AE IL++L L YRV++LCTGD+GFSA KT+DLEVWL  QN YREISSC
Sbjct: 298 TSYAALDEMVGHAEAILQKLGLPYRVITLCTGDMGFSAAKTFDLEVWLPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S    FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+A+LENY NADGSVT+P VL
Sbjct: 358 SNTEAFQARRMQARFRNAQGK-PELVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPEVL 416

Query: 414 RPYMNNLAVI 423
           RPYM  +  I
Sbjct: 417 RPYMGGMERI 426


>gi|261868430|ref|YP_003256352.1| seryl-tRNA synthetase [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261413762|gb|ACX83133.1| seryl-tRNA synthetase [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 438

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 203/437 (46%), Positives = 271/437 (62%), Gaps = 14/437 (3%)

Query: 1   MLDIQWIRQNPEHLDIALK-KRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           M+D   +R NP  +   LK KR     +  I  L+E+ + L  K E+++A RN+ S  IG
Sbjct: 1   MIDPNLLRNNPADVAEKLKIKRGFVLDTAKITQLEEQRKALQVKTENLQAERNARSRAIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
            A A G    +  L  E   + E+L   + E  +V ++L  +   IPN+P +EVP+G   
Sbjct: 61  AAKARG--EDIAPLLAEVDHMAEELEQGKIELDKVQNALNDIALNIPNIPADEVPLGKDD 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +EN+ +   G+        ++H  +GE L  +DF  A KL+G+RF V+ G +A L RA+ 
Sbjct: 119 SENLEVSRWGEPRKFDFEVKDHVTLGENLQGLDFAAAVKLTGSRFVVMKGQIAKLHRAIA 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-----------TDGRWL 228
           QFM+DLHT +HGYTE   P LV  + +YGTGQ+PKF +D+F T                L
Sbjct: 179 QFMLDLHTEQHGYTEAYVPYLVNHDTLYGTGQLPKFGEDLFHTKPLEGQDPNEVQRTYGL 238

Query: 229 IPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVS 288
           IPT+EV +TNL   EI+++++LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV 
Sbjct: 239 IPTAEVPVTNLVRGEILDAENLPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQ 298

Query: 289 ITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYR 348
           I   E S    E +   AE++L+ L L YR V LCTGD+GF +CKTYDLEVW+  QN YR
Sbjct: 299 IVEPEKSMEALEELTGHAEKVLQLLGLPYRKVLLCTGDMGFGSCKTYDLEVWVPAQNTYR 358

Query: 349 EISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVT 408
           EISSCS   +FQ+RRM +R R    K  +  HTLNGSG+AVGR L+A+LENY NADGS+T
Sbjct: 359 EISSCSNMWDFQARRMQARCRSKGDKKTRLVHTLNGSGLAVGRTLVAVLENYQNADGSIT 418

Query: 409 IPTVLRPYMNNLAVIKK 425
           +P VLRPYM  L VI K
Sbjct: 419 VPEVLRPYMGGLDVIGK 435


>gi|119774911|ref|YP_927651.1| seryl-tRNA synthetase [Shewanella amazonensis SB2B]
 gi|166223284|sp|A1S6H5|SYS_SHEAM RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|119767411|gb|ABL99981.1| seryl-tRNA synthetase [Shewanella amazonensis SB2B]
          Length = 428

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 193/429 (44%), Positives = 266/429 (62%), Gaps = 8/429 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD +++R   E     L  R      +++ +L+EK + L    E+++A RN+ S  IGQ
Sbjct: 1   MLDTKYLRNELEFTKERLAARGFALDIDHLKALEEKRKSLQVATEELQASRNAISKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A + G    V  +  +   L  +L   + E   +   +  +   +PN+P E VP+G   +
Sbjct: 61  AKSRG--EDVAPIMAQVGNLGTELEAKKIELAALLEEINAIAMSVPNLPDESVPVGKDES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ IR  G+  S     ++H ++GE LG +DF  A K++G+RF V+ G +A + RAL Q
Sbjct: 119 ENVEIRRWGEPRSFDFAVKDHVDLGETLGGLDFKSAVKITGSRFIVMKGQIARMHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC------TTDGRWLIPTSEV 234
           FM+DLHT EHGYTE   PLLV  +++ GTGQ+PKF++D+F             LIPT+EV
Sbjct: 179 FMLDLHTIEHGYTEAYVPLLVNTDSLLGTGQLPKFSEDLFNLKPATEEGQALSLIPTAEV 238

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            +TNL    I++   LP++ T     FRSEAGS G+DTRG++RQHQF K E+V I + E+
Sbjct: 239 PVTNLVRDTILDEADLPIKITAHTACFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVKPEN 298

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCS 354
           S    E+M+  AE +LK+L L YR V LCTGD+GF A KTYD+EVWL  QN YREISSCS
Sbjct: 299 SMDALEQMVGHAENVLKKLGLPYRTVVLCTGDMGFGAAKTYDIEVWLPAQNTYREISSCS 358

Query: 355 TCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR 414
              +FQ+RRM +RYR          HTLNGSG+AVGR L+AILENY NADG+VT+P  LR
Sbjct: 359 NVKDFQARRMQARYRSKEDNKPALVHTLNGSGLAVGRTLVAILENYQNADGTVTVPEALR 418

Query: 415 PYMNNLAVI 423
           PYM  +  +
Sbjct: 419 PYMGGIEQL 427


>gi|307545960|ref|YP_003898439.1| seryl-tRNA synthetase [Halomonas elongata DSM 2581]
 gi|307217984|emb|CBV43254.1| seryl-tRNA synthetase [Halomonas elongata DSM 2581]
          Length = 442

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 200/425 (47%), Positives = 270/425 (63%), Gaps = 4/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R + E +   L KR     +E + +L+ + R L  + E ++  RN+ S  IG+
Sbjct: 17  MLDPKLLRSDLEGVAQRLAKRGFALDTERLAALESRRRELQAETERLQNERNTRSKSIGK 76

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    +  L +E S L ++L   +    EV +   + +S +PN+P E VP G S +
Sbjct: 77  AKANG--EDIQPLLDEVSDLGDRLDAAKTRLAEVQAEWDEQVSGLPNLPHESVPEGQSED 134

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G   +     R+H ++G   G +DFD A+KL+GARF+V+ G +A L RAL Q
Sbjct: 135 DNVELHRWGTPRTFDFEIRDHVDLGAQTGQLDFDLASKLTGARFAVMRGTIARLHRALTQ 194

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLI--PTSEVSLTN 238
           FM+D  T EHGY E   P +V D+++YGTGQ+PKF +D+F   D R     PT+EV LTN
Sbjct: 195 FMLDKQTLEHGYEECYVPYMVNDDSLYGTGQLPKFGEDLFRLEDERGYRLIPTAEVPLTN 254

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
               EIIE K+LP+R T   P FRSEAGS GRDTRGM+RQHQF K E+V +     S+  
Sbjct: 255 FARDEIIEHKALPVRLTAHTPCFRSEAGSHGRDTRGMIRQHQFDKVEMVQLVEPSTSYDT 314

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E M   AE IL+ LDL YRVV+LCTGD+G  A KTYDLEVWL  Q  YREISS S C +
Sbjct: 315 LEEMRGHAEAILQALDLPYRVVTLCTGDMGAGAAKTYDLEVWLPSQETYREISSVSNCED 374

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRM +R+R P+ K  +  HTLNGSG+AVGRCLIA++EN+ NADGS+++P  LR YM 
Sbjct: 375 FQARRMQARFRHPDEKKPQLLHTLNGSGLAVGRCLIAVMENHQNADGSISVPEALRAYMG 434

Query: 419 NLAVI 423
            +  I
Sbjct: 435 GMETI 439


>gi|85712402|ref|ZP_01043452.1| seryl-tRNA synthetase [Idiomarina baltica OS145]
 gi|85693845|gb|EAQ31793.1| seryl-tRNA synthetase [Idiomarina baltica OS145]
          Length = 430

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 205/431 (47%), Positives = 263/431 (61%), Gaps = 9/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD ++ R+  +     LK R  E   + I +L+E+ + +  K E ++A RNS S  IG+
Sbjct: 1   MLDAKYFREELQQTAERLKTRGFELNIDEIQALEEQRKSIQVKTEQLQAERNSRSKAIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G    +  L +  S L  QL   ++E  EV   L  LI  +PN+P E VP G   +
Sbjct: 61  AKQAG--EDIQPLLDAVSDLGSQLDAAKEELREVQDKLGALIMGVPNLPAEGVPEGKDES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEA-LGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           EN  I   G+ P      ++H E+ EA    MDF+ A KL+GARF V+ G +A L RAL 
Sbjct: 119 ENQEISVWGEPPQLDFEPKDHVELAEALAKGMDFEAAAKLTGARFVVMRGKIARLHRALT 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT------DGRWLIPTSE 233
           QFM+D HT  HGY E   P LV  +++YGTGQ+PKF  D+F             LIPT+E
Sbjct: 179 QFMLDTHTEAHGYAETYVPYLVNHDSLYGTGQLPKFGKDLFHIQGETEEQIPLSLIPTAE 238

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V LTNL   EI +   LP++ T   P FRSEAGS GRDTRG++RQHQF K ELV +   E
Sbjct: 239 VPLTNLARDEIFDEAELPVKLTAHTPCFRSEAGSHGRDTRGLIRQHQFDKVELVWLAHPE 298

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S    E++   AE IL++L L YR V LCTGD+GF A KTYDLEVWL  QN YREISSC
Sbjct: 299 QSMDALEQLTQHAETILQKLGLAYRKVLLCTGDMGFGATKTYDLEVWLPAQNTYREISSC 358

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S  G+FQ+RRM +R+R   +K  +  HTLNGSG+AVGR L+A+LENY  ADGS+ IP VL
Sbjct: 359 SNMGDFQARRMQARFRRKGAKKPELLHTLNGSGLAVGRTLVALLENYQQADGSIVIPEVL 418

Query: 414 RPYMNNLAVIK 424
           RPYM  +  I+
Sbjct: 419 RPYMGGIERIE 429


>gi|161611255|ref|YP_296799.2| seryl-tRNA synthetase [Ralstonia eutropha JMP134]
          Length = 434

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 198/437 (45%), Positives = 270/437 (61%), Gaps = 15/437 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ  R++ + +   L  R  +       +L+ + + L  + E++++RRNS S QIG 
Sbjct: 1   MLDIQLFRKDIDAVAQRLATRGFQLDVAAFQALESERKQLQTQTEELQSRRNSLSKQIGM 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A+  E   + + L        E+ + L +L+  IPN+P E VP+G    
Sbjct: 61  LKGKG--EDASAVMAEVGGIGDTLKDSAARLEEIQAQLSELMLSIPNLPHESVPLGKDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R VG+        R+H ++G+ LG +DFD A K++G+RFS+L G +A + RAL Q
Sbjct: 119 QNVEVRRVGEPRKFDFEVRDHVDVGDKLG-LDFDTAAKVTGSRFSMLRGGMARMHRALVQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-----------GRWLI 229
            M+D HT EHGYTE+  P +V   +M GTGQ+PKF +D+F                 +LI
Sbjct: 178 LMLDTHTLEHGYTEMYVPYIVNAASMRGTGQLPKFEEDLFKVPRKVGGEDGERTENFYLI 237

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV LTN+    I+    LPLRF    P FRSEAGS G+DTRGM+RQHQF K ELV +
Sbjct: 238 PTAEVPLTNIVRDAIVAGDKLPLRFVAHTPCFRSEAGSYGKDTRGMIRQHQFDKVELVHV 297

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
              E SF   E++   AE ILK+L+L +R + LCTGD+GF + KTYDLEVW+  QN YRE
Sbjct: 298 VPAEQSFDALEQLTGHAEAILKKLELPFRTIVLCTGDMGFGSTKTYDLEVWIPAQNTYRE 357

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS  G+FQ+RRM +RYR    K  +  HTLNGSG+AVGR L+AILENY NADGSVT+
Sbjct: 358 ISSCSNMGDFQARRMQARYRVGQGK-PELVHTLNGSGLAVGRTLVAILENYQNADGSVTV 416

Query: 410 PTVLRPYMNNLAVIKKE 426
           PT L+PYM     ++ E
Sbjct: 417 PTALQPYMGGTTRLEPE 433


>gi|72119692|gb|AAZ61955.1| seryl-tRNA synthetase [Ralstonia eutropha JMP134]
          Length = 445

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 198/437 (45%), Positives = 270/437 (61%), Gaps = 15/437 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ  R++ + +   L  R  +       +L+ + + L  + E++++RRNS S QIG 
Sbjct: 12  MLDIQLFRKDIDAVAQRLATRGFQLDVAAFQALESERKQLQTQTEELQSRRNSLSKQIGM 71

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A+  E   + + L        E+ + L +L+  IPN+P E VP+G    
Sbjct: 72  LKGKG--EDASAVMAEVGGIGDTLKDSAARLEEIQAQLSELMLSIPNLPHESVPLGKDET 129

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R VG+        R+H ++G+ LG +DFD A K++G+RFS+L G +A + RAL Q
Sbjct: 130 QNVEVRRVGEPRKFDFEVRDHVDVGDKLG-LDFDTAAKVTGSRFSMLRGGMARMHRALVQ 188

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-----------GRWLI 229
            M+D HT EHGYTE+  P +V   +M GTGQ+PKF +D+F                 +LI
Sbjct: 189 LMLDTHTLEHGYTEMYVPYIVNAASMRGTGQLPKFEEDLFKVPRKVGGEDGERTENFYLI 248

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV LTN+    I+    LPLRF    P FRSEAGS G+DTRGM+RQHQF K ELV +
Sbjct: 249 PTAEVPLTNIVRDAIVAGDKLPLRFVAHTPCFRSEAGSYGKDTRGMIRQHQFDKVELVHV 308

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
              E SF   E++   AE ILK+L+L +R + LCTGD+GF + KTYDLEVW+  QN YRE
Sbjct: 309 VPAEQSFDALEQLTGHAEAILKKLELPFRTIVLCTGDMGFGSTKTYDLEVWIPAQNTYRE 368

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS  G+FQ+RRM +RYR    K  +  HTLNGSG+AVGR L+AILENY NADGSVT+
Sbjct: 369 ISSCSNMGDFQARRMQARYRVGQGK-PELVHTLNGSGLAVGRTLVAILENYQNADGSVTV 427

Query: 410 PTVLRPYMNNLAVIKKE 426
           PT L+PYM     ++ E
Sbjct: 428 PTALQPYMGGTTRLEPE 444


>gi|294141063|ref|YP_003557041.1| seryl-tRNA synthetase [Shewanella violacea DSS12]
 gi|293327532|dbj|BAJ02263.1| seryl-tRNA synthetase [Shewanella violacea DSS12]
          Length = 428

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 198/429 (46%), Positives = 269/429 (62%), Gaps = 8/429 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   E     L  R      E +  L+EK + L    E+++A RN+ S  IGQ
Sbjct: 1   MLDPKLLRNELEVTAERLATRGFILDVERLSKLEEKRKSLQMTTEELQASRNAISKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G    V  +  +   L  +L   + E   + + L  +   +PN+P E  P+G   +
Sbjct: 61  AKAKG--EDVAPIMAKVGDLGTELDAKKSELAALLAELNAIAMSVPNLPDESAPLGADES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G         ++H ++GEALG +DF  A KL+G+RF ++ G +A + RAL Q
Sbjct: 119 ENVEVRRWGTPREFNFEVKDHVDLGEALGGLDFKNAVKLTGSRFIIMKGQIARMHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG------RWLIPTSEV 234
           FM+DLHT EHGYTE   PLLV +++++GTGQ+PKF +D+F T           LIPT+EV
Sbjct: 179 FMLDLHTDEHGYTEAYVPLLVNEDSLFGTGQLPKFGEDLFHTKPATEEGQGLSLIPTAEV 238

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            LTNL    II+   LP++ T   P FRSEAGS GRDTRG++RQHQF K ELV + + ED
Sbjct: 239 PLTNLARDTIIDEDELPVKLTAHTPCFRSEAGSYGRDTRGLIRQHQFDKVELVQMVKPED 298

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCS 354
           S    + +   AE +L++LDL YR V LCTGD+GF A KT+D+EVWL  QN +REISSCS
Sbjct: 299 SMAALDALTGHAETVLQKLDLPYRTVILCTGDMGFGASKTFDIEVWLPAQNTFREISSCS 358

Query: 355 TCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR 414
              +FQ+RRM +RY+  ++K     HTLNGSG+AVGR L+A+LENY N DGS+T+P VLR
Sbjct: 359 NMQDFQARRMQARYKAKSAKKPALLHTLNGSGLAVGRTLVAVLENYQNEDGSITVPEVLR 418

Query: 415 PYMNNLAVI 423
           PYMN L  I
Sbjct: 419 PYMNGLEKI 427


>gi|225076272|ref|ZP_03719471.1| hypothetical protein NEIFLAOT_01312 [Neisseria flavescens
           NRL30031/H210]
 gi|224952396|gb|EEG33605.1| hypothetical protein NEIFLAOT_01312 [Neisseria flavescens
           NRL30031/H210]
          Length = 431

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 197/433 (45%), Positives = 272/433 (62%), Gaps = 9/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L  R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLAARGYEFDTARFNALEEQRKAVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKVDLEQAAADLDAVQKELDAWLLTIPNLPHESVPAGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMKGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T         ++LIPT+E
Sbjct: 180 FMLDTHTLKHGYTEHYTPYIVDDLTLQGTGQLPKFAEDLFHVTRGGDESKKTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  I+    LPL+ T  +P FRSEAG+ G+D RG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIVAGSDLPLKLTAHSPCFRSEAGAYGKDVRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ +P  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINVPAAL 418

Query: 414 RPYMNNLAVIKKE 426
           +PYM  +  ++ +
Sbjct: 419 QPYMGGVTKLEVK 431


>gi|261381397|ref|ZP_05985970.1| serine--tRNA ligase [Neisseria subflava NJ9703]
 gi|284795610|gb|EFC50957.1| serine--tRNA ligase [Neisseria subflava NJ9703]
          Length = 431

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 196/433 (45%), Positives = 272/433 (62%), Gaps = 9/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L  R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLAARGYEFDTARFNALEEQRKAVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP+G    
Sbjct: 61  LKGQGKHEEAQAAMDQVTQIKADLEQAAADLDAVQKELDAWLLSIPNLPHESVPVGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMKGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T         ++LIPT+E
Sbjct: 180 FMLDTHTLKHGYTEHYTPYIVDDLTLQGTGQLPKFAEDLFHVTRGGDESKKTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  I+     PL+ T  +P FRSEAG+ G+D RG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIVAGSDFPLKLTAHSPCFRSEAGAYGKDVRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ +P  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINVPAAL 418

Query: 414 RPYMNNLAVIKKE 426
           +PYM  +  ++ +
Sbjct: 419 QPYMGGVTKLEVK 431


>gi|90021342|ref|YP_527169.1| seryl-tRNA synthetase [Saccharophagus degradans 2-40]
 gi|123396207|sp|Q21K22|SYS_SACD2 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|89950942|gb|ABD80957.1| seryl-tRNA synthetase [Saccharophagus degradans 2-40]
          Length = 426

 Score =  436 bits (1120), Expect = e-120,   Method: Composition-based stats.
 Identities = 198/427 (46%), Positives = 270/427 (63%), Gaps = 4/427 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R     +   LKKR  E  ++   +L+E+ R L    E ++  RN+ S  IG+
Sbjct: 1   MLDPKLLRNQLNDVAENLKKRGYELDTQAFTALEERRRTLQTACESLQQERNTRSKNIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    +  L  E   LK  L   E+    +   L+ L+S IPN+  ++VP G S +
Sbjct: 61  AKAAG--EDIGPLLQEVDNLKSALAEAEQNLQALQGELEALVSAIPNMVHDDVPAGKSED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I   G+  +     ++H ++G A+G +DF+ ATK++GARFS++ G +A + RAL Q
Sbjct: 119 DNVEISKWGEPKTFDFEVQDHVDVGAAIGGLDFETATKITGARFSLMRGDIASMHRALTQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGR--WLIPTSEVSLTN 238
            M++ H  EH Y EV  P +V  +++YGTGQ+PKF +D+F  TD R  +LIPT+EV +TN
Sbjct: 179 LMLNTHIDEHKYEEVYVPYIVNKDSLYGTGQLPKFEEDLFKLTDDREFYLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           +   EI +   LP+RF    P FRSEAGS GRDTRGM+RQHQF K ELV + + EDS   
Sbjct: 239 IARGEIFDESQLPVRFVAHTPCFRSEAGSYGRDTRGMIRQHQFEKVELVQLVKPEDSLNA 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E +   AE IL++L L YR V LC GD+GFSA KTYDLEVW+  Q  YREISSCS  G+
Sbjct: 299 LEELTQHAEAILQKLGLPYRKVVLCGGDIGFSATKTYDLEVWIPSQGKYREISSCSCFGD 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRM +RYR+  +   +  HT+NGSG+AVGR L+A+LENY   DGSV IP  L+PYMN
Sbjct: 359 FQARRMMARYRNSETNKPELLHTINGSGLAVGRTLVAVLENYQREDGSVEIPAALQPYMN 418

Query: 419 NLAVIKK 425
              VI K
Sbjct: 419 GKTVIAK 425


>gi|260888172|ref|ZP_05899435.1| serine--tRNA ligase [Selenomonas sputigena ATCC 35185]
 gi|260862201|gb|EEX76701.1| serine--tRNA ligase [Selenomonas sputigena ATCC 35185]
          Length = 430

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 189/426 (44%), Positives = 277/426 (65%), Gaps = 3/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+++R + + +   L+KR    +      L+EK R L+++ E+++ARRNS S +IG 
Sbjct: 6   MLDIKFVRDHIDEVQAMLEKRCNPLKLSGFKELEEKRRTLLQEAEELKARRNSVSKEIGA 65

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G    V A+  E   + +++  L+    EV   L  ++  IPN+P ++VPIG    
Sbjct: 66  KKKQG--EDVAAISAEMREVGKKIADLDARTREVEDELHTILLNIPNMPKDDVPIGKDDT 123

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN  +R  G+  +     + H+++G  L ++D +RA K++GARF+   G  A LERA   
Sbjct: 124 ENPEVRRWGEPRTFTFEPKAHWDLGADLEILDAERAAKVTGARFTFYKGLGARLERACIN 183

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-TTDGRWLIPTSEVSLTNL 239
           FM+DLH ++HGYTE+ AP +  + +M GTGQ+PKFA+DMF       +L+PT+EV  TN 
Sbjct: 184 FMMDLHATKHGYTEMLAPYIANEASMIGTGQLPKFAEDMFKLEGLDYYLVPTAEVPTTNY 243

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +  EI++ + LP R+T+    FR+EAGSAGRDTRG++RQHQF K EL+  T+ E+S+ E 
Sbjct: 244 HRDEILDGRKLPERYTSYTACFRAEAGSAGRDTRGLIRQHQFNKVELIKFTKPEESWDEL 303

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E M+  AE++L+ L++ Y VV LCTGD+ F++ KTYD+EVW+  QN YREISSCS C ++
Sbjct: 304 EGMVDAAEDVLRILEIPYHVVLLCTGDMSFTSAKTYDIEVWMPAQNTYREISSCSNCLDY 363

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N ++R       +F HTLNGSG+AVGR + AILENY   DGSV +P  L PYM  
Sbjct: 364 QARRANIKFRREPKAKPEFCHTLNGSGLAVGRTVAAILENYQQEDGSVRVPKALVPYMGG 423

Query: 420 LAVIKK 425
           + VI+K
Sbjct: 424 VEVIEK 429


>gi|261493580|ref|ZP_05990100.1| serine--tRNA ligase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261310762|gb|EEY11945.1| serine--tRNA ligase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 435

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 201/436 (46%), Positives = 272/436 (62%), Gaps = 14/436 (3%)

Query: 1   MLDIQWIRQNPEHLDIALK-KRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           M+D   +R N E +  ALK KR+     E + +L+E+ + L  K E ++A RN+ S  IG
Sbjct: 1   MIDQNLLRTNLEDVATALKIKRNFILDVERVKTLEEQRKTLQVKTETLQAERNTRSKNIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
            A A G    + AL  E  ++  +L   + E  +V + +++L+  +PN+P +E+P+G   
Sbjct: 61  AAKARG--EDISALLAEVDSMGNELDTAKVELDKVQAEIRELLLSVPNLPADEIPLGKDD 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +EN+ +   G+        ++H  +GE L  +DF    KL+ +RF V+ G LA L RAL 
Sbjct: 119 SENLEVLRWGEPRQFDFEVQDHVTLGENLNGLDFAAGVKLTASRFVVMKGKLARLHRALS 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-----------GRWL 228
           QFM+DLHT +HGY E + P LV  + +YGTGQ+PKF +D+F T                L
Sbjct: 179 QFMLDLHTEQHGYVETNVPFLVNHDTLYGTGQLPKFGEDLFHTQPLTGQDPNEVQRPFGL 238

Query: 229 IPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVS 288
           IPT+EV +TNL   EII+  SLPLR+T   P FR+EAGS GRDTRG++R HQF K E+V 
Sbjct: 239 IPTAEVPVTNLVRDEIIDEDSLPLRYTAHTPCFRAEAGSYGRDTRGLIRMHQFEKVEMVQ 298

Query: 289 ITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYR 348
           I   E S    E +   AE++L+ L L YR V LCTGD+GF A KTYDLEVWL  QN YR
Sbjct: 299 IVAPEKSMEALEELTGHAEKVLQLLGLPYRKVLLCTGDMGFGAAKTYDLEVWLPAQNTYR 358

Query: 349 EISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVT 408
           EISSCS   +FQ+RRM++R +    K  +  HTLNGSG+AVGR L+A+LENY NADGS+T
Sbjct: 359 EISSCSNMWDFQARRMSARCKAKGDKKTRLVHTLNGSGLAVGRTLVAVLENYQNADGSIT 418

Query: 409 IPTVLRPYMNNLAVIK 424
           +P VLRPYM  L VI 
Sbjct: 419 VPEVLRPYMGGLEVIT 434


>gi|297616225|ref|YP_003701384.1| seryl-tRNA synthetase [Syntrophothermus lipocalidus DSM 12680]
 gi|297144062|gb|ADI00819.1| seryl-tRNA synthetase [Syntrophothermus lipocalidus DSM 12680]
          Length = 423

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 199/425 (46%), Positives = 276/425 (64%), Gaps = 3/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R NPE ++ AL  R ++   +  L LD++ R    + ++++  RN  S ++G+
Sbjct: 1   MLDPRLVRANPEMVEKALSARGIQGGLDQFLKLDKERRACQVRADELKNFRNQASVEVGR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG  +  + L+     + +++  L+    E+   L +++  IPN+P E VP+G    
Sbjct: 61  LKKEGKDT--NELQARIREVGQEIKGLDDRMREIDEQLTEILLNIPNLPHESVPLGAGDA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G+        + H++IG AL ++DF+RA KLSGARF+V  G  A LERAL  
Sbjct: 119 DNVEVRRWGEPRKFDFEPQAHWDIGVALDILDFERAAKLSGARFTVYKGLGARLERALIS 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT-DGRWLIPTSEVSLTNL 239
           FM+DLH  +HGY EV  P +V  + M GTGQ+PKFA+DMF       +++PT+EV LTNL
Sbjct: 179 FMLDLHVDKHGYREVFPPFMVTADCMVGTGQLPKFAEDMFKVEGRELYMVPTAEVPLTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y  EI+ ++ LP+  T     FR+EAGS GRDTRG++RQHQF K ELV IT  E S+ E 
Sbjct: 239 YREEILAAEQLPMYLTAYTACFRAEAGSHGRDTRGIIRQHQFNKVELVKITSPETSYEEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++   AEE+L+ L L YRV+ LCTGD+GFS+ KTYDLEVWL     Y+EISSCS CG+F
Sbjct: 299 EKLTRDAEEVLQLLGLPYRVMLLCTGDMGFSSAKTYDLEVWLPSYGEYKEISSCSNCGDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N RYR   +   +F HTLNGSGVAVGR + AILENY  AD SV +P +LRPYM  
Sbjct: 359 QARRANIRYRPEPNARPQFVHTLNGSGVAVGRTVAAILENYQQADSSVVVPEILRPYMGG 418

Query: 420 LAVIK 424
           +AVI+
Sbjct: 419 IAVIR 423


>gi|196251172|ref|ZP_03149848.1| seryl-tRNA synthetase [Geobacillus sp. G11MC16]
 gi|196209313|gb|EDY04096.1| seryl-tRNA synthetase [Geobacillus sp. G11MC16]
          Length = 424

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 193/426 (45%), Positives = 269/426 (63%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ +R   + +   L +R  +    +    LD++ R LI ++E+++++RN  S QI 
Sbjct: 1   MLDVKLLRTQFQEVKEKLLQRGDDLANIDRFEQLDKERRRLIAQVEELKSKRNEVSQQIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      ++L  E   + +++  ++++  ++   L  L+  IPNVP E VP+G S 
Sbjct: 61  VLKREKK--DAESLIAEMREVGDRIKQMDEQIRQLEEELDSLLLSIPNVPHESVPVGQSE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            +N+ +R  G+  S     + H++I + LGL+DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 EDNVEVRRWGEPRSFSFEPKPHWDIADQLGLLDFERAAKVAGSRFVFYKGLGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+D+H  E GY EV  P LV   +M GTGQ+PKFA+D F   +  +  IPT+EV +TN
Sbjct: 179 NFMLDIHLDEFGYQEVLPPYLVNRASMIGTGQLPKFAEDAFHLDNEDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L+  EI+ +  LPL +   +  FR+EAGSAGRDTRG++RQHQF K ELV   + EDS+ E
Sbjct: 239 LHRDEILTADDLPLYYAAYSACFRAEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYDE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++   AE IL+RL L YRVV+LCTGDLGFSA KTYD+EVWL     YREISSCS    
Sbjct: 299 LEKLTHQAETILQRLGLPYRVVALCTGDLGFSAAKTYDIEVWLPSYGTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R       ++ HTLNGSG+A+GR + AILENY   DGSV IP  LRPYM 
Sbjct: 359 FQARRANIRFRREPKAKPEYVHTLNGSGLAIGRTVAAILENYQQEDGSVVIPEALRPYMG 418

Query: 419 NLAVIK 424
           N  VI+
Sbjct: 419 NRDVIR 424


>gi|269837655|ref|YP_003319883.1| seryl-tRNA synthetase [Sphaerobacter thermophilus DSM 20745]
 gi|269786918|gb|ACZ39061.1| seryl-tRNA synthetase [Sphaerobacter thermophilus DSM 20745]
          Length = 427

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 188/430 (43%), Positives = 275/430 (63%), Gaps = 4/430 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M+D++ IR+ P+ +  AL K + E   + IL LDE+ R L+ ++E+++ARRN+ S +I +
Sbjct: 1   MIDLRLIREQPDLVREALAKLNTEAPIDEILELDERRRALLAEVEELKARRNAGSKEISR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
                     DA   E   L +++  L+ +  E  ++L+ L+  +PN+P  +VP+G   +
Sbjct: 61  LAP---GPERDARIAEMRGLGDKIQELDAQVAETDAALRDLLLQVPNLPDPDVPVGPDES 117

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+++R  G+     +  R H+EIGE LGL+DF+R  K+SG+RF    G +A L+RAL  
Sbjct: 118 ANVVVRHWGEPRDFPYPVRPHWEIGEELGLIDFERGVKVSGSRFYFFRGDMARLQRALAT 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-GRWLIPTSEVSLTNL 239
           +MIDLH  EHGYTE+ AP+LVR +A+ GTG +PKF D ++   +   WLIPT+EV +TNL
Sbjct: 178 WMIDLHVREHGYTELYAPVLVRPDALIGTGNLPKFGDALYRDDESDLWLIPTAEVPVTNL 237

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y+ EI+++ +LP+      P FR E  SAGRD RG+ R HQF K E+V     E S  E 
Sbjct: 238 YADEILDADALPIYHVAQTPCFRREQLSAGRDVRGIKRVHQFEKVEMVKFVAPETSDDEL 297

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
             +++ AEE+L+RL++ YRVV +CTGDL F+A K +DLE W  G   + E+SSCS   +F
Sbjct: 298 NSLVANAEEVLQRLNIPYRVVQMCTGDLSFTAAKKFDLEAWAPGSQDWLEVSSCSNFRDF 357

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N RYR  +    +F HTLNGSG+A+ R LIAI+ENY   DG++ IP VLRPYM  
Sbjct: 358 QARRANIRYRPADGARPQFVHTLNGSGLALPRTLIAIMENYQREDGTIEIPEVLRPYMGG 417

Query: 420 LAVIKKEHIL 429
             VI ++ + 
Sbjct: 418 QEVIGRQPVF 427


>gi|254361093|ref|ZP_04977238.1| serine--tRNA ligase [Mannheimia haemolytica PHL213]
 gi|261495418|ref|ZP_05991866.1| serine--tRNA ligase [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|153092579|gb|EDN73634.1| serine--tRNA ligase [Mannheimia haemolytica PHL213]
 gi|261308923|gb|EEY10178.1| serine--tRNA ligase [Mannheimia haemolytica serotype A2 str. OVINE]
          Length = 435

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 202/436 (46%), Positives = 272/436 (62%), Gaps = 14/436 (3%)

Query: 1   MLDIQWIRQNPEHLDIALK-KRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           M+D   +R N E +  ALK KR+     E + +L+E+ + L  K E ++A RN+ S  IG
Sbjct: 1   MIDQNLLRTNLEDVATALKIKRNFILDVERVKTLEEQRKTLQVKTETLQAERNTRSKNIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
            A A G    + AL  E  ++  +L   + E  +V + +++L+  +PN+P +EVP+G   
Sbjct: 61  AAKARG--EDISALLAEVDSMGNELDTAKVELDKVQAEIRELLLSVPNLPADEVPLGKDD 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +EN+ +   G+        ++H  +GE L  +DF    KL+ +RF V+ G LA L RAL 
Sbjct: 119 SENLEVLRWGEPRQFDFEVQDHVTLGENLNGLDFAAGVKLTASRFVVMKGKLARLHRALS 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-----------GRWL 228
           QFM+DLHT +HGY E + P LV  + +YGTGQ+PKF +D+F T                L
Sbjct: 179 QFMLDLHTEQHGYVETNVPFLVNHDTLYGTGQLPKFGEDLFHTQPLTGQDPNEVQRPFGL 238

Query: 229 IPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVS 288
           IPT+EV +TNL   EII+  SLPLR+T   P FR+EAGS GRDTRG++R HQF K E+V 
Sbjct: 239 IPTAEVPVTNLVRDEIIDEDSLPLRYTAHTPCFRAEAGSYGRDTRGLIRMHQFEKVEMVQ 298

Query: 289 ITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYR 348
           I   E S    E +   AE++L+ L L YR V LCTGD+GF A KTYDLEVWL  QN YR
Sbjct: 299 IVAPEKSMEALEELTGHAEKVLQLLGLPYRKVLLCTGDMGFGAAKTYDLEVWLPAQNTYR 358

Query: 349 EISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVT 408
           EISSCS   +FQ+RRM++R +    K  +  HTLNGSG+AVGR L+A+LENY NADGS+T
Sbjct: 359 EISSCSNMWDFQARRMSARCKAKGDKKTRLVHTLNGSGLAVGRTLVAVLENYQNADGSIT 418

Query: 409 IPTVLRPYMNNLAVIK 424
           +P VLRPYM  L VI 
Sbjct: 419 VPEVLRPYMGGLEVIT 434


>gi|70731235|ref|YP_260976.1| seryl-tRNA synthetase [Pseudomonas fluorescens Pf-5]
 gi|123654458|sp|Q4K9V7|SYS_PSEF5 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|68345534|gb|AAY93140.1| seryl-tRNA synthetase [Pseudomonas fluorescens Pf-5]
          Length = 426

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 197/427 (46%), Positives = 274/427 (64%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R N + +   L  R        I +L+E+ + +  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRSNLQDVADRLASRGFALDVARIEALEEQRKTVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G    +  L  +   +  +L   + E   + S L  ++  IPN+P E VP+G   +
Sbjct: 61  AKQRG--EDIAPLMADVERMGNELSSGKAELENIQSELDSILFGIPNLPHESVPVGEDED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G   +     ++H  +GE  G +DF+ A KLSGARF++L G +A L RAL Q
Sbjct: 119 GNVEVRRWGTPTAFDFPIKDHVALGETHGWLDFETAAKLSGARFALLRGPIARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD----GRWLIPTSEVSL 236
           FMI+LHT EHGY E   P LV+  A+ GT Q+PKF +D+F  T       +LIPT+EVSL
Sbjct: 179 FMINLHTGEHGYEEAYTPYLVQAPALVGTSQLPKFEEDLFKITREGEADLYLIPTAEVSL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+ + EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V +     S 
Sbjct: 239 TNIVAGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQVVEPSTSM 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
              E + + AE++L+ L L YRV++LCTGD+GFSA KTYDLEVW+  Q+ YREISSCS C
Sbjct: 299 EALEGLTANAEKVLQLLQLPYRVLALCTGDMGFSAVKTYDLEVWVPSQDKYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P VL+PY
Sbjct: 359 GDFQARRMQARFRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPDVLKPY 418

Query: 417 MNNLAVI 423
           M  L VI
Sbjct: 419 MGGLEVI 425


>gi|255658869|ref|ZP_05404278.1| serine--tRNA ligase [Mitsuokella multacida DSM 20544]
 gi|260849274|gb|EEX69281.1| serine--tRNA ligase [Mitsuokella multacida DSM 20544]
          Length = 426

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 188/426 (44%), Positives = 268/426 (62%), Gaps = 3/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+++R++ + +   LK R      +    LD+K R L+++ E ++++RN+ S +I  
Sbjct: 1   MLDIKFVREHLDEVRQMLKNRCNPLNLDDFEGLDKKRRELLQESEALKSQRNTVSKEISV 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
                  +    L  E   +  ++  L+KE  +V + L+ ++  IPN+P E+VPIG    
Sbjct: 61  MKKNKEDAEAKIL--EMRAVGAKISELDKELKDVEAQLRDIMLHIPNMPREDVPIGKDDT 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN  +R  G+        + H+++G  L ++D DRA K++GARF+   G  A LERA   
Sbjct: 119 ENPEVRKWGEPTKFDFEPKAHWDLGTELDILDADRAAKVTGARFTFYKGLGARLERACIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-TTDGRWLIPTSEVSLTNL 239
           FM+DLH ++HGYTE+ AP +   E+M GTGQ+PKFADDMF       +L+PT+EV  TN 
Sbjct: 179 FMMDLHANKHGYTEMLAPYIANKESMTGTGQLPKFADDMFKLEGLDYYLVPTAEVPTTNY 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +  EI++   LP  ++     FR+EAGSAGRDTRG++RQHQF K EL+   + E S+ E 
Sbjct: 239 HRDEILDGNKLPEYYSCYTACFRAEAGSAGRDTRGLIRQHQFNKVELIKFVKPETSWHEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           + M+  AE++L+ L+L Y VV LCTGD+ F++  TYDLEVW   QN YREISSCS C ++
Sbjct: 299 DTMVDAAEDVLRLLELPYHVVKLCTGDMSFTSATTYDLEVWFPAQNKYREISSCSNCTDY 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N ++R       +F HTLNGSG+AVGR + AILENY   DGSV IP VL PYM  
Sbjct: 359 QARRANIKFRRDAKSKPEFVHTLNGSGLAVGRTVAAILENYQQEDGSVRIPKVLVPYMGG 418

Query: 420 LAVIKK 425
           + VIKK
Sbjct: 419 VEVIKK 424


>gi|269102238|ref|ZP_06154935.1| seryl-tRNA synthetase [Photobacterium damselae subsp. damselae CIP
           102761]
 gi|268162136|gb|EEZ40632.1| seryl-tRNA synthetase [Photobacterium damselae subsp. damselae CIP
           102761]
          Length = 436

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 191/434 (44%), Positives = 262/434 (60%), Gaps = 11/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   +     L +R  +   E +  L+E+ + L  K E+++A+RN+ S  IGQ
Sbjct: 1   MLDSKLLRTELDDTAEKLARRGFKLDVENLRQLEEQRKSLQVKTEELQAQRNARSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+    + +  E   L  +L   +K    + + L  +   +PN+P E VP+G   N
Sbjct: 61  AKAKGDHEEAERILAEVGNLGSELDEAKKALAALQAELDAITQTVPNIPDESVPVGKDEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I   G+  +     ++H ++GE    +DF  A K++GARF V+ G  A L RA+ Q
Sbjct: 121 DNVEISRWGEPKTYDFEVKDHVDLGEMSDGLDFASAVKITGARFIVMKGQFARLHRAIAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-----------GRWLI 229
           FM+DLH  EHGYTE+  P LV  ++++GTGQ+PKF  D+F T                LI
Sbjct: 181 FMLDLHIEEHGYTEMYVPYLVNADSLFGTGQLPKFGADLFHTQPLTEKVNDEEPRTLSLI 240

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV +TNL    I E   LP++ T   P FRSEAGS GRDTRG++R HQF K ELV I
Sbjct: 241 PTAEVPVTNLMRDTISEEADLPVKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQI 300

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
           T+ EDS    E +   AE++L+ L+L YR V LCTGD+GF +CKTYDLEVW+  Q  YRE
Sbjct: 301 TKPEDSMAALEELTGHAEKVLQLLELPYRKVVLCTGDMGFGSCKTYDLEVWVPAQETYRE 360

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR ++AILEN   ADG + I
Sbjct: 361 ISSCSNMWDFQARRMQARFRRKGEKKPELVHTLNGSGLAVGRTMVAILENNQEADGRIRI 420

Query: 410 PTVLRPYMNNLAVI 423
           P VLR YMN    I
Sbjct: 421 PEVLRKYMNGAEYI 434


>gi|260773037|ref|ZP_05881953.1| seryl-tRNA synthetase [Vibrio metschnikovii CIP 69.14]
 gi|260612176|gb|EEX37379.1| seryl-tRNA synthetase [Vibrio metschnikovii CIP 69.14]
          Length = 435

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 191/434 (44%), Positives = 270/434 (62%), Gaps = 11/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   +     L +R      + I +L+E+ + +  ++E++++ RNS S QIGQ
Sbjct: 1   MLDSKLLRTELDETAAKLARRGFTLDVDTIRTLEEQRKSIQVEVENLQSTRNSISKQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +++G+ +  +A+K +  TL E L   + E  ++ + L+ +   +PN+P   VP G   +
Sbjct: 61  LMSQGDKAGAEAIKQQIGTLGEDLDSKKVELDKIQAELEAITQTVPNIPDSSVPDGKDED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G         ++H ++GE  G +DF  ATK++GARF ++ G  A L RA+ Q
Sbjct: 121 DNVEVSRWGTPKEYDFEVKDHVDLGEMSGGLDFASATKITGARFVIMKGQFARLHRAIAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-----------TDGRWLI 229
           FM+DLHT +HGYTE+  P LV  E ++GTGQ+PKF  D+F T                LI
Sbjct: 181 FMLDLHTEQHGYTELYVPYLVNQETLFGTGQLPKFGKDLFHTEPLTEKASDEDPRRFSLI 240

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV +TNL    I++   LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I
Sbjct: 241 PTAEVPVTNLVRDVILDEAELPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQI 300

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
           T+ EDS    E + + AE++L+ L+L YR V LCTGD+GF ACKTYDLEVW+  Q  YRE
Sbjct: 301 TKPEDSMAALEELTAHAEKVLQLLNLPYRKVVLCTGDMGFGACKTYDLEVWVPAQKTYRE 360

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR ++AILENY  ADG + I
Sbjct: 361 ISSCSNMWDFQARRMQARFRRKAEKRPELVHTLNGSGLAVGRTMVAILENYQQADGRIEI 420

Query: 410 PTVLRPYMNNLAVI 423
           P VL+ YM  L  I
Sbjct: 421 PAVLQKYMGGLTHI 434


>gi|300853245|ref|YP_003778229.1| seryl-tRNA synthetase [Clostridium ljungdahlii DSM 13528]
 gi|300433360|gb|ADK13127.1| seryl-tRNA synthetase [Clostridium ljungdahlii DSM 13528]
          Length = 426

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 180/428 (42%), Positives = 269/428 (62%), Gaps = 6/428 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQ---SEYILSLDEKNRILIKKIEDIRARRNSNSAQ 57
           MLD++ IR NPE +   L  R  +      + +++LDEK R ++ ++E ++ +RN +SAQ
Sbjct: 1   MLDLKRIRNNPEEVKKQLSNRGEDFDPATIDEVIALDEKRRKILVEVEALKNKRNQDSAQ 60

Query: 58  IGQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGT 117
           I +    G     D L  E   + + +   + E  E+   ++ ++  IPN+P   VP G 
Sbjct: 61  IAKMKRNG--ENADDLVAEMKHVSDNIKQYDTELSELNGKIEYIMLRIPNIPNPAVPEGK 118

Query: 118 SANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
           S  +N+ IR   +        + H++IG  L ++DF+R  K+SG+RF+   G  A LERA
Sbjct: 119 SDEDNVEIRKWSEPTKFDFKPKAHWDIGTDLDILDFERGGKVSGSRFTFYKGLGAKLERA 178

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSL 236
           +  + +D HT +HGYTE+  P +V   +M GTGQ+PKF +D F  ++  +  IPT+EV +
Sbjct: 179 IITYYLDFHTEKHGYTEILPPYMVNRTSMTGTGQLPKFEEDAFRISNNDYFLIPTAEVPV 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN +  E+++ ++LPL++   +  FR+EAGSAGRDTRG++RQHQF K E+V  T+ E+S+
Sbjct: 239 TNFHRDEVLKGENLPLKYVAYSACFRAEAGSAGRDTRGIIRQHQFNKVEMVKFTKPEESY 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            E E++ + AE++LK L + YRVV +C GDLGF+A   YD+EVW+   N Y EISSCS  
Sbjct: 299 DELEKLTNDAEDVLKGLKIPYRVVRICKGDLGFTAALKYDIEVWMPSYNRYVEISSCSNF 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
            +FQ+RR N +Y++      ++ HTLNGSGVA+GR + AILENY   DGSV IP +LRPY
Sbjct: 359 EDFQARRANIKYKETPKDKPRYVHTLNGSGVAIGRTVAAILENYQQEDGSVIIPEILRPY 418

Query: 417 MNNLAVIK 424
           M    VIK
Sbjct: 419 MGGKEVIK 426


>gi|253688109|ref|YP_003017299.1| seryl-tRNA synthetase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259511677|sp|C6DF54|SYS_PECCP RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|251754687|gb|ACT12763.1| seryl-tRNA synthetase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 431

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 198/432 (45%), Positives = 265/432 (61%), Gaps = 11/432 (2%)

Query: 1   MLDIQWIRQNPEHLDIAL-KKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD   +R   + +   L  +R  +   E +   +E+ ++L  + E+++A RNS S +IG
Sbjct: 1   MLDPNLLRNELDAVAEKLLARRGFKLDVETLRKQEERRKVLQVETENLQAERNSRSKEIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
            A A G    ++ L+ E +TL E+L   + E  ++ + ++ L   IPN+P + VP+G   
Sbjct: 61  AAKARG--EDIEPLRREVNTLGEKLDAAKAELDQLQNEIRDLALTIPNLPDDSVPLGKDD 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            +N  +   G+        R+H E+GE    +DF  A KL+GARF V+ G +A L RAL 
Sbjct: 119 TQNQEVTRWGEPRKYDFPVRDHVELGEMAAGLDFAAAVKLTGARFVVMKGQIARLHRALS 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPT 231
           QFM+DLHT +H Y E   P LV    +YGTGQ+PKF +D+F T             LIPT
Sbjct: 179 QFMLDLHTQQHAYQEAYVPYLVNHATLYGTGQLPKFGEDLFHTNPLSEEAESSQYALIPT 238

Query: 232 SEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITR 291
           +EV LTNL   EI++ +SLPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I R
Sbjct: 239 AEVPLTNLVRDEILDEESLPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQIVR 298

Query: 292 EEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREIS 351
            EDS    E + + AE +L+ L L YR V LCTGD+GF + KTYDLEVWL  Q+ YREIS
Sbjct: 299 PEDSMQALEELTTHAETVLQLLKLPYRKVLLCTGDMGFGSTKTYDLEVWLPAQDTYREIS 358

Query: 352 SCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPT 411
           SCS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A+LENY  ADG + IP 
Sbjct: 359 SCSNMWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVLENYQQADGRIEIPE 418

Query: 412 VLRPYMNNLAVI 423
           VLRPYM  L  I
Sbjct: 419 VLRPYMGGLEFI 430


>gi|224368220|ref|YP_002602383.1| SerS [Desulfobacterium autotrophicum HRM2]
 gi|259511665|sp|C0QLD3|SYS_DESAH RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|223690936|gb|ACN14219.1| SerS [Desulfobacterium autotrophicum HRM2]
          Length = 427

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 205/427 (48%), Positives = 284/427 (66%), Gaps = 3/427 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           ML+I+++R+N E +  AL KR  +   E     ++K R L+++IE++R +RN+ S +I +
Sbjct: 1   MLEIKYVRENIEEVKQALAKRAGKADFEGFARAEKKRRELLQQIEELRHQRNTVSDEIAR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
                  +    L  E  T+ +++  L+K   E    +++ +  IPN+P  +VP+G S  
Sbjct: 61  MKRNKEDAGTSIL--EMRTVSDEIKTLDKTLAEQDDFIQQFMMAIPNMPHPDVPMGASDA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N L + VG   S     + H++IGE LG++DF RA K++GARFS+  G  A LERAL  
Sbjct: 119 DNTLEKKVGTPRSFDFPIKAHWDIGEDLGILDFPRAAKITGARFSLYLGSGAKLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT-DGRWLIPTSEVSLTNL 239
           FM+DLHT+EHGYTE   P +V  E++ GTGQ+PKF +D+F       +LIPTSEV +TN+
Sbjct: 179 FMLDLHTNEHGYTETLPPFIVNRESLLGTGQLPKFEEDLFKIEGQEYYLIPTSEVPMTNI 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y  E++  ++LP++FT   P FRSEAGS G+DTRG++RQHQF K ELV  T  E S+ E 
Sbjct: 239 YRDEVLNEENLPIKFTAYTPCFRSEAGSYGKDTRGLIRQHQFNKVELVKYTTPETSYQEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E +L+ AE +LKRL L Y+VV+LC+GDLGFSA +TYD+EVW+ GQ+ YREISSCS C  F
Sbjct: 299 ESLLANAETVLKRLGLPYQVVTLCSGDLGFSATRTYDIEVWMPGQDKYREISSCSNCEAF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N ++R    K L+F HTLNGSG+AVGR + AILEN+   DGSV IP VLRPYM  
Sbjct: 359 QARRANIKFRRAGQKKLEFVHTLNGSGLAVGRTVAAILENFQQPDGSVVIPEVLRPYMGG 418

Query: 420 LAVIKKE 426
              I  E
Sbjct: 419 KETITNE 425


>gi|83943025|ref|ZP_00955485.1| seryl-tRNA synthetase [Sulfitobacter sp. EE-36]
 gi|83846033|gb|EAP83910.1| seryl-tRNA synthetase [Sulfitobacter sp. EE-36]
          Length = 430

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 207/429 (48%), Positives = 281/429 (65%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP+  D AL +R   P S  +L+LDE  R  I   E  +A +N  S  +G 
Sbjct: 1   MHDIKAIRENPDAFDAALARRGDTPVSAQVLALDEARRAKISAAETAQAEQNKASKLVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+ +  + L+   S  K ++  ++ E  ++ + L  +++ IPN+P ++ P G    
Sbjct: 61  AKAKGDEAEFERLRTLVSDKKAEVTAMQAEAKDLDAQLTDMLARIPNLPADDAPDGADEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G  P+    ++EHFEI      MDF+ A K SGARF +L G +A + RAL Q
Sbjct: 121 DNVEVNRWGDVPTFDFKAKEHFEIASVAASMDFETAAKTSGARFVMLKGAVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMID H  E+G TE   P+LVRDEAMYGT ++PKF DD + TT+G WLIPTSEV+LT   
Sbjct: 181 FMIDTHVDENGLTEHMTPVLVRDEAMYGTDKLPKFGDDSYQTTNGWWLIPTSEVTLTYSV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + +++E  +LP R T     FRSEAGSAGRDT GMLRQHQF K E+VS+T  + S  E +
Sbjct: 241 AGDVLEEAALPRRMTAHTLCFRSEAGSAGRDTSGMLRQHQFEKVEMVSVTHPDQSDDEQK 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML CAE++L+RL + YR V LCTGD+GF A +T+D+E WL GQN YREISS ST G+FQ
Sbjct: 301 RMLRCAEDMLERLGVPYRTVILCTGDMGFGARRTFDIEAWLPGQNAYREISSVSTTGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++  +    +F HTLNGSG+AVGRCLIA+LEN   ADGSV +P VL PY+   
Sbjct: 361 ARRMNARFKPADGGKPQFVHTLNGSGLAVGRCLIAVLENGQQADGSVKLPDVLAPYLGGK 420

Query: 421 AVIKKEHIL 429
             +  +  L
Sbjct: 421 ITLGVDGTL 429


>gi|237809053|ref|YP_002893493.1| seryl-tRNA synthetase [Tolumonas auensis DSM 9187]
 gi|259516216|sp|C4L937|SYS_TOLAT RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|237501314|gb|ACQ93907.1| seryl-tRNA synthetase [Tolumonas auensis DSM 9187]
          Length = 432

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 199/434 (45%), Positives = 277/434 (63%), Gaps = 14/434 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD +++R + E     L  R  +     I +L+E+ ++L  + ++++A RN+ S  IG+
Sbjct: 1   MLDPKFLRSDIETAAERLALRGYKLDVATINALEEQRKVLQTRTQELQAERNARSKAIGE 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G    V  L  +  +L  +L   +K++ E+   L+++   +PN+P + VP+G   +
Sbjct: 61  AKRLGQ--DVAPLMAQVGSLGSELEQCKKQQDEILEQLRQIALLVPNLPADTVPVGKDES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G         ++H  +GE  G +DF  ATK+SG+RF VL G +A + RAL Q
Sbjct: 119 ENVEVRRWGTPRQFDFEIKDHVAVGEDNGGLDFATATKISGSRFVVLKGQIARMHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-----------TDGRWLI 229
           FM+DLHT +HGYTE   P LV  +++ GTGQ+PKFA+D+F T                LI
Sbjct: 179 FMLDLHTQQHGYTECYVPYLVNADSLLGTGQLPKFAEDLFHTAINGEGDEEGKVRKFSLI 238

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV LTN+   EI + K+LP++ T  +P FRSEAGS GRDTRG++R HQF K E+V +
Sbjct: 239 PTAEVPLTNIARDEIYDEKALPVKMTAHSPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQL 298

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
              E S+   E M+  AE++L+ L L YRVVSLCTGD+GFSA KTYDLEVWL  QN YRE
Sbjct: 299 VHPEKSWDALEEMVGHAEKVLQLLGLPYRVVSLCTGDMGFSAAKTYDLEVWLPAQNTYRE 358

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS C +FQ+RRM +R R  +SK  +  HTLNGSG+AVGR L+A+LENY  ADG + +
Sbjct: 359 ISSCSNCTDFQARRMQARVRGADSK-PQLLHTLNGSGLAVGRTLVAVLENYQQADGRIEV 417

Query: 410 PTVLRPYMNNLAVI 423
           P VLRPYM+ L  I
Sbjct: 418 PEVLRPYMSGLTHI 431


>gi|241759885|ref|ZP_04757985.1| serine--tRNA ligase [Neisseria flavescens SK114]
 gi|241319893|gb|EER56289.1| serine--tRNA ligase [Neisseria flavescens SK114]
          Length = 431

 Score =  435 bits (1119), Expect = e-120,   Method: Composition-based stats.
 Identities = 197/431 (45%), Positives = 271/431 (62%), Gaps = 9/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L  R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQLLRSNTAAVAERLAARGYEFDTARFNALEEQRKAVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKVDLEQAAADLDAVQKELDAWLLTIPNLPHESVPAGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMKGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T         ++LIPT+E
Sbjct: 180 FMLDTHTLKHGYTEHYTPYIVDDLTLQGTGQLPKFAEDLFHVTRGGDESKKTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  I+    LPL+ T  +P FRSEAG+ G+D RG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIVAGSDLPLKLTAHSPCFRSEAGAYGKDVRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ +P  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINVPAAL 418

Query: 414 RPYMNNLAVIK 424
           +PYM  +  ++
Sbjct: 419 QPYMGGVTKLE 429


>gi|206561375|ref|YP_002232140.1| seryl-tRNA synthetase [Burkholderia cenocepacia J2315]
 gi|238693102|sp|B4EBR4|SYS_BURCJ RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|198037417|emb|CAR53352.1| seryl-tRNA synthetase [Burkholderia cenocepacia J2315]
          Length = 433

 Score =  435 bits (1118), Expect = e-120,   Method: Composition-based stats.
 Identities = 200/430 (46%), Positives = 271/430 (63%), Gaps = 11/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R +    E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDLDGVAKRLADRGYTLDVAAFSALEAERRAIQTHTEELQARRNSLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A+  E S + + +   E +  E+ + L  L+  +PNV  E VP+G    
Sbjct: 61  MKGKG--EDTSAVMAEVSGIGDDMKASEAKLGEIQARLSDLMLGMPNVAHESVPVGKDEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G         ++H ++G  LG +DF+   KL+GARF++L G +A L RAL Q
Sbjct: 119 DNVEVRRWGTPRQFDFEVKDHVDVGTPLG-LDFETGAKLAGARFTMLRGPIARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FMID HT +HGYTE   P +V  E +YGTGQ+PKFADDMF            ++LI TSE
Sbjct: 178 FMIDTHTQQHGYTETYTPYIVNPEILYGTGQLPKFADDMFRVEKGGAENTVTQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     I++  +LP++ T  +P FRSEAGS GRDTRGM+RQHQF K E+V +   E
Sbjct: 238 ISLTNTVRESIVDGAALPIKLTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQVVAPE 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   + M+  AE IL++L L YRV++LCTGD+GFSA KT+DLEVWL  QN YREISSC
Sbjct: 298 TSYAALDEMVGHAEAILQKLGLPYRVITLCTGDMGFSAAKTFDLEVWLPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S    FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+A+LENY NADGSVT+P VL
Sbjct: 358 SNTEAFQARRMQARFRNAQGK-PELVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPEVL 416

Query: 414 RPYMNNLAVI 423
           RPYM  +  I
Sbjct: 417 RPYMGGMERI 426


>gi|163784436|ref|ZP_02179316.1| hypothetical protein HG1285_05375 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880295|gb|EDP73919.1| hypothetical protein HG1285_05375 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 419

 Score =  435 bits (1118), Expect = e-120,   Method: Composition-based stats.
 Identities = 208/420 (49%), Positives = 282/420 (67%), Gaps = 4/420 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRH--LEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQI 58
           MLDI+ IR+NP+ +   LK R   L    + IL++D++ R LI ++E ++A +N  S +I
Sbjct: 1   MLDIKLIRENPDFVKERLKTRDEVLVFVIDEILTVDKERRKLIAEVEQLKAEKNKLSKEI 60

Query: 59  GQAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTS 118
           G+   EG        K E     E++  LEKE  EV      L+  +PN+P E VP+G  
Sbjct: 61  GKLFKEGKKEEAQKAKEEVVAKNERIECLEKELKEVEKRFNNLLLTVPNLPYESVPVGKD 120

Query: 119 ANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
             EN+ IR  G+          H+EIGE LG++DF+R  KLSG+RF+V+    A LERAL
Sbjct: 121 ETENVEIRKWGEPRKFDFEPLPHWEIGEKLGILDFERGAKLSGSRFTVMFKEAARLERAL 180

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-GRWLIPTSEVSLT 237
             FM+D+HT EHGYTEV +P+LV+ E + GTGQ+PKF +D++   D   +L+PT+EVSLT
Sbjct: 181 INFMLDIHTKEHGYTEVWSPVLVKPEILTGTGQLPKFEEDLYKICDEDLYLLPTAEVSLT 240

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           NL++ EI++ + LP  +T   P FR EAGS GRD RG+LRQHQF K ELV I + E+S+ 
Sbjct: 241 NLHAGEILKEEELPKYYTAYTPCFRREAGSHGRDVRGILRQHQFDKVELVKIVKPEESYN 300

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E E++++ AE+IL+ L+L YRVV LCTGDLGFSA KTYD+EVW+  QN+YREISSCS   
Sbjct: 301 ELEKLVNEAEKILQLLELPYRVVELCTGDLGFSAAKTYDIEVWIPSQNMYREISSCSNTE 360

Query: 358 NFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +FQ+RR   RY+    K+ +F HTLNGSG+AVGR L+A++ENY   DGS  IP VL+ YM
Sbjct: 361 DFQARRAKIRYKTKEGKN-EFVHTLNGSGLAVGRTLLAVMENYQKPDGSFDIPEVLQKYM 419


>gi|170698494|ref|ZP_02889565.1| seryl-tRNA synthetase [Burkholderia ambifaria IOP40-10]
 gi|170136578|gb|EDT04835.1| seryl-tRNA synthetase [Burkholderia ambifaria IOP40-10]
          Length = 433

 Score =  435 bits (1118), Expect = e-120,   Method: Composition-based stats.
 Identities = 195/430 (45%), Positives = 271/430 (63%), Gaps = 11/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R +  + E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDLDGVAKRLADRGYTLDVAAFSALEAERRAIQTRTEELQARRNSLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A+  E   + +++   E +  E+ + L  L+  +PN+  E VP+G    
Sbjct: 61  MKGKG--EDTSAVMAEVGGIGDEMKASEAKLGEIQTRLSDLMLGMPNIAHESVPVGKDEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G         ++H ++G  LG +DF+   KL+GARF++L G +A L RAL Q
Sbjct: 119 DNVEVRRWGTPREFDFEVKDHVDVGTPLG-LDFETGAKLAGARFTMLRGSIARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FMID HT +HGY+E   P +V  E +YGTGQ+PKFADDMF            ++LI TSE
Sbjct: 178 FMIDTHTLQHGYSETYTPYIVNPEILYGTGQLPKFADDMFRVEKGGGENTITQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     I++  +LP++ T  +P FRSEAGS GRDTRGM+RQHQF K E+V +   +
Sbjct: 238 ISLTNTVRESIVDGSALPIKLTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQVVAPD 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   + M+  AE IL++L L YRV++LCTGD+GFSA KT+DLEVWL  QN YREISSC
Sbjct: 298 ASYAALDEMVGHAEAILQKLGLPYRVITLCTGDMGFSAAKTFDLEVWLPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S    FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+A+LENY NADGSVT+P  L
Sbjct: 358 SNTEAFQARRMQARFRNAQGK-PELVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPEAL 416

Query: 414 RPYMNNLAVI 423
           RPYM  +  I
Sbjct: 417 RPYMGGMERI 426


>gi|78065554|ref|YP_368323.1| seryl-tRNA synthetase [Burkholderia sp. 383]
 gi|123569084|sp|Q39IN7|SYS_BURS3 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|77966299|gb|ABB07679.1| seryl-tRNA synthetase [Burkholderia sp. 383]
          Length = 433

 Score =  435 bits (1118), Expect = e-120,   Method: Composition-based stats.
 Identities = 198/430 (46%), Positives = 271/430 (63%), Gaps = 11/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R +  + E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDLDGVAQRLADRGYTLDVAAFSALEAERRAIQTRTEELQARRNSLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A+  E   + +++   E +  E+ + L  L+  +PNV  E VP+G    
Sbjct: 61  MKGKG--EDTSAVMAEVGGIGDEMKAGEAKLGEIQARLSDLMLGMPNVAHESVPVGKDEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+  R  G         ++H ++G  LG +DF+   KL+GARF++L G +A L RAL Q
Sbjct: 119 DNVEARRWGTPRQFDFEVKDHVDVGTPLG-LDFETGAKLAGARFTMLRGSIARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FMID HT +HGYTE   P +V  E +YGTGQ+PKFADDMF            ++LI TSE
Sbjct: 178 FMIDTHTLQHGYTETYTPYIVNPEILYGTGQLPKFADDMFRVEKGGEENKVTQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     I+++ +LP++ T  +P FRSEAGS GRDTRGM+RQHQF K E+V +   E
Sbjct: 238 ISLTNTVRESIVDASALPIKLTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQVVAPE 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   + M+  AE IL++L L YRV++LCTGD+GFSA KT+DLEVWL  QN YREISSC
Sbjct: 298 ASYAALDEMVGHAEAILQKLGLPYRVITLCTGDMGFSAAKTFDLEVWLPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S    FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+A+LENY NADGSVT+P  L
Sbjct: 358 SNTEAFQARRMQARFRNAQGK-PELVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPEAL 416

Query: 414 RPYMNNLAVI 423
           RPYM  +  I
Sbjct: 417 RPYMGGIERI 426


>gi|293396837|ref|ZP_06641111.1| serine-tRNA ligase [Serratia odorifera DSM 4582]
 gi|291420308|gb|EFE93563.1| serine-tRNA ligase [Serratia odorifera DSM 4582]
          Length = 430

 Score =  435 bits (1118), Expect = e-120,   Method: Composition-based stats.
 Identities = 198/431 (45%), Positives = 264/431 (61%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R   + +   L +R  +   + + S +E+ ++L    E ++A RNS S  IG 
Sbjct: 1   MLDPNLLRNELDAVAEKLARRGFKLDLDLLRSQEERRKVLQVATETLQAERNSRSKSIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E  ++ S ++     +PN+P + VP G   +
Sbjct: 61  AKARG--EDIEPLRREVNDLGEKLDAAKAELDKLQSEIRDYALALPNLPDDSVPNGKDES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN  +   G+        R+H E+GE  G +DF  A KL+GARF V+ G +A + RAL Q
Sbjct: 119 ENQEVSRWGEPRQYDFSVRDHVELGEMAGGLDFASAVKLTGARFVVMKGQIARMHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY E   P LV    +YGTGQ+PKF +D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYLETYVPYLVNHATLYGTGQLPKFGEDLFHTKPLEEESDSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI+E +SLPL+ T   P FRSEAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEILEEESLPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E +   AE++L+ L+L YR V LCTGD+GF + KTYDLEVWL  QN YREISS
Sbjct: 299 EDSMDALEELTGHAEKVLQLLNLPYRKVLLCTGDMGFGSSKTYDLEVWLPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R+   K  +  HTLNGSG+AVGR L+A+LENY  ADG + +P V
Sbjct: 359 CSNMWDFQARRMQARCRNKTEKKPRLVHTLNGSGLAVGRTLVAVLENYQQADGRIQVPDV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMGGLEYI 429


>gi|149908479|ref|ZP_01897142.1| seryl-tRNA synthetase [Moritella sp. PE36]
 gi|149808642|gb|EDM68577.1| seryl-tRNA synthetase [Moritella sp. PE36]
          Length = 428

 Score =  435 bits (1118), Expect = e-120,   Method: Composition-based stats.
 Identities = 190/427 (44%), Positives = 263/427 (61%), Gaps = 8/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD +++R + E     L  R  E   + I SL+E+ + L  + E ++  RN  S  IG+
Sbjct: 1   MLDPKFLRADLEEAKQRLASRGFELDVDTIKSLEEQRKALQIRTEQLQNDRNVRSKSIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    V +L  E   L E+L + + E  E+ + ++ +   +PN+P   VP G   +
Sbjct: 61  AKASG--EDVQSLLAEVGKLGEELDVAKAELAELLTKIEDIALSLPNLPHSSVPQGQDED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ ++  G+        ++H ++GEAL  +DF  A K+SG+RF V+ G +A + RA+ Q
Sbjct: 119 DNVELKRWGQPKEFDFEIKDHVDVGEALNGLDFKTAVKISGSRFIVMRGQVARMHRAIAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG------RWLIPTSEV 234
           FM+D HT EHGYTE+  P LV  +++YGT Q+PKF +D+F T           LIP++EV
Sbjct: 179 FMLDTHTEEHGYTELYVPYLVNADSLYGTAQLPKFGEDLFHTKPATEEGQGLSLIPSAEV 238

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            +TN     I +   LP+R T   P FRSEAGS GRDTRG++RQHQF K E+V +   E 
Sbjct: 239 PVTNTARDTITDEADLPVRLTAHTPCFRSEAGSYGRDTRGLIRQHQFDKVEMVQLAHPEK 298

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCS 354
           S+   E M   AE IL +L+L YRVV+LCTGD+GFSA KTYDLEVW+  Q  YREISS S
Sbjct: 299 SYEALEEMCQHAENILIKLNLPYRVVTLCTGDMGFSAAKTYDLEVWVPAQKTYREISSIS 358

Query: 355 TCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR 414
            C +FQ+RR+++R R  ++K     HTLNGSG+AVGR L+AILENY   DG V +P VLR
Sbjct: 359 NCEDFQARRLHARTRLKDNKKPVLLHTLNGSGLAVGRTLVAILENYQLEDGRVEVPEVLR 418

Query: 415 PYMNNLA 421
            YM  L 
Sbjct: 419 GYMGGLT 425


>gi|302390825|ref|YP_003826645.1| seryl-tRNA synthetase [Acetohalobium arabaticum DSM 5501]
 gi|302202902|gb|ADL11580.1| seryl-tRNA synthetase [Acetohalobium arabaticum DSM 5501]
          Length = 426

 Score =  435 bits (1118), Expect = e-120,   Method: Composition-based stats.
 Identities = 181/427 (42%), Positives = 265/427 (62%), Gaps = 3/427 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++++R+N   +   L++R  +   +     DEK R ++ ++E ++ RRN  S +IG+
Sbjct: 1   MLDLRFVRENTGLIKKVLEQRGTDANIDEFKEYDEKRRDVLYEVEQLKHRRNEASEKIGE 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G       L  E   + +++  L++   E    + +++  IPN+P E+VP+G    
Sbjct: 61  LKRKG--EDASELIEEMREVSDKISELDEIVAECEEKINEILLTIPNIPHEDVPVGDDEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +NI+     +        + H++IGE L ++DF+R  K+SG+RF+ L    A LERAL  
Sbjct: 119 DNIVAWKWEEPTEFDFEPQPHWDIGEELDILDFERGAKVSGSRFTFLKNLGARLERALIA 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT-DGRWLIPTSEVSLTNL 239
           FMID+HT EHGY EV  P +VR E+M GTGQ+PKF +D F       +LIPT+EV +TN+
Sbjct: 179 FMIDIHTEEHGYNEVFPPFIVRGESMVGTGQLPKFEEDAFKIEGTNHYLIPTAEVPVTNM 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y  EI++   LP+     +  FR+EAG+ GRDTRG++RQHQF K ELV       S+ E 
Sbjct: 239 YRDEIMDKDELPIYHVAYSGCFRAEAGAHGRDTRGIIRQHQFNKVELVKFVEPGTSYDEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E+++  AE++L+RL+L YRV+++CTGDLGF+A K YDLEVW    + YRE+SSCS   +F
Sbjct: 299 EKLVKNAEKVLQRLELPYRVMNMCTGDLGFTAAKKYDLEVWFPSYDTYREVSSCSNFEDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR   RYR       +F HTLNGSG+A+GR + AILENY   DGSV IP  L+PYM  
Sbjct: 359 QARRAGIRYRPEPDAKAEFVHTLNGSGLAIGRTVAAILENYQQEDGSVIIPEALQPYMKG 418

Query: 420 LAVIKKE 426
           +  I  +
Sbjct: 419 IEKITPK 425


>gi|116689002|ref|YP_834625.1| seryl-tRNA synthetase [Burkholderia cenocepacia HI2424]
 gi|162218059|ref|YP_620385.2| seryl-tRNA synthetase [Burkholderia cenocepacia AU 1054]
 gi|166200606|sp|A0K5F5|SYS_BURCH RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|116647091|gb|ABK07732.1| seryl-tRNA synthetase [Burkholderia cenocepacia HI2424]
          Length = 433

 Score =  435 bits (1118), Expect = e-120,   Method: Composition-based stats.
 Identities = 199/430 (46%), Positives = 270/430 (62%), Gaps = 11/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R +    E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDLDGVAKRLADRGYTLDVAAFSALEAERRAIQTHTEELQARRNSLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A+  E   + + +   E +  E+ + L  L+  +PNV  E VP+G    
Sbjct: 61  MKGKG--EDTSAVMAEVGGIGDDMKASEAKLGEIQARLSDLMLGMPNVAHESVPVGKDEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+  R  G         ++H ++G  LG +DF+   KL+GARF++L G +A L RAL Q
Sbjct: 119 DNVEARRWGTPRQFDFEVKDHVDVGTPLG-LDFETGAKLAGARFTMLRGPIARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FMID HT +HGYTE   P +V  E +YGTGQ+PKFADDMF            ++LI TSE
Sbjct: 178 FMIDTHTQQHGYTETYTPYIVNPEILYGTGQLPKFADDMFRVEKGGAENTVTQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     I+++ +LP++ T  +P FRSEAGS GRDTRGM+RQHQF K E+V +   E
Sbjct: 238 ISLTNTVRESIVDASALPIKLTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQVVAPE 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   + M+  AE IL++L L YRV++LCTGD+GFSA KT+DLEVWL  QN YREISSC
Sbjct: 298 TSYAALDEMVGHAEAILQKLGLPYRVITLCTGDMGFSAAKTFDLEVWLPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S    FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+A+LENY NADGSVT+P VL
Sbjct: 358 SNTEAFQARRMQARFRNAQGK-PELVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPEVL 416

Query: 414 RPYMNNLAVI 423
           RPYM  +  I
Sbjct: 417 RPYMGGMERI 426


>gi|105892247|gb|ABF75412.1| seryl-tRNA synthetase [Burkholderia cenocepacia AU 1054]
          Length = 471

 Score =  435 bits (1118), Expect = e-120,   Method: Composition-based stats.
 Identities = 199/430 (46%), Positives = 270/430 (62%), Gaps = 11/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R +    E+++ARRNS S QIG 
Sbjct: 39  MLDIQLLRKDLDGVAKRLADRGYTLDVAAFSALEAERRAIQTHTEELQARRNSLSKQIGA 98

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A+  E   + + +   E +  E+ + L  L+  +PNV  E VP+G    
Sbjct: 99  MKGKG--EDTSAVMAEVGGIGDDMKASEAKLGEIQARLSDLMLGMPNVAHESVPVGKDEA 156

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+  R  G         ++H ++G  LG +DF+   KL+GARF++L G +A L RAL Q
Sbjct: 157 DNVEARRWGTPRQFDFEVKDHVDVGTPLG-LDFETGAKLAGARFTMLRGPIARLHRALAQ 215

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FMID HT +HGYTE   P +V  E +YGTGQ+PKFADDMF            ++LI TSE
Sbjct: 216 FMIDTHTQQHGYTETYTPYIVNPEILYGTGQLPKFADDMFRVEKGGAENTVTQYLISTSE 275

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     I+++ +LP++ T  +P FRSEAGS GRDTRGM+RQHQF K E+V +   E
Sbjct: 276 ISLTNTVRESIVDASALPIKLTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQVVAPE 335

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   + M+  AE IL++L L YRV++LCTGD+GFSA KT+DLEVWL  QN YREISSC
Sbjct: 336 TSYAALDEMVGHAEAILQKLGLPYRVITLCTGDMGFSAAKTFDLEVWLPAQNTYREISSC 395

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S    FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+A+LENY NADGSVT+P VL
Sbjct: 396 SNTEAFQARRMQARFRNAQGK-PELVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPEVL 454

Query: 414 RPYMNNLAVI 423
           RPYM  +  I
Sbjct: 455 RPYMGGMERI 464


>gi|240141053|ref|YP_002965533.1| serine tRNA synthetase; also charges selenocystein tRNA with serine
           [Methylobacterium extorquens AM1]
 gi|240011030|gb|ACS42256.1| serine tRNA synthetase; also charges selenocystein tRNA with serine
           [Methylobacterium extorquens AM1]
          Length = 428

 Score =  435 bits (1118), Expect = e-120,   Method: Composition-based stats.
 Identities = 234/428 (54%), Positives = 298/428 (69%), Gaps = 1/428 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NPE  D  L++R L P S  +++LD+  +  +   +  + RRN+ S +IG 
Sbjct: 1   MHDIRAIRENPEAFDRDLERRGLAPLSAELIALDDARKGAVSAAQAAQERRNALSKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A    + +    L  E + LKE+ P LE  + E   +L + ++ IPN P ++VP G   +
Sbjct: 61  AKKAKDEARATELMAEVARLKEEAPGLEAAQGEAAKALDERLAAIPNRPKDDVPPGADEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+  R        +   R+HFE+GEA GLMDF+ A KLSG+RF VL G LA LERALGQ
Sbjct: 121 GNVEYRRFDSSRERLTQGRQHFELGEATGLMDFEAAAKLSGSRFVVLKGQLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT EHGYTEV  P+LVR+EAM+GT Q+PKF DD F   +  WLIPT+EV LTNL 
Sbjct: 181 FMLDLHTGEHGYTEVVPPVLVREEAMFGTAQLPKFRDDQFAAGENFWLIPTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
              I+    LPLRFT L P FR+EAG+AGRDTRGMLRQHQF K ELVSIT  E S  EHE
Sbjct: 241 RESILAEDELPLRFTALTPCFRAEAGAAGRDTRGMLRQHQFNKVELVSITAPEKSAEEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML+CAE +L++LDL YRV++LCTGD+GF++ KTYD+EVW+ GQ  YREISSCS CG FQ
Sbjct: 301 RMLACAEAVLQKLDLTYRVMTLCTGDMGFASQKTYDIEVWVPGQQTYREISSCSVCGEFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR    + + F HTLNGSGVAVGR LIA++ENY N DGSVTIP+ L+PYM  L
Sbjct: 361 ARRMNARYRAKEGRGVGFVHTLNGSGVAVGRALIAVMENYQNPDGSVTIPSALQPYMGGL 420

Query: 421 AVIK-KEH 427
             I+  ++
Sbjct: 421 TRIEGPKN 428


>gi|23097467|ref|NP_690933.1| seryl-tRNA synthetase [Oceanobacillus iheyensis HTE831]
 gi|30173160|sp|Q8EU77|SYS_OCEIH RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|22775690|dbj|BAC11968.1| seryl-tRNA synthetase [Oceanobacillus iheyensis HTE831]
          Length = 424

 Score =  435 bits (1118), Expect = e-120,   Method: Composition-based stats.
 Identities = 181/425 (42%), Positives = 265/425 (62%), Gaps = 4/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++++RQN E +   L+ R  +    +    LD   R LI + E ++A+RN  + +I 
Sbjct: 1   MLDMKYLRQNFEEVQQRLQHRGEDLADLDKFGELDTNRRQLIAETEKLKAQRNEATKKIS 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           +   E      +    E   + +++  L+K+  ++   L++++  IPN+P E VP+G   
Sbjct: 61  ELKREKK--DAEPAIKEMREVGQEIATLDKQLKDIEEKLEQIMLSIPNLPHESVPVGEDE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            +NI  R  G+ P+    +  H+++   L ++DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 EDNIEARKWGEAPNFAFEALPHWDVATNLDIIDFERAGKVTGSRFVFYKGLGARLERALW 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-TTDGRWLIPTSEVSLTN 238
            FM+DLH  EHGY E+  P +V   +M GTGQ+PKF +D F       +++PT+EV +TN
Sbjct: 179 NFMMDLHADEHGYQEMLPPYIVNRSSMTGTGQLPKFEEDAFKLEEWDYFMVPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            +  EI+    LP ++   + SFRSEAGSAGRDTRG++RQHQF K ELV+  + EDS+  
Sbjct: 239 YHREEILGIDDLPKKYVAFSASFRSEAGSAGRDTRGLIRQHQFNKVELVNFVKPEDSYDV 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            ER+   AE++L+ L L YRV+S+CTGDLGF+A K YD+EVW+  Q  YREISSCS   +
Sbjct: 299 LERLTGEAEKVLQLLKLPYRVMSMCTGDLGFTAAKKYDIEVWIPSQETYREISSCSNFED 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   R+R   +   +F HTLNGSG+A+GR + AILENY   DG+V +P VLRPYM 
Sbjct: 359 FQARRAGIRFRREANGKPEFVHTLNGSGLAIGRTVAAILENYQQEDGTVVVPEVLRPYMG 418

Query: 419 NLAVI 423
              +I
Sbjct: 419 GKEII 423


>gi|325528345|gb|EGD05497.1| seryl-tRNA synthetase [Burkholderia sp. TJI49]
          Length = 433

 Score =  435 bits (1118), Expect = e-120,   Method: Composition-based stats.
 Identities = 195/430 (45%), Positives = 270/430 (62%), Gaps = 11/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R +  + E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDLDGVAKRLADRGYTLDVAAFSALEAERRAIQTRTEELQARRNSLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A+  E   + +++     +  E+   L  L+  +PN+  E VP+G    
Sbjct: 61  MKGKG--EDTSAVMAEVGGIGDEMKASATQLDEIQQRLSDLMLGMPNIAHESVPVGKDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G         ++H ++G  LG +DF+   KL+GARF++L G +A L RAL Q
Sbjct: 119 DNVEVRRWGTPRQFDFDVKDHVDVGTPLG-LDFETGAKLAGARFTMLRGPIARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM+D HT +HGY+E   P +V  E +YGTGQ+PKFADDMF            ++LI TSE
Sbjct: 178 FMLDTHTQQHGYSETYTPYIVNPEILYGTGQLPKFADDMFRVEKGGAENTVTQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     I+E+ +LP++ T  +P FRSEAGS GRDTRGM+RQHQF K E+V +   E
Sbjct: 238 ISLTNTVRDSIVEASALPIKLTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQVVAPE 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   + M+  AE IL++L L YRV++LCTGD+GFSA KT+DLEVWL  QN YREISSC
Sbjct: 298 TSYAALDEMVGHAEAILQKLGLPYRVITLCTGDMGFSAAKTFDLEVWLPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S    FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+A+LENY NADGSVT+P  L
Sbjct: 358 SNTEAFQARRMQARFRNAQGK-PELVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPEAL 416

Query: 414 RPYMNNLAVI 423
           RPYM  +  I
Sbjct: 417 RPYMGGMERI 426


>gi|154483909|ref|ZP_02026357.1| hypothetical protein EUBVEN_01615 [Eubacterium ventriosum ATCC
           27560]
 gi|149735400|gb|EDM51286.1| hypothetical protein EUBVEN_01615 [Eubacterium ventriosum ATCC
           27560]
          Length = 427

 Score =  434 bits (1117), Expect = e-120,   Method: Composition-based stats.
 Identities = 184/429 (42%), Positives = 258/429 (60%), Gaps = 5/429 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+ +R N E ++ AL  R+ E        LDEK R L+ ++E ++A +N+ S  I Q
Sbjct: 1   MLDIKLLRNNFEEVEKALSTRNEEFDLSLFKDLDEKRRNLLGEVEALKAEQNATSKLIPQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG    V  +  E   + E++  L  E  +    L   +  +PN+P   VP G +  
Sbjct: 61  YKKEGK--DVAPIMAEMKEISEKVKTLNGELSKAEEDLNNYMLTLPNIPNPTVPQGMTDE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ IR  G+        + H+++G  LG++D + A K+SG+RF+V     A LERA+  
Sbjct: 119 DNVEIRKFGEPTKFDFEPKAHWDLGADLGILDPETAAKISGSRFTVYRDLGAKLERAIVN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT---DGRWLIPTSEVSLT 237
           F +D HT++HGYTEV  P +V  E+M GTGQ+PKF +D +         +L+PT+EV +T
Sbjct: 179 FFLDTHTTKHGYTEVFPPFMVSRESMTGTGQLPKFEEDAYKVQGDGKEYFLVPTAEVPVT 238

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           N+Y ++I++   LP+        FR+EAGSAGRDTRG++RQHQF K ELV   + E S+ 
Sbjct: 239 NMYRNQILDGSKLPIMHCAYTACFRAEAGSAGRDTRGLIRQHQFNKVELVKFCKPETSYD 298

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E E++   AE++L+ L L YRVV +C GDLGF+A   YD+EVW+     Y EISSCS   
Sbjct: 299 ELEKLTRDAEDVLQMLGLPYRVVKICIGDLGFTAAMKYDIEVWMPSYGRYVEISSCSNFE 358

Query: 358 NFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
            FQ+RR N +Y+D      +F HTLNGSGVA GR   AILENY  ADGS+ IP VLRPYM
Sbjct: 359 TFQARRANIKYKDNAGDKAEFVHTLNGSGVAAGRTTAAILENYQQADGSIVIPEVLRPYM 418

Query: 418 NNLAVIKKE 426
             L  I+ +
Sbjct: 419 GGLEKIEAK 427


>gi|163853631|ref|YP_001641674.1| seryl-tRNA synthetase [Methylobacterium extorquens PA1]
 gi|238687369|sp|A9VY49|SYS_METEP RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|163665236|gb|ABY32603.1| seryl-tRNA synthetase [Methylobacterium extorquens PA1]
          Length = 428

 Score =  434 bits (1117), Expect = e-120,   Method: Composition-based stats.
 Identities = 234/428 (54%), Positives = 298/428 (69%), Gaps = 1/428 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NPE  D  L++R L P S  +++LD+  +  +   +  + RRN+ S +IG 
Sbjct: 1   MHDIRAIRENPEAFDRDLERRGLAPLSAELIALDDARKGAVSAAQAAQERRNALSKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A    + +    L  E + LKE+ P LE  + E   +L + ++ IPN P ++VP G   +
Sbjct: 61  AKKAKDEARATELMAEVARLKEEAPGLEAAQGEAAKALDERLAAIPNRPKDDVPPGADEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+  R        +   R+HFE+GEA GLMDF+ A KLSG+RF VL G LA LERALGQ
Sbjct: 121 GNVEYRRFDSSRERLAQGRQHFELGEATGLMDFEAAAKLSGSRFVVLKGQLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT EHGYTEV  P+LVR+EAM+GT Q+PKF DD F   +  WLIPT+EV LTNL 
Sbjct: 181 FMLDLHTGEHGYTEVVPPVLVREEAMFGTAQLPKFRDDQFAAGENFWLIPTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
              I+    LPLRFT L P FR+EAG+AGRDTRGMLRQHQF K ELVSIT  E S  EHE
Sbjct: 241 RESILAEDELPLRFTALTPCFRAEAGAAGRDTRGMLRQHQFNKVELVSITAPEKSAEEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML+CAE +L++LDL YRV++LCTGD+GF++ KTYD+EVW+ GQ  YREISSCS CG FQ
Sbjct: 301 RMLACAEAVLQKLDLTYRVMTLCTGDMGFASQKTYDIEVWVPGQQTYREISSCSVCGEFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR    + + F HTLNGSGVAVGR LIA++ENY N DGSVTIP+ L+PYM  L
Sbjct: 361 ARRMNARYRAKEGRGVGFVHTLNGSGVAVGRALIAVMENYQNPDGSVTIPSALQPYMGGL 420

Query: 421 AVIK-KEH 427
             I+  ++
Sbjct: 421 TRIEGPKN 428


>gi|126732587|ref|ZP_01748384.1| seryl-tRNA synthetase [Sagittula stellata E-37]
 gi|126706871|gb|EBA05940.1| seryl-tRNA synthetase [Sagittula stellata E-37]
          Length = 430

 Score =  434 bits (1117), Expect = e-120,   Method: Composition-based stats.
 Identities = 207/429 (48%), Positives = 279/429 (65%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NPE LD AL +R  EP S  +L+LD + R  I   E  +A +N  S ++G+
Sbjct: 1   MHDIRAIRENPETLDAALGRRGAEPMSSAVLALDAERRAAILAAETAQADQNRASKEVGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  + L+   +  K ++  ++++   + + L  L+  +PN+PL +VP G   N
Sbjct: 61  AKASGDEAEFERLRALVAEKKAEVAEMQEKAKVLDTQLTDLLMGLPNLPLADVPDGADEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ IR  G+  S     +EH+E+      MDF+ A KLSG+RF +L+G +A + RAL Q
Sbjct: 121 DNVEIRRWGEPRSFDFTPKEHYELEGVKPGMDFETAAKLSGSRFVLLSGGVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H  EH   E   P+LVR E MYGTGQ+PKF +D + TT+G WLIPTSEV+LTN+ 
Sbjct: 181 FMLDTHVEEHDLAETWTPVLVRPEMMYGTGQLPKFGEDSYETTNGWWLIPTSEVTLTNIV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           +   ++   LP R+   +  FRSEAGSAGRDT GMLRQHQF K E+V++   + S  EHE
Sbjct: 241 NGLTVDEGYLPRRYAAHSQCFRSEAGSAGRDTSGMLRQHQFEKVEMVTVCHPDKSLEEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE IL++L L YR V LCTGD+GF A KT+D+EVWL GQN YREISS STCG+FQ
Sbjct: 301 RMTRCAEAILEKLGLPYRTVVLCTGDIGFGAQKTHDIEVWLPGQNTYREISSVSTCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RY+        F HTLNGSG+AVGR LIA+LEN   ADGSV +P  L P++   
Sbjct: 361 ARRMNARYKPTEGGKPGFLHTLNGSGLAVGRALIAVLENGQQADGSVDLPEALHPWLRGK 420

Query: 421 AVIKKEHIL 429
             +     L
Sbjct: 421 TRLDASGNL 429


>gi|229083329|ref|ZP_04215689.1| Seryl-tRNA synthetase [Bacillus cereus Rock3-44]
 gi|228699976|gb|EEL52601.1| Seryl-tRNA synthetase [Bacillus cereus Rock3-44]
          Length = 424

 Score =  434 bits (1117), Expect = e-120,   Method: Composition-based stats.
 Identities = 186/426 (43%), Positives = 264/426 (61%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+++R N E +   L+ R  +         LD + R L+ + E+++++RN  S QI 
Sbjct: 1   MLDIKFLRANFEEVKAKLQHRGEDLTDFGRFEELDIRRRELLVQTEELKSKRNEVSQQIS 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      +AL  E   + E++   + E   V   L++L+  IPN+P E  PIG + 
Sbjct: 61  VLKREKK--DAEALILEMREVGEKVKKFDDELRSVEEDLERLMLSIPNIPHESAPIGDTE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N++ R+ G+        + H+++   LG++DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 DDNVVTRTWGEIKEFNFEPKPHWDLATDLGILDFERAAKVTGSRFVFSKGAGAKLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLHT EH Y EV  P +V   +M GTGQ+PKF +D F      +  IPT+EV +TN
Sbjct: 179 SFMLDLHTEEHEYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIESEDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           ++  EI+    LP+R+   +  FRSEAGSAGRDTRG++RQHQF K ELV   + EDS+ E
Sbjct: 239 MHRDEILNVDQLPIRYAAFSACFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++ + AE +L+ L L YRV+S+CTGDLGF+A K YD+EVW+     YREISSCS    
Sbjct: 299 LEKLTNDAERVLQLLGLPYRVMSMCTGDLGFTAAKKYDIEVWIPSYGTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R   +   +  HT+NGSG+A+GR + AILENY   DG++ IP VLRPYM 
Sbjct: 359 FQARRANIRFRREPNAKPEHVHTINGSGLAIGRTIAAILENYQQEDGTIIIPEVLRPYMG 418

Query: 419 NLAVIK 424
              VIK
Sbjct: 419 GKTVIK 424


>gi|157375268|ref|YP_001473868.1| seryl-tRNA synthetase [Shewanella sediminis HAW-EB3]
 gi|189083588|sp|A8FV67|SYS_SHESH RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|157317642|gb|ABV36740.1| Serine--tRNA ligase [Shewanella sediminis HAW-EB3]
          Length = 428

 Score =  434 bits (1117), Expect = e-120,   Method: Composition-based stats.
 Identities = 197/429 (45%), Positives = 269/429 (62%), Gaps = 8/429 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD +++R   E     L  R      E +  L+EK + L    E+++A RN+ S  IGQ
Sbjct: 1   MLDPKFLRTELEATAERLATRGFILDVERLSKLEEKRKSLQMATEELQASRNAISKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G    V  +  +   L  QL   ++E  E+  +L  +   +PN+P E VP G   +
Sbjct: 61  AKAKG--EDVAPIMAQVGDLGSQLDTKKQELAELLETLNAIAMSVPNLPDESVPAGADES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G         ++H E+GE LG +DF  A K++G RF ++ G +A + RAL Q
Sbjct: 119 ENVEVRRWGTPKEFNFEVKDHVELGETLGGLDFKAAVKITGTRFIIMKGQIARMNRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG------RWLIPTSEV 234
           FM+DLHT+EHGYTE   PLLV +E++ GTGQ+PKF +D+F T           LIPT+EV
Sbjct: 179 FMLDLHTTEHGYTEAYVPLLVNEESLLGTGQLPKFGEDLFHTKPATEEGQGLSLIPTAEV 238

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            LTN+    II+   LP++ T   P FRSEAGS GRDTRG++RQHQF K ELV + + ED
Sbjct: 239 PLTNIARDTIIDEADLPVKLTAHTPCFRSEAGSYGRDTRGLIRQHQFDKVELVQLVKPED 298

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCS 354
           S    + +   AE +L++L+L YR V LCTGD+GF + KT+D+EVWL  QN YREISSCS
Sbjct: 299 SMAALDSLTGHAETVLQKLELPYRTVVLCTGDMGFGSSKTFDIEVWLPAQNTYREISSCS 358

Query: 355 TCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR 414
              +FQ+RRM +RY+  ++K     HTLNGSG+AVGR L+A++ENY N DGS+T+P VLR
Sbjct: 359 NMQDFQARRMQARYKAKSAKKPALLHTLNGSGLAVGRTLVAVIENYQNEDGSITVPEVLR 418

Query: 415 PYMNNLAVI 423
           PYM  L  I
Sbjct: 419 PYMGGLEKI 427


>gi|295402717|ref|ZP_06812659.1| seryl-tRNA synthetase [Geobacillus thermoglucosidasius C56-YS93]
 gi|312109164|ref|YP_003987480.1| seryl-tRNA synthetase [Geobacillus sp. Y4.1MC1]
 gi|294975248|gb|EFG50884.1| seryl-tRNA synthetase [Geobacillus thermoglucosidasius C56-YS93]
 gi|311214265|gb|ADP72869.1| seryl-tRNA synthetase [Geobacillus sp. Y4.1MC1]
          Length = 424

 Score =  434 bits (1117), Expect = e-120,   Method: Composition-based stats.
 Identities = 189/426 (44%), Positives = 267/426 (62%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++++R + + +   ++KR  +    +    LD+K R LI K E+++ +RN  S QI 
Sbjct: 1   MLDVKYLRNHFQEVKERIQKRGGDLANMDRFAELDKKRRELIAKAEELKNKRNEVSQQIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      + L  E   + +++  ++ E  +V   L  L+  IPN+P E VP+G S 
Sbjct: 61  VLKREKK--DANHLIAEMREVGDRIKAMDDEIRQVEEELNALLLSIPNIPHESVPVGKSE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            +N+ +R  G+  S     + H++I + LG++DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 EDNVEVRKWGEPRSFSFEPKPHWDIADQLGILDFERAAKVTGSRFVFYKGLGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+D+H  E GY E+  P LV   +M GTGQ+PKF +D F      +  IPT+EV +TN
Sbjct: 179 NFMLDVHIEEFGYQEILPPYLVNRASMTGTGQLPKFEEDAFRIETEDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L+  EI+ ++ LP+ +   +  FR+EAG+AGRDTRG++RQHQF K ELV   + EDS+ E
Sbjct: 239 LHRDEILSAEDLPIYYAAYSACFRAEAGAAGRDTRGLIRQHQFNKVELVKFVKPEDSYDE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++ + AE IL+ L L YRVV LCTGDLGF+A KTYD+EVWL     YREISSCS    
Sbjct: 299 LEKLTNQAERILQLLGLPYRVVCLCTGDLGFAAAKTYDIEVWLPSYGTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R       ++ HTLNGSG+A+GR + AILENY   DG+V IP VLRPYM 
Sbjct: 359 FQARRANIRFRREPKSKPEYVHTLNGSGLAIGRTVAAILENYQQEDGTVVIPEVLRPYMG 418

Query: 419 NLAVIK 424
           N  VI+
Sbjct: 419 NREVIR 424


>gi|310767171|gb|ADP12121.1| seryl-tRNA synthetase [Erwinia sp. Ejp617]
          Length = 430

 Score =  434 bits (1117), Expect = e-120,   Method: Composition-based stats.
 Identities = 198/431 (45%), Positives = 267/431 (61%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + + +E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGYKLDVDTLRAHEERRKVLQVETENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + +S+      IPN+P + VP+G   +
Sbjct: 61  AKACG--EDIEPLRQEMNALGERLDAAKAELDALLTSINDFSMAIPNIPADVVPLGKDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN  I   G         R+H E+GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 ENQEIGRWGVPRKFDFTVRDHVELGERAAGLDFAAAVKLTGSRFIVMKGQIALMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY E   P LV   ++ GTGQ+PKF +D+F T             LIPTS
Sbjct: 179 FMLDLHTEQHGYQETYVPYLVNHASLNGTGQLPKFGEDLFHTRPLDEEASSSNYALIPTS 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI+E +SLPL+ T   P FRSEAG+ GRDTRG++R HQF K E+V +TR 
Sbjct: 239 EVPLTNLVRDEILEEESLPLKMTAHTPCFRSEAGAYGRDTRGLIRMHQFDKVEMVHVTRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E ++  AE++L+ L+L YR V LCTGD+GF A KTYDLEVWL  Q+ YREISS
Sbjct: 299 EDSMDALEELVGHAEKVLQLLNLPYRKVLLCTGDMGFGAQKTYDLEVWLPAQDTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS  G+FQ+RRM +R R       +  HTLNGSG+AVGR L+A+LENY  ADG + +P V
Sbjct: 359 CSNMGDFQARRMKARCRPKGETKTRLVHTLNGSGLAVGRTLVAVLENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMKGLTFI 429


>gi|330840034|ref|YP_004414614.1| Seryl-tRNA synthetase [Selenomonas sputigena ATCC 35185]
 gi|329747798|gb|AEC01155.1| Seryl-tRNA synthetase [Selenomonas sputigena ATCC 35185]
          Length = 425

 Score =  434 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 189/426 (44%), Positives = 277/426 (65%), Gaps = 3/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+++R + + +   L+KR    +      L+EK R L+++ E+++ARRNS S +IG 
Sbjct: 1   MLDIKFVRDHIDEVQAMLEKRCNPLKLSGFKELEEKRRTLLQEAEELKARRNSVSKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G    V A+  E   + +++  L+    EV   L  ++  IPN+P ++VPIG    
Sbjct: 61  KKKQG--EDVAAISAEMREVGKKIADLDARTREVEDELHTILLNIPNMPKDDVPIGKDDT 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN  +R  G+  +     + H+++G  L ++D +RA K++GARF+   G  A LERA   
Sbjct: 119 ENPEVRRWGEPRTFTFEPKAHWDLGADLEILDAERAAKVTGARFTFYKGLGARLERACIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-TTDGRWLIPTSEVSLTNL 239
           FM+DLH ++HGYTE+ AP +  + +M GTGQ+PKFA+DMF       +L+PT+EV  TN 
Sbjct: 179 FMMDLHATKHGYTEMLAPYIANEASMIGTGQLPKFAEDMFKLEGLDYYLVPTAEVPTTNY 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +  EI++ + LP R+T+    FR+EAGSAGRDTRG++RQHQF K EL+  T+ E+S+ E 
Sbjct: 239 HRDEILDGRKLPERYTSYTACFRAEAGSAGRDTRGLIRQHQFNKVELIKFTKPEESWDEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E M+  AE++L+ L++ Y VV LCTGD+ F++ KTYD+EVW+  QN YREISSCS C ++
Sbjct: 299 EGMVDAAEDVLRILEIPYHVVLLCTGDMSFTSAKTYDIEVWMPAQNTYREISSCSNCLDY 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N ++R       +F HTLNGSG+AVGR + AILENY   DGSV +P  L PYM  
Sbjct: 359 QARRANIKFRREPKAKPEFCHTLNGSGLAVGRTVAAILENYQQEDGSVRVPKALVPYMGG 418

Query: 420 LAVIKK 425
           + VI+K
Sbjct: 419 VEVIEK 424


>gi|304391793|ref|ZP_07373735.1| seryl-tRNA synthetase [Ahrensia sp. R2A130]
 gi|303296022|gb|EFL90380.1| seryl-tRNA synthetase [Ahrensia sp. R2A130]
          Length = 426

 Score =  434 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 231/426 (54%), Positives = 300/426 (70%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+WIR NPE  D  + +R L PQS+ +L+LDE  R  I K+++ +  RN+ S +IG 
Sbjct: 1   MFDIKWIRDNPEAFDQGMARRGLGPQSDRLLALDEARRDHISKVQEAQEARNAASKKIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+ +   A  +E + LK  L     EE  + ++L + +S + NVP ++VP G    
Sbjct: 61  AKAQGDEAGAQAAISEVAKLKSFLQTGADEERTLSAALSEALSTLDNVPADDVPDGADEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+     G++P+     +EH+E+GEALG MDFD A KLSG+RF VL   LA LERALGQ
Sbjct: 121 DNVETHRHGEQPAFAFKPKEHWELGEALGQMDFDAAAKLSGSRFVVLNRGLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLH  EH Y EV+ P+LVR E ++G G +PKF DD+F T+D R+LIPTSE  LTNL 
Sbjct: 181 FMVDLHVDEHAYHEVAPPVLVRSEVLFGVGNLPKFEDDLFKTSDDRYLIPTSEAPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
              I++ K+LP R+T L   FR+EAGSAGRDTRGMLRQHQF KCE+VSIT  ++S  E +
Sbjct: 241 RESILDEKTLPRRYTALTNCFRAEAGSAGRDTRGMLRQHQFAKCEMVSITTPDNSDAEQQ 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM+ CAEE+LKRL LHYRVV LCTGDLGFSA +T D+EVWL GQ+ +REISSCSTCG+FQ
Sbjct: 301 RMVGCAEEVLKRLGLHYRVVKLCTGDLGFSARRTLDIEVWLPGQDTFREISSCSTCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM++RYR    K     HTLNGSG+AVGR LIA++ENY N DGS+ +P VL+ YM   
Sbjct: 361 ARRMDARYRPEGEKQPVHVHTLNGSGIAVGRALIAVMENYQNEDGSIRVPDVLQSYMGGT 420

Query: 421 AVIKKE 426
            VI+  
Sbjct: 421 TVIEAT 426


>gi|315633929|ref|ZP_07889218.1| serine--tRNA ligase [Aggregatibacter segnis ATCC 33393]
 gi|315477179|gb|EFU67922.1| serine--tRNA ligase [Aggregatibacter segnis ATCC 33393]
          Length = 438

 Score =  434 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 202/437 (46%), Positives = 269/437 (61%), Gaps = 14/437 (3%)

Query: 1   MLDIQWIRQNPEHLDIALK-KRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           M+D   +R N   +   LK KR        I  L+E+ + L  K E ++A RN+ S  IG
Sbjct: 1   MIDPNLLRNNLAEVAEKLKIKRGFTLDVANITQLEEQRKALQVKTETLQAERNARSKAIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
            A A G    +  L  E   +  +L   + E  +V ++L  +   IPN+P++EVP+G   
Sbjct: 61  AAKARG--EDIAPLLAEVDHMAAELEQGKVELEKVQNALNDIALNIPNIPVDEVPLGKDD 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +EN+ +   G+        ++H  +GE L  +DF  A KL+G+RF V+ G +A L RAL 
Sbjct: 119 SENLEVSRWGEPRKFDFEVKDHVALGENLQGLDFASAVKLTGSRFVVMKGQIAKLHRALA 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-----------TDGRWL 228
           QFM+DLHT +HGYTE   P LV  + +YGTGQ+PKF++D+F T                L
Sbjct: 179 QFMLDLHTEQHGYTEAYVPYLVNHDTLYGTGQLPKFSEDLFHTKPLEGQDPNEVQRTYAL 238

Query: 229 IPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVS 288
           IPT+EV +TNL   +I+E+++LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV 
Sbjct: 239 IPTAEVPVTNLVRGDILEAENLPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQ 298

Query: 289 ITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYR 348
           I   E S    E +   AE++L+ L L YR V LCTGD+GF +CKTYDLEVW+  QN YR
Sbjct: 299 IVEPERSMEALEELTGHAEKVLQLLGLPYRKVLLCTGDMGFGSCKTYDLEVWVPAQNTYR 358

Query: 349 EISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVT 408
           EISSCS   +FQ+RRM +R R    K  +  HTLNGSG+AVGR L+A+LENY NADGS+T
Sbjct: 359 EISSCSNMWDFQARRMQARCRSKGDKKTRLVHTLNGSGLAVGRTLVAVLENYQNADGSIT 418

Query: 409 IPTVLRPYMNNLAVIKK 425
           +P VLRPYM  L VI K
Sbjct: 419 VPEVLRPYMGGLEVIGK 435


>gi|85859585|ref|YP_461787.1| seryl-tRNA synthetase [Syntrophus aciditrophicus SB]
 gi|85722676|gb|ABC77619.1| seryl-tRNA synthetase [Syntrophus aciditrophicus SB]
          Length = 448

 Score =  434 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 194/424 (45%), Positives = 279/424 (65%), Gaps = 3/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+++RQN + +   +++R         +S+D + R +++++E +R  RN+ S  IG+
Sbjct: 24  MLDIKFLRQNVDLVKKKIEERGQGIDLSAFVSMDAERRDILQEVESLRNERNAVSRHIGE 83

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
                       L +   T+  ++  LE+   E   +L  L+  IPN+P E V  G +A 
Sbjct: 84  RKK--RKEDAQDLIDRMGTVSGRIRELEEGLKETEENLHNLLLTIPNIPHESVVCGVNAE 141

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N ++R  G+KP      + H+EIGE L ++DF R  K++GARF++  G  A LERA+  
Sbjct: 142 DNPVVRVWGEKPLFDFSPKPHWEIGEDLSILDFARGAKITGARFTLYRGAGAMLERAIIN 201

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-GRWLIPTSEVSLTNL 239
           FM+DLH  EHGYTE+  P +   ++M GTGQ+PKFA+D+F   +   +LIPT+EV +TN+
Sbjct: 202 FMLDLHIMEHGYTEILPPFMANRDSMTGTGQLPKFAEDLFKIENLEYYLIPTAEVPVTNI 261

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +  EI+E K+LP+ +   +P FR+EAGS G+DTRG++RQHQF K E+V  T  E S+ E 
Sbjct: 262 HREEILEEKALPIYYVAYSPCFRAEAGSYGKDTRGLIRQHQFNKVEMVKFTSPETSYDEL 321

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++   AEE+LKRL++ YR VSLCTGDLGFS+ KTYD+E WL GQ+ YREISSCS   +F
Sbjct: 322 EKLTVNAEEVLKRLNIPYRTVSLCTGDLGFSSAKTYDVEAWLPGQDTYREISSCSNFEDF 381

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR + R+R  ++  L F HTLNGSG+A GR L+A+LENY  ADGS+ IP VLRPYM  
Sbjct: 382 QARRASIRFRRESTGKLDFVHTLNGSGLAAGRTLVAVLENYQQADGSIVIPDVLRPYMKG 441

Query: 420 LAVI 423
           +  I
Sbjct: 442 MKKI 445


>gi|255066517|ref|ZP_05318372.1| serine--tRNA ligase [Neisseria sicca ATCC 29256]
 gi|255049101|gb|EET44565.1| serine--tRNA ligase [Neisseria sicca ATCC 29256]
          Length = 431

 Score =  434 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 197/433 (45%), Positives = 273/433 (63%), Gaps = 9/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R +   +   L +R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQQLRSHTAAVAERLAQRGYEFDTARFNALEEQRKAVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP+G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPVGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMKGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T         ++LIPT+E
Sbjct: 180 FMLDTHTLKHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDESKKTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  I+    LPL+ T  +P FRSEAG+ G+D RG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSILAEGDLPLKLTAHSPCFRSEAGAYGKDVRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIKKE 426
           +PYM  +  ++  
Sbjct: 419 QPYMGGVTKLEAR 431


>gi|77459804|ref|YP_349311.1| seryl-tRNA synthetase [Pseudomonas fluorescens Pf0-1]
 gi|123604068|sp|Q3KA84|SYS_PSEPF RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|77383807|gb|ABA75320.1| serine tRNA synthetase; also charges selenocystein tRNA with serine
           [Pseudomonas fluorescens Pf0-1]
          Length = 426

 Score =  434 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 195/427 (45%), Positives = 273/427 (63%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R N + +   L  R        I +L+E+ + +  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRSNLQDVADRLASRGFALDVARIEALEEQRKTVQTRTEALQAERNARSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G    +  L  +   +  +L   + E   + + L  ++  IPN+P E VP+G   +
Sbjct: 61  AKQRG--EDIAPLMADVERMAGELSAGKVELEAIQTELDSILLGIPNLPHESVPVGEDED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G   +     ++H  +GE  G +DF+ A KLSGARF++L G +A L RAL Q
Sbjct: 119 GNVEVRRWGTPTAFDFPVQDHVALGEKFGWLDFETAAKLSGARFALLRGPIARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD----GRWLIPTSEVSL 236
           FMI+LH +EHGY E   P LV+  A+ GTGQ+PKF +D+F          +LIPT+EVSL
Sbjct: 179 FMINLHVTEHGYEEAYTPYLVQAPALQGTGQLPKFEEDLFKIAREGEADLYLIPTAEVSL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+ + EI++SK LP++F    P FRSEAG++GRDTRGM+RQHQF K E+V I     S 
Sbjct: 239 TNIVAGEIVDSKQLPIKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVEPSKSM 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
              E + + AE++L+ L L YR ++LCTGD+GFSA KTYDLEVW+  Q+ YREISSCS C
Sbjct: 299 EALESLTANAEKVLQLLGLPYRTLALCTGDMGFSAVKTYDLEVWIPSQDKYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P VL+PY
Sbjct: 359 GDFQARRMQARFRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPDVLKPY 418

Query: 417 MNNLAVI 423
           M  L VI
Sbjct: 419 MGGLEVI 425


>gi|330503300|ref|YP_004380169.1| seryl-tRNA synthetase [Pseudomonas mendocina NK-01]
 gi|328917586|gb|AEB58417.1| seryl-tRNA synthetase [Pseudomonas mendocina NK-01]
          Length = 426

 Score =  434 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 197/426 (46%), Positives = 269/426 (63%), Gaps = 6/426 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R     +   L  R          +L+ + + +  + E ++A RNS S  IGQ
Sbjct: 1   MLDSKLVRTQLSEIAERLATRGFALDVARFEALESQRKSVQVRTEQLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    +  L  E   +   L   ++E   + + L  L+  IPN+P E VP+G   +
Sbjct: 61  AKARG--EDIAPLLAEVDQMGSDLEAGKRELDAIQNELDNLLLNIPNLPHESVPVGADED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +   G   +     ++H  +GE  G +DF+ A KLSGARF++L G +A L RAL Q
Sbjct: 119 GNVEVARWGAPRTFDFEIKDHVALGEQHGWLDFETAAKLSGARFALLRGPIARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD----GRWLIPTSEVSL 236
           FMI+LHT EHGY E   P LV+  A+ GTGQ+PKF +D+F          +LIPT+EVSL
Sbjct: 179 FMINLHTGEHGYEEAYTPYLVQAPALQGTGQLPKFEEDLFKIRREDQADLYLIPTAEVSL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+ + EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I     SF
Sbjct: 239 TNIVAGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVEPSKSF 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
              E M + AE +L+ L+L YR ++LCTGD+GFSA KTYDLEVW+  Q+ YREISSCS C
Sbjct: 299 EALEGMTANAERVLQLLELPYRKLALCTGDMGFSAVKTYDLEVWVPSQDKYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +RYR+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P VL+PY
Sbjct: 359 GDFQARRMQARYRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPEVLKPY 418

Query: 417 MNNLAV 422
           M  + V
Sbjct: 419 MGGIEV 424


>gi|254486623|ref|ZP_05099828.1| seryl-tRNA synthetase [Roseobacter sp. GAI101]
 gi|214043492|gb|EEB84130.1| seryl-tRNA synthetase [Roseobacter sp. GAI101]
          Length = 430

 Score =  434 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 209/429 (48%), Positives = 285/429 (66%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP+  D AL +R   P +  IL+LD   R +I   E  +A +N  S  +G 
Sbjct: 1   MHDIKAIRENPDAFDAALARRGDAPVTGEILALDTARRGMINAAETAQAEQNKASKLVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+ +  + L+   S  K ++  ++ E  ++ + L  +++ IPN+P ++VP G   N
Sbjct: 61  AKAKGDEAEFERLRTLVSDKKAEVTRMQAEAKDLDAQLTDMLARIPNLPADDVPEGADEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G  PS    ++EHFEI      MDF+ A K SGARF +L G +A + RAL Q
Sbjct: 121 DNVEVNRWGDVPSYDFAAKEHFEIASVAASMDFETAAKTSGARFVMLKGAVARVHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H   +G TE + P+LVRDEAMYGT ++PKF DD + TT+G WLIPTSEV+LT   
Sbjct: 181 FMVDTHVDHNGLTEYATPVLVRDEAMYGTDKLPKFGDDSYQTTNGWWLIPTSEVTLTYSV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           S +++E  +LP R T     FRSEAGSAGRDT GMLRQHQF K E+VSIT  + S  E +
Sbjct: 241 SGDVLEEAALPRRMTAHTLCFRSEAGSAGRDTSGMLRQHQFEKVEMVSITHPDASDDEQK 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML CAE++L+RL + YR V LCTGD+GF A +T+D+E WL GQN YREISS ST G+FQ
Sbjct: 301 RMLRCAEDLLERLGVPYRTVLLCTGDMGFGARRTFDIEAWLPGQNAYREISSVSTTGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++  +    +F HTLNGSG+AVGRCLIA+LEN   ADGSV +P VL PY+   
Sbjct: 361 ARRMNARFKPADGSKPQFVHTLNGSGLAVGRCLIAVLENGQQADGSVQLPDVLAPYLGGK 420

Query: 421 AVIKKEHIL 429
            ++  + +L
Sbjct: 421 TLLGADGVL 429


>gi|126174377|ref|YP_001050526.1| seryl-tRNA synthetase [Shewanella baltica OS155]
 gi|166223285|sp|A3D4J4|SYS_SHEB5 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|125997582|gb|ABN61657.1| seryl-tRNA synthetase [Shewanella baltica OS155]
          Length = 428

 Score =  434 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 201/429 (46%), Positives = 263/429 (61%), Gaps = 8/429 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD +++R   E     L  R       ++  L+EK + L    E+++A RN+ S  IGQ
Sbjct: 1   MLDPKFLRNELEVTAERLATRGFILDIAHLTQLEEKRKSLQVATEELQASRNAISKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    VDA+  +   L  QL   + E   V   +  +   +PN+P E  PIG    
Sbjct: 61  AKARG--EDVDAIMAQVGDLGSQLDAKKIELAAVLEEVNAIAMSMPNLPDESAPIGADET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G   +     ++H ++GE L  +DF  A K++G+RF V+ G +A L RA+GQ
Sbjct: 119 ENVEVRRWGTPRTFDFPIKDHIDLGEGLNGLDFKNAVKITGSRFIVMKGQVARLNRAIGQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG------RWLIPTSEV 234
           FM+DLHT+EHGYTE   PLLV + ++ GTGQ+PKF +D+F T           LIPT+EV
Sbjct: 179 FMLDLHTTEHGYTEAYVPLLVNEASLLGTGQLPKFGEDLFHTKPATEEGQGLSLIPTAEV 238

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            LTNL    I++   LP++ T     FRSEAGS G+DTRG++RQHQF K E+V I + ED
Sbjct: 239 PLTNLVRDSIVDEDELPIKLTAHTACFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVKPED 298

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCS 354
           S    E +   AE +L+RL L YR V LCTGD+GF + KTYD+EVWL  QN YREISSCS
Sbjct: 299 SMAALEALTGHAETVLQRLGLPYRTVILCTGDMGFGSSKTYDIEVWLPAQNTYREISSCS 358

Query: 355 TCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR 414
              +FQ+RRM +RYR          HTLNGSG+AVGR L+AILENY NADGS+TIP VLR
Sbjct: 359 NMKDFQARRMQARYRVKADNKPALLHTLNGSGLAVGRTLVAILENYQNADGSITIPEVLR 418

Query: 415 PYMNNLAVI 423
           PYM  L  I
Sbjct: 419 PYMGGLTKI 427


>gi|307265411|ref|ZP_07546967.1| seryl-tRNA synthetase [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306919525|gb|EFN49743.1| seryl-tRNA synthetase [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 423

 Score =  434 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 199/426 (46%), Positives = 269/426 (63%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++ IR NPE +  A++ +  +   +  L LDEK R ++ ++E ++ RRN  S  I +
Sbjct: 1   MLDVKRIRNNPEAVRRAVELKGEKADIDRFLELDEKRRQMLVELETLKNRRNMESDNIAK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG       L  E   L +++  +E+E  EV   L++++  IPN+P E VPIG S  
Sbjct: 61  LKREGK--DASDLIAEMKELSDKIKEMEQEVKEVEEELERILWTIPNIPHESVPIGDSDE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ IR  G+        + H+EIGE LG++DF+ A +++G+RF+   G  A LERAL  
Sbjct: 119 DNVEIRRWGEPRKFDFEPKPHWEIGEELGILDFEAAARVTGSRFTFYKGLGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTNL 239
           FM+DLH   HGYTEV  P +    +M+GTGQ+PKF +D F      +  IPT+EV +TN+
Sbjct: 179 FMLDLHIERHGYTEVFPPFMAHRRSMFGTGQLPKFEEDAFKVYGTDYFLIPTAEVPVTNM 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y   II+   LP+     +  FR EAGSAGRDTRG++RQHQF K ELV  T  + S+ E 
Sbjct: 239 YRDTIIDGDKLPIYHCAYSACFRQEAGSAGRDTRGLIRQHQFNKVELVKFTEPDKSYEEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E+M   AEE+L+ L L YRVV++CTGDLGF+A K YD+EVW+     Y EISSCS C +F
Sbjct: 299 EKMTRDAEEVLQALGLPYRVVAICTGDLGFTASKKYDIEVWMPSYGRYVEISSCSNCEDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N +YR  +    ++ HTLNGSGVAVGR   AILENY   DGSV IP VLRPYM  
Sbjct: 359 QARRANIKYRPKDGGKAQYVHTLNGSGVAVGRTFAAILENYQQEDGSVVIPEVLRPYMK- 417

Query: 420 LAVIKK 425
           + VIKK
Sbjct: 418 VDVIKK 423


>gi|188534278|ref|YP_001908075.1| seryl-tRNA synthetase [Erwinia tasmaniensis Et1/99]
 gi|238689714|sp|B2VC55|SYS_ERWT9 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|188029320|emb|CAO97197.1| Seryl-tRNA synthetase [Erwinia tasmaniensis Et1/99]
          Length = 430

 Score =  434 bits (1117), Expect = e-119,   Method: Composition-based stats.
 Identities = 198/431 (45%), Positives = 268/431 (62%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + + +E+ ++L  + E+++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGYKLDVDTLRAHEERRKVLQVETENLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E   + + +      IPN+P + VP+G   +
Sbjct: 61  AKARG--EDIEPLRQEVNALGERLDAAKAELDALLTCINDFSMAIPNIPADVVPLGKDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN  I   G+        R+H E+GE    +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 ENQEISRWGEPRQFDFTVRDHVELGEMAAGLDFAAAVKLTGSRFIVMKGQIALMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY E   P LV   ++YGTGQ+PKF +D+F T             LIPTS
Sbjct: 179 FMLDLHTEQHGYQETYVPYLVNHASLYGTGQLPKFGEDLFHTRPLDEEASSSNYALIPTS 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI+E ++LPL+ T   P FRSEAG+ GRDTRG++R HQF K E+V ITR 
Sbjct: 239 EVPLTNLVRDEILEEETLPLKMTAHTPCFRSEAGAYGRDTRGLIRMHQFDKVEMVHITRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E ++  AE++L+ L+L YR V LCTGD+GF A KTYDLEVWL  Q+ YREISS
Sbjct: 299 EDSMDALEELVGHAEKVLQLLNLPYRKVLLCTGDMGFGAQKTYDLEVWLPAQDTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS  G+FQ+RRM +R R       +  HTLNGSG+AVGR L+A+LENY  ADG + +P V
Sbjct: 359 CSNMGDFQARRMKARCRPRGESKTRLVHTLNGSGLAVGRTLVAVLENYQQADGRIEVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMKGLHFI 429


>gi|28897882|ref|NP_797487.1| seryl-tRNA synthetase [Vibrio parahaemolyticus RIMD 2210633]
 gi|260364482|ref|ZP_05777107.1| serine--tRNA ligase [Vibrio parahaemolyticus K5030]
 gi|260877041|ref|ZP_05889396.1| serine--tRNA ligase [Vibrio parahaemolyticus AN-5034]
 gi|260902447|ref|ZP_05910842.1| serine--tRNA ligase [Vibrio parahaemolyticus AQ4037]
 gi|31340446|sp|Q87QP1|SYS_VIBPA RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|28806095|dbj|BAC59371.1| seryl-tRNA synthetase [Vibrio parahaemolyticus RIMD 2210633]
 gi|308093830|gb|EFO43525.1| serine--tRNA ligase [Vibrio parahaemolyticus AN-5034]
 gi|308110643|gb|EFO48183.1| serine--tRNA ligase [Vibrio parahaemolyticus AQ4037]
 gi|308114618|gb|EFO52158.1| serine--tRNA ligase [Vibrio parahaemolyticus K5030]
          Length = 435

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 192/434 (44%), Positives = 265/434 (61%), Gaps = 11/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   +     L +R  +   E I  L+E+ + +  ++E++++ RNS S QIGQ
Sbjct: 1   MLDSKLLRTELDETAAKLARRGFKLDVETIRKLEEQRKSIQVEVENLQSTRNSISKQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +A G+    + +K +  TL   L   + E  +V + L +    +PN+P +EVP G   N
Sbjct: 61  KMAAGDKEGAEEIKKQIGTLGSDLDAKKVELEQVMAQLDEFTLSVPNIPADEVPDGKDEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I   G+  +     ++H ++GE  G +DF  A K++GARF V+ G  A L RA+ Q
Sbjct: 121 DNVEISRWGEPKTYDFDLKDHVDLGEMGGGLDFASAVKITGARFIVMKGQFARLHRAIAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-----------TDGRWLI 229
           FM+DLHT EHGYTE+  P LV  ++++GTGQ+PKF  D+F T                LI
Sbjct: 181 FMLDLHTEEHGYTEMYVPYLVNSDSLFGTGQLPKFGKDLFHTEPLAEKVNDEEPRKLSLI 240

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV +TNL    I +   LP++ T   P FRSEAGS GRDTRG++R HQF K ELV I
Sbjct: 241 PTAEVPVTNLVRDTITDEADLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQI 300

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
           T+ EDS T  E +   AE++L+ L+L YR V LCTGD+GF A KTYDLEVW+  Q  YRE
Sbjct: 301 TKPEDSMTALEELTGHAEKVLQLLELPYRKVVLCTGDMGFGARKTYDLEVWVPAQETYRE 360

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR ++AILEN   ADG + I
Sbjct: 361 ISSCSNMWDFQARRMQARFRRKGEKKPELVHTLNGSGLAVGRTMVAILENNQEADGRIAI 420

Query: 410 PTVLRPYMNNLAVI 423
           P VL+ YM     I
Sbjct: 421 PAVLQKYMGGATHI 434


>gi|313667939|ref|YP_004048223.1| seryl-tRNA synthetase [Neisseria lactamica ST-640]
 gi|313005401|emb|CBN86835.1| seryl-tRNA synthetase [Neisseria lactamica 020-06]
          Length = 431

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 202/433 (46%), Positives = 275/433 (63%), Gaps = 9/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L  R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQSLRSNTAAVAERLAARGYEFDAARFNALEEQRKAVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +S IPN+P E VP G    
Sbjct: 61  LKGQGRHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLSGIPNLPHESVPAGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRRVGTPREFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM+D HT EHGYTE   P +V    +YGTGQ+PKF +D+F  T         ++LIPT+E
Sbjct: 180 FMLDTHTLEHGYTEHYTPYIVNGGTLYGTGQLPKFGEDLFHVTRGGDESKTAQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAG+ G+D RG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVAGSIIPSEQLPLKLTAHSPCFRSEAGAYGKDVRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYGALEEMVGHAENILKALELPYRVITLCTGDMGFGAAKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIKKE 426
           +PYM  +A ++ +
Sbjct: 419 QPYMGGVAKLEAK 431


>gi|260776356|ref|ZP_05885251.1| seryl-tRNA synthetase [Vibrio coralliilyticus ATCC BAA-450]
 gi|260607579|gb|EEX33844.1| seryl-tRNA synthetase [Vibrio coralliilyticus ATCC BAA-450]
          Length = 435

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 190/434 (43%), Positives = 268/434 (61%), Gaps = 11/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   +     L +R  +   E I +L+E+ + +  ++E++++ RNS S QIGQ
Sbjct: 1   MLDSKLLRTELDETAAKLARRGFKLDVETIRTLEEQRKSIQVEVENLQSTRNSISKQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +A G+    + +K +  TL   L   + E  E+ + L+ +   +PN+P +EVP G   N
Sbjct: 61  KMAAGDKEGAEEIKKQIGTLGSDLEAKKAELVEIQNKLEDITLSVPNLPDDEVPDGKDEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ I   G+  S     ++H ++GE    +DF  ATK++GARF ++ G  A L RA+ Q
Sbjct: 121 ENVEISRWGEPKSYDFEVKDHVDLGEMGDGLDFASATKITGARFIIMKGQFARLHRAIAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-----------TDGRWLI 229
           FM+DLHT EHGYTE+  P LV  ++++GTGQ+PKF +D+F T                LI
Sbjct: 181 FMLDLHTEEHGYTEMYVPYLVNSDSLFGTGQLPKFGEDLFHTEPLTEKVNDEEPRKLSLI 240

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV +TN+    I++   LP++ T   P FRSEAGS GRDTRG++R HQF K ELV I
Sbjct: 241 PTAEVPVTNMVRDTIVDEADLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQI 300

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
           T+ E+S    E +   AE++L+ L+L YR V LCTGD+GF A KTYDLEVW+  Q  YRE
Sbjct: 301 TKPEESMAALEELTGHAEKVLQLLELPYRKVVLCTGDMGFGARKTYDLEVWVPAQETYRE 360

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR ++AILEN   ADG + I
Sbjct: 361 ISSCSNTWDFQARRMQARFRRKGEKKPELVHTLNGSGLAVGRTMVAILENNQEADGRIAI 420

Query: 410 PTVLRPYMNNLAVI 423
           P VL+ YM     I
Sbjct: 421 PAVLQKYMGGATHI 434


>gi|293392027|ref|ZP_06636361.1| seryl-tRNA synthetase [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290952561|gb|EFE02680.1| seryl-tRNA synthetase [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 438

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 203/437 (46%), Positives = 273/437 (62%), Gaps = 14/437 (3%)

Query: 1   MLDIQWIRQNPEHLDIALK-KRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           M+D   +R NP  +   LK KR     +  I  L+E+ + L  K E+++A RN+ S  IG
Sbjct: 1   MIDPNLLRNNPADVAEKLKIKRGFVLDTAKITQLEEQRKALQVKTENLQAERNARSKAIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
            A A G    +  L  E   + E+L   + E  +V ++L  +   IPN+P +EVP+G   
Sbjct: 61  AAKARG--EDIAPLLAEVDHMAEELEQGKIELDKVQNALNDIALNIPNIPADEVPLGKDD 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +EN+ +   G+        ++H  +GE L  +DF  A KL+G+RF V+ G +A L RA+ 
Sbjct: 119 SENLEVSRWGEPRKFDFEVKDHVTLGENLQGLDFAAAVKLTGSRFVVMKGQIAKLHRAIA 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-----------TDGRWL 228
           QFM+DLHT +HGYTE   P LV  + +YGTGQ+PKF++D+F T                L
Sbjct: 179 QFMLDLHTEQHGYTEAYVPYLVNHDTLYGTGQLPKFSEDLFHTKPLEGQDPNEVQRTYGL 238

Query: 229 IPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVS 288
           IPT+EV +TNL   EI+++++LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV 
Sbjct: 239 IPTAEVPVTNLVRGEILDAENLPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQ 298

Query: 289 ITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYR 348
           I   E S    E +   AE++L+ L L YR V LCTGD+GF +CKTYDLEVW++ QN YR
Sbjct: 299 IVEPEKSMEALEELTGHAEKVLQLLGLPYRKVLLCTGDMGFGSCKTYDLEVWVSAQNTYR 358

Query: 349 EISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVT 408
           EISSCS   +FQ+RRM +R R    K  +  HTLNGSG+AVGR L+A+LENY NADGS+T
Sbjct: 359 EISSCSNMWDFQARRMQARCRSKGDKKTRLVHTLNGSGLAVGRTLVAVLENYQNADGSIT 418

Query: 409 IPTVLRPYMNNLAVIKK 425
           +P VLRPYM  L VI K
Sbjct: 419 VPEVLRPYMGGLDVIGK 435


>gi|290967982|ref|ZP_06559531.1| serine--tRNA ligase [Megasphaera genomosp. type_1 str. 28L]
 gi|290781888|gb|EFD94467.1| serine--tRNA ligase [Megasphaera genomosp. type_1 str. 28L]
          Length = 424

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 194/420 (46%), Positives = 271/420 (64%), Gaps = 5/420 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD +++R+N E +   +K R+     +  ++LD K R LI+++E ++  RN+ + +I +
Sbjct: 1   MLDAKFVRENLEAVRENIKNRNAHVDLDAFIALDSKRRTLIQQVETMKNERNTVTQEISR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
                N     AL      L + + + +KE H+V  +L+++   IPN+    VP+G   +
Sbjct: 61  LKR--NKEDASALIEAMKKLGDTIAVQDKEIHQVAEALRQIQLMIPNMCHPSVPVGKDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N  +R  G+  +     +EH+EIGE LG++D +RA K++GARF    G  A LERA+  
Sbjct: 119 QNPEVRKWGEPTNFSFTPKEHWEIGENLGILDAERAAKVAGARFYYYIGAGARLERAVYN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC---TTDGRWLIPTSEVSLT 237
           FM+D HT + GYTEV  P +V  +AM GTGQ+PKF++DM+         +LIPT+EV LT
Sbjct: 179 FMLDRHTEKDGYTEVIPPYIVNRKAMTGTGQLPKFSEDMYQLQVEGQDMFLIPTAEVPLT 238

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           N YS EI+ +  LP+  T L P FR+EAGSAGRDTRG++RQHQF K E+V  T  E S+ 
Sbjct: 239 NYYSGEILRADQLPVYVTALTPCFRAEAGSAGRDTRGLIRQHQFHKVEMVKYTTPESSYD 298

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
           E +++   AE+ILK L+L Y VV LCTGD+GFSA KT+D+EVW   Q  YREISSCS   
Sbjct: 299 ELDKLTRNAEDILKALELPYHVVCLCTGDIGFSAAKTFDVEVWFPAQGKYREISSCSNTE 358

Query: 358 NFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +FQ+RR N R+R       ++ HTLNGSG+AVGR + AILENY  ADGSV +P VLRPYM
Sbjct: 359 DFQARRANIRFRRDTKAKPEYVHTLNGSGLAVGRTVAAILENYQQADGSVAVPEVLRPYM 418


>gi|149204172|ref|ZP_01881140.1| seryl-tRNA synthetase [Roseovarius sp. TM1035]
 gi|149142614|gb|EDM30659.1| seryl-tRNA synthetase [Roseovarius sp. TM1035]
          Length = 430

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 207/429 (48%), Positives = 279/429 (65%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+ P+  D AL +R L P S  IL+LDE  R  I   E  +A +N  S + G 
Sbjct: 1   MHDIRAIRETPDAFDAALARRGLAPVSPQILALDEARRTRIHAAESAQADQNRASKEAGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G+ +  + L+   S  KE++  ++ E   + + L  L+  +PN+P ++VP GT  +
Sbjct: 61  AKGRGDEAEFERLRTLVSAKKEEMAAMQAEAKALDTQLTDLLMALPNLPFDDVPDGTDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G   S     +EH++I      MDF+ A KLSGARF VL+G +A L RAL Q
Sbjct: 121 GNVELRRWGTPASFDFTPKEHYDITGVQPGMDFETAAKLSGARFVVLSGSIARLHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H  E+G  E   P+LVR E M GTGQ+PKF +D + TT+G WL+PT+EV+LTN+ 
Sbjct: 181 FMLDTHIEENGLQETWTPVLVRPEMMLGTGQLPKFGEDSYETTNGWWLVPTAEVTLTNIV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             E +++ +LP R+      FRSEAGSAGRDT GMLRQHQF K E+VSIT  ++S  E +
Sbjct: 241 HGETVDAATLPRRYVAHTQCFRSEAGSAGRDTAGMLRQHQFEKVEMVSITHPDESRAELD 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM +CA+ IL+RL L YR + LCTGD+GF A +T+D+EVWL GQN YREISS S CG+FQ
Sbjct: 301 RMTACAQSILERLGLPYRTIVLCTGDMGFGARRTHDIEVWLPGQNTYREISSVSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++       +F HTLNGSG+AVGRCLIA+LEN   ADGSV IP  L PY+   
Sbjct: 361 ARRMNARFKPQGGGKPEFLHTLNGSGLAVGRCLIAVLENGQQADGSVRIPDALHPYLRGK 420

Query: 421 AVIKKEHIL 429
            ++  +  L
Sbjct: 421 TILNADGSL 429


>gi|325266501|ref|ZP_08133178.1| serine--tRNA ligase [Kingella denitrificans ATCC 33394]
 gi|324981944|gb|EGC17579.1| serine--tRNA ligase [Kingella denitrificans ATCC 33394]
          Length = 467

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 202/433 (46%), Positives = 285/433 (65%), Gaps = 9/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R + +     L +R     +E    L+ + + L  + E+++A+RNS S QIG 
Sbjct: 36  MLDIQLLRNDIQTTAQRLAQRGFVLDTERFGELEGRRKQLQIRSEELQAQRNSLSKQIGV 95

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            + +G     +A K + + LK  +  +E E  +V ++L  L+  IPN+P E VP+G    
Sbjct: 96  LMGQGKKDEAEAAKAQVAQLKTDMENIESELPQVQAALDDLLLRIPNLPHESVPVGKDET 155

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG   +     ++H ++G ALG +DF++A +LSGARFS++ G +A L RAL Q
Sbjct: 156 ENVEVRKVGTPRTFDLDIKDHVDLGAALG-LDFEKAAELSGARFSLMKGKIARLHRALAQ 214

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKF +D+F  T         ++LIPT+E
Sbjct: 215 FMLDTHTQQHGYTECYTPYIVNDSTLLGTGQLPKFGEDLFHVTRGGDETKLTQYLIPTAE 274

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN     I+  K LPL+ T  +P FRSEAGS G+DTRG++RQHQF K E+V I + E
Sbjct: 275 VTLTNTVRDTILAEKDLPLKLTAHSPCFRSEAGSHGKDTRGLIRQHQFDKVEMVQIVQPE 334

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 335 KSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 394

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N ++ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 395 SNCEDFQARRMKARFKDENGRN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 453

Query: 414 RPYMNNLAVIKKE 426
           RPY+  L  ++ +
Sbjct: 454 RPYLGGLERLEAD 466


>gi|254246060|ref|ZP_04939381.1| Seryl-tRNA synthetase, class IIa [Burkholderia cenocepacia PC184]
 gi|124870836|gb|EAY62552.1| Seryl-tRNA synthetase, class IIa [Burkholderia cenocepacia PC184]
          Length = 487

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 199/430 (46%), Positives = 269/430 (62%), Gaps = 11/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R +    E+++ARRNS S QIG 
Sbjct: 55  MLDIQLLRKDLDGVAKRLADRGYTLDVAAFSALEAERRAIQTHTEELQARRNSLSKQIGA 114

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A+  E   + + +   E +  E+ + L  L+  +PNV  E VP+G    
Sbjct: 115 MKGKG--EDTSAVMAEVGGIGDDMKASEAKLGEIQARLSDLMLGMPNVAHESVPVGKDEA 172

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+  R  G         ++H ++G  LG +DF+   KL+GARF++L G +A L RAL Q
Sbjct: 173 DNVEARRWGTPRQFDFEVKDHVDVGTPLG-LDFETGAKLAGARFTMLRGPIARLHRALAQ 231

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FMID HT +HGYTE   P +V  E +YGTGQ+PKFADDMF            ++LI TSE
Sbjct: 232 FMIDTHTQQHGYTETYTPYIVNPEILYGTGQLPKFADDMFRVEKGGAENTVTQYLISTSE 291

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     I++  +LP++ T  +P FRSEAGS GRDTRGM+RQHQF K E+V +   E
Sbjct: 292 ISLTNTVRESIVDGAALPIKLTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQVVAPE 351

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   + M+  AE IL++L L YRV++LCTGD+GFSA KT+DLEVWL  QN YREISSC
Sbjct: 352 TSYAALDEMVGHAEAILQKLGLPYRVITLCTGDMGFSAAKTFDLEVWLPAQNTYREISSC 411

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S    FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+A+LENY NADGSVT+P VL
Sbjct: 412 SNTEAFQARRMQARFRNAQGK-PELVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPEVL 470

Query: 414 RPYMNNLAVI 423
           RPYM  +  I
Sbjct: 471 RPYMGGMERI 480


>gi|170732292|ref|YP_001764239.1| seryl-tRNA synthetase [Burkholderia cenocepacia MC0-3]
 gi|238688596|sp|B1JX98|SYS_BURCC RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|169815534|gb|ACA90117.1| seryl-tRNA synthetase [Burkholderia cenocepacia MC0-3]
          Length = 433

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 199/430 (46%), Positives = 269/430 (62%), Gaps = 11/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R +    E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDLDGVAKRLADRGYTLDVAAFSALEAERRAIQTHTEELQARRNSLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A+  E   + + +   E +  E+ + L  L+  +PNV  E VP+G    
Sbjct: 61  MKGKG--EDTSAVMAEVGGIGDDMKASEAKLGEIQARLSDLMLGMPNVAHESVPVGKDEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+  R  G         ++H ++G  LG +DF+   KL+GARF++L G +A L RAL Q
Sbjct: 119 DNVEARRWGTPRQFDFEVKDHVDVGTPLG-LDFETGAKLAGARFTMLRGPIARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FMID HT +HGYTE   P +V  E +YGTGQ+PKFADDMF            ++LI TSE
Sbjct: 178 FMIDTHTQQHGYTETYTPYIVNPEILYGTGQLPKFADDMFRVEKGGAENTVTQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     I++  +LP++ T  +P FRSEAGS GRDTRGM+RQHQF K E+V +   E
Sbjct: 238 ISLTNTVRESIVDGAALPIKLTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQVVAPE 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   + M+  AE IL++L L YRV++LCTGD+GFSA KT+DLEVWL  QN YREISSC
Sbjct: 298 TSYAALDEMVGHAEAILQKLGLPYRVITLCTGDMGFSAAKTFDLEVWLPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S    FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+A+LENY NADGSVT+P VL
Sbjct: 358 SNTEAFQARRMQARFRNAQGK-PELVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPEVL 416

Query: 414 RPYMNNLAVI 423
           RPYM  +  I
Sbjct: 417 RPYMGGMERI 426


>gi|163759446|ref|ZP_02166531.1| seryl-tRNA synthetase [Hoeflea phototrophica DFL-43]
 gi|162283043|gb|EDQ33329.1| seryl-tRNA synthetase [Hoeflea phototrophica DFL-43]
          Length = 427

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 251/426 (58%), Positives = 317/426 (74%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+WIR+NP  LD AL+KR  E QS  +++LDE  R  +  ++ ++ RRN+ S +IG+
Sbjct: 1   MLDIKWIRENPAALDAALEKRGAEAQSSRLVALDEARRSHVGLVQALQERRNAASKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A+A  + +  DALK E + LK++L   E +E E+   LK  +S +PN+PL+EVP+G    
Sbjct: 61  AMAAKDQAAADALKAEVAKLKDELQAGEAKERELDEELKHALSVLPNIPLDEVPLGADEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R VG+KP      +EHFE+GEALG+MDF+RA K+SGARF++L+G LA LERALGQ
Sbjct: 121 DNVEVRKVGEKPDLGFEPKEHFELGEALGMMDFERAAKMSGARFTILSGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT EHGYTEV+ PLLV D A YGT ++PKF DD+F TTDGRWLIPT+EV LT + 
Sbjct: 181 FMLDLHTGEHGYTEVNPPLLVNDAAAYGTDKLPKFGDDLFRTTDGRWLIPTAEVPLTYMA 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + EI+    LP R+      FRSEAGSAGRDTRGMLRQHQF K ELVS+T  E S  EHE
Sbjct: 241 AGEILAEDELPKRYAAHTACFRSEAGSAGRDTRGMLRQHQFSKVELVSVTTPETSLEEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM + AE +L RL LH+R V LCTGD+GF A KTYD+EVWL GQN YREISSCS CG+FQ
Sbjct: 301 RMTASAEAVLTRLGLHFRTVVLCTGDMGFGAQKTYDIEVWLPGQNAYREISSCSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R R P  K+ +F HTLNGSGVAVGR LIA++ENY NADGS+T+P  LR YM  L
Sbjct: 361 ARRMNARSRKPGDKATRFVHTLNGSGVAVGRALIAVMENYQNADGSITVPDALRFYMGGL 420

Query: 421 AVIKKE 426
           + I+K 
Sbjct: 421 SKIEKT 426


>gi|110679777|ref|YP_682784.1| seryl-tRNA synthetase [Roseobacter denitrificans OCh 114]
 gi|123065549|sp|Q166J5|SYS_ROSDO RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|109455893|gb|ABG32098.1| seryl-tRNA synthetase [Roseobacter denitrificans OCh 114]
          Length = 430

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 210/429 (48%), Positives = 285/429 (66%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NP   D AL +R   P S+ IL+LD   R  I   E+ +A +N  S ++GQ
Sbjct: 1   MHDIRAIRENPAAFDAALARRGEAPMSQAILALDTARRAKINAAENAQAEQNKASKEVGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+ +  + L+   S  K  +  ++ +   + + L + +S I N+P ++VP G   +
Sbjct: 61  AKAQGDEATFEKLRALVSEKKALVAEMQADAKALDAELTEKLSWIANIPADDVPDGADED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G  P      +EH+EIG     MDFD A K SGARF +L G +A + RAL Q
Sbjct: 121 DNVEVRRWGHLPDFEFTPKEHYEIGGVAASMDFDTAAKTSGARFVMLKGAVARIHRALSQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMID H   +G TE+++P+LVRD+AMYGT ++PKFA+D + TT+G WL+ TSE+ LT   
Sbjct: 181 FMIDTHVDHNGLTEINSPVLVRDDAMYGTDKLPKFAEDSYQTTNGWWLVSTSEIPLTYTV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + +I+++ +LP+R T     FRSEAGSAGRDT GMLRQHQF K E+VSIT  + S  E +
Sbjct: 241 AGDILDAAALPIRLTAHTLCFRSEAGSAGRDTAGMLRQHQFEKVEMVSITEPDQSEAEQQ 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML CAE+IL+RL L YR V LCTGD+GF A +T+D+E WL GQN YREISS ST G+FQ
Sbjct: 301 RMLRCAEDILERLGLPYRTVLLCTGDMGFGARRTFDIEAWLPGQNNYREISSVSTTGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RY+  +    +F HTLNGSG+AVGRCLIA+LEN   ADGSV +P VL  Y+   
Sbjct: 361 ARRMNARYKPADGGKPQFVHTLNGSGLAVGRCLIAVLENGQQADGSVVLPPVLAGYLGGK 420

Query: 421 AVIKKEHIL 429
            V+  E  L
Sbjct: 421 TVLSAEGTL 429


>gi|161525589|ref|YP_001580601.1| seryl-tRNA synthetase [Burkholderia multivorans ATCC 17616]
 gi|189349682|ref|YP_001945310.1| seryl-tRNA synthetase [Burkholderia multivorans ATCC 17616]
 gi|221201182|ref|ZP_03574222.1| seryl-tRNA synthetase [Burkholderia multivorans CGD2M]
 gi|221206364|ref|ZP_03579377.1| seryl-tRNA synthetase [Burkholderia multivorans CGD2]
 gi|221213643|ref|ZP_03586617.1| seryl-tRNA synthetase [Burkholderia multivorans CGD1]
 gi|30913321|sp|Q9AEN2|SYS_BURCE RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|238687044|sp|A9AES3|SYS_BURM1 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|13591535|emb|CAC36357.1| putative seryl-tRNA synthetase [Burkholderia cepacia]
 gi|160343018|gb|ABX16104.1| seryl-tRNA synthetase [Burkholderia multivorans ATCC 17616]
 gi|189333704|dbj|BAG42774.1| seryl-tRNA synthetase [Burkholderia multivorans ATCC 17616]
 gi|221166432|gb|EED98904.1| seryl-tRNA synthetase [Burkholderia multivorans CGD1]
 gi|221173673|gb|EEE06107.1| seryl-tRNA synthetase [Burkholderia multivorans CGD2]
 gi|221179032|gb|EEE11439.1| seryl-tRNA synthetase [Burkholderia multivorans CGD2M]
          Length = 433

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 200/430 (46%), Positives = 274/430 (63%), Gaps = 11/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R +  + E+++ARRN+ S QIG 
Sbjct: 1   MLDIQLLRKDLDGVAKRLADRGYTLDVAAFSALEAERRAIQTRTEELQARRNTLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
             A+G      A+  E   + +++     +  E+ + L +L+  +PN+  E VP+G    
Sbjct: 61  MKAKG--EDTSAVMAEVGGIGDEMKASAAKLDEIQARLSELLLGMPNLAHESVPVGKDEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G         ++H +IG  LG +DF+   KL+GARF++L G +A L RAL Q
Sbjct: 119 DNVEVRRWGTPRQFDFDVKDHVDIGTPLG-LDFETGAKLAGARFTMLRGPIARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM+D HT +HGY+E   P +V  E +YGTGQ+PKFADDMF            ++LI TSE
Sbjct: 178 FMLDTHTQQHGYSETYTPYIVNPEILYGTGQLPKFADDMFRVEKGGAENTVTQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     I+E+ +LP++ T  +P FRSEAGS GRDTRGM+RQHQF K E+V I   E
Sbjct: 238 ISLTNTVRESIVEASALPIKLTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQIVAPE 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   + M+  AE IL++L L YRVV+LCTGD+GFSA KT+DLEVWL  QN YREISSC
Sbjct: 298 SSYAALDEMVGHAEAILQKLGLPYRVVALCTGDMGFSAAKTFDLEVWLPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S    FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+A+LENY NADGSVT+P VL
Sbjct: 358 SNTEAFQARRMQARFRNAQGK-PELVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPEVL 416

Query: 414 RPYMNNLAVI 423
           RPYM  L  I
Sbjct: 417 RPYMGGLERI 426


>gi|328473158|gb|EGF44006.1| seryl-tRNA synthetase [Vibrio parahaemolyticus 10329]
          Length = 435

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 191/434 (44%), Positives = 264/434 (60%), Gaps = 11/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   +     L +R  +   E I  L+E+ + +  ++E++++ RNS S QIGQ
Sbjct: 1   MLDSKLLRTELDETAAKLARRGFKLDVETIRKLEEQRKSIQVEVENLQSTRNSISKQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +A G+    + +K +  TL   L   + E  +V + L +    +PN+P +EVP G   N
Sbjct: 61  KMAAGDKEGAEEIKKQIGTLGSDLDAKKVELEQVMAQLDEFTLSVPNIPADEVPDGKDEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I   G+  +     ++H ++GE  G +DF  A K++GARF V+ G  A L RA+ Q
Sbjct: 121 DNVEISRWGEPKTYDFDLKDHVDLGEMGGGLDFASAVKITGARFIVMKGQFARLHRAIAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-----------TDGRWLI 229
           FM+DLHT EHGYTE+  P LV  ++++GTGQ+PKF  D+F T                LI
Sbjct: 181 FMLDLHTEEHGYTEMYVPYLVNSDSLFGTGQLPKFGKDLFHTEPLAEKVNDEEPRKLSLI 240

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV +TNL    I +   LP++ T   P FRSEAGS GRDTRG++R HQF K ELV I
Sbjct: 241 PTAEVPVTNLVRDTITDEADLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQI 300

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
           T+ EDS    E +   AE++L+ L+L YR V LCTGD+GF A KTYDLEVW+  Q  YRE
Sbjct: 301 TKPEDSMNALEELTGHAEKVLQLLELPYRKVVLCTGDMGFGARKTYDLEVWVPAQETYRE 360

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR ++AILEN   ADG + I
Sbjct: 361 ISSCSNMWDFQARRMQARFRRKGEKKPELVHTLNGSGLAVGRTMVAILENNQEADGRIAI 420

Query: 410 PTVLRPYMNNLAVI 423
           P VL+ YM     I
Sbjct: 421 PAVLQKYMGGATHI 434


>gi|115350893|ref|YP_772732.1| seryl-tRNA synthetase [Burkholderia ambifaria AMMD]
 gi|122323794|sp|Q0BHH5|SYS_BURCM RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|115280881|gb|ABI86398.1| seryl-tRNA synthetase [Burkholderia ambifaria AMMD]
          Length = 433

 Score =  434 bits (1116), Expect = e-119,   Method: Composition-based stats.
 Identities = 198/430 (46%), Positives = 271/430 (63%), Gaps = 11/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R +  + E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDLDGVAKRLADRGYTLDVAAFSALEAERRAIQTRTEELQARRNSLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A+  E   + +++   E +  E+ + L  L+  +PN+  E VP+G    
Sbjct: 61  MKGKG--EDTSAVMAEVGGIGDEMKASEAKLGEIQTRLSDLMLGMPNIAHESVPVGKDEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G         ++H ++G  LG +DF+   KL+GARF++L G +A L RAL Q
Sbjct: 119 DNVEVRRWGTPREFDFAVKDHVDVGTPLG-LDFETGAKLAGARFTMLRGSIARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FMID HT +HGYTE   P +V  E +YGTGQ+PKFADDMF            ++LI TSE
Sbjct: 178 FMIDTHTLQHGYTETYTPYIVNPEILYGTGQLPKFADDMFRVEKGGGENTITQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     I+E  +LP++ T  +P FRSEAGS GRDTRGM+RQHQF K E+V +   +
Sbjct: 238 ISLTNTVRESIVEGSALPIKLTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQVVAPD 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   + M+  AE IL++L L YRVV+LCTGD+GFSA KT+DLEVWL  QN YREISSC
Sbjct: 298 ASYAALDEMVGHAEAILQKLGLPYRVVALCTGDMGFSAAKTFDLEVWLPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S    FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+A+LENY NADGSVT+P  L
Sbjct: 358 SNTEAFQARRMQARFRNAQGK-PELVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPEAL 416

Query: 414 RPYMNNLAVI 423
           RPYM  +  I
Sbjct: 417 RPYMGGMERI 426


>gi|224826934|ref|ZP_03700033.1| seryl-tRNA synthetase [Lutiella nitroferrum 2002]
 gi|224600921|gb|EEG07105.1| seryl-tRNA synthetase [Lutiella nitroferrum 2002]
          Length = 428

 Score =  434 bits (1115), Expect = e-119,   Method: Composition-based stats.
 Identities = 207/430 (48%), Positives = 282/430 (65%), Gaps = 11/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R  PE +   L  R  +  ++    L+ + + L  ++++++ARRN+ S QIG+
Sbjct: 1   MLDIQLLRSQPETVAERLAARGYQLDTDAFGQLENERKALQTRMQELQARRNATSKQIGE 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A  +G    V A+  E +TL ++L   E     V   L+  +  IPN+P   VP G   +
Sbjct: 61  AKRKG--EDVSAIMAEVATLGDELKAAEAAFEAVQQKLEHWLMTIPNLPHASVPQGKDES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R VG   S    +++H ++G  LG +DF+   KLSGARF+VL G +A L RAL Q
Sbjct: 119 ANVEVRRVGVPRSFEFEAKDHVDVGSPLG-LDFETGAKLSGARFTVLRGEIAQLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM++ HT++HGYTE+  P +V D  ++GTGQ+PKFA+DMF  T         ++LI TSE
Sbjct: 178 FMLNTHTNQHGYTEMYTPYIVNDSVLFGTGQLPKFAEDMFKVTRGGEEGAVDQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           ++LTN     I++   LP++ T  +P FRSEAGS GRDTRGM+RQHQF K E+V +   E
Sbjct: 238 ITLTNTVRESILKLDELPVKMTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQVVHPE 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVWL  QN YREISSC
Sbjct: 298 KSYDALEEMVGHAEAILKALELPYRVITLCTGDMGFGAAKTYDLEVWLPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C  FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LENY NADGSVT+PTVL
Sbjct: 358 SNCEAFQARRMQARFKDENGKN-QLVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPTVL 416

Query: 414 RPYMNNLAVI 423
           RPY+     I
Sbjct: 417 RPYLGGKEKI 426


>gi|254230182|ref|ZP_04923576.1| seryl-tRNA synthetase [Vibrio sp. Ex25]
 gi|262394647|ref|YP_003286501.1| seryl-tRNA synthetase [Vibrio sp. Ex25]
 gi|151937320|gb|EDN56184.1| seryl-tRNA synthetase [Vibrio sp. Ex25]
 gi|262338241|gb|ACY52036.1| seryl-tRNA synthetase [Vibrio sp. Ex25]
          Length = 435

 Score =  434 bits (1115), Expect = e-119,   Method: Composition-based stats.
 Identities = 191/434 (44%), Positives = 264/434 (60%), Gaps = 11/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   +     L +R  +   E I  L+E+ + +  ++E++++ RNS S QIGQ
Sbjct: 1   MLDSKLLRTELDETAAKLARRGFKLDVETIRKLEEQRKSIQVEVENLQSTRNSISKQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +A G+    + +K +  TL   L   + E  +V + L +    +PN+P +EVP G   N
Sbjct: 61  KMAAGDKEGAEEIKKQIGTLGSDLDAKKVELEQVMAQLDEFTLSVPNIPADEVPDGKDEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I   G+  +     ++H ++GE  G +DF  A K++GARF V+ G  A L RA+ Q
Sbjct: 121 DNVEISRWGEPKTYDFDLKDHVDLGEMGGGLDFASAVKITGARFIVMKGQFARLHRAIAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-----------TDGRWLI 229
           FM+DLHT EHGYTE+  P LV  ++++GTGQ+PKF  D+F T                LI
Sbjct: 181 FMLDLHTEEHGYTEMYVPYLVNSDSLFGTGQLPKFGKDLFHTEPLAEKVNDEEPRKLSLI 240

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV +TNL    I +   LP++ T   P FRSEAGS GRDTRG++R HQF K ELV I
Sbjct: 241 PTAEVPVTNLVRDTISDEADLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQI 300

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
           T+ EDS    E +   AE++L+ L+L YR V LCTGD+GF A KTYDLEVW+  Q  YRE
Sbjct: 301 TKPEDSMNALEELTGHAEKVLQLLELPYRKVVLCTGDMGFGARKTYDLEVWVPAQETYRE 360

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR ++AILEN   ADG + I
Sbjct: 361 ISSCSNMWDFQARRMQARFRRKGEKKPELVHTLNGSGLAVGRTMVAILENNQEADGRIAI 420

Query: 410 PTVLRPYMNNLAVI 423
           P VL+ YM     I
Sbjct: 421 PAVLQKYMGGATHI 434


>gi|172059906|ref|YP_001807558.1| seryl-tRNA synthetase [Burkholderia ambifaria MC40-6]
 gi|238689188|sp|B1YUL5|SYS_BURA4 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|171992423|gb|ACB63342.1| seryl-tRNA synthetase [Burkholderia ambifaria MC40-6]
          Length = 433

 Score =  434 bits (1115), Expect = e-119,   Method: Composition-based stats.
 Identities = 195/430 (45%), Positives = 270/430 (62%), Gaps = 11/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R +  + E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDLDGVAKRLADRGYTLDVAAFSALEAERRAIQTRTEELQARRNSLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G       +  E   + +++   E +  E+ + L  L+  +PN+  E VP+G    
Sbjct: 61  MKGKG--EDTSDVMAEVGGIGDEMKASEAKLGEIQTRLSDLMLGMPNIAHESVPVGKDEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G         ++H ++G  LG +DF+   KL+GARF++L G +A L RAL Q
Sbjct: 119 DNVEVRRWGTPREFDFAVKDHVDVGTPLG-LDFETGAKLAGARFTMLRGSIARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FMID HT +HGY+E   P +V  E +YGTGQ+PKFADDMF            ++LI TSE
Sbjct: 178 FMIDTHTLQHGYSETYTPYIVNPEILYGTGQLPKFADDMFRVEKGGGENTITQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     I+E  +LP++ T  +P FRSEAGS GRDTRGM+RQHQF K E+V +   +
Sbjct: 238 ISLTNTVRDSIVEGSALPIKLTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQVVAPD 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   + M+  AE IL++L L YRV++LCTGD+GFSA KT+DLEVWL  QN YREISSC
Sbjct: 298 ASYAALDEMVGHAEAILQKLGLPYRVITLCTGDMGFSAAKTFDLEVWLPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S    FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+A+LENY NADGSVT+P  L
Sbjct: 358 SNTEAFQARRMQARFRNAQGK-PELVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPEAL 416

Query: 414 RPYMNNLAVI 423
           RPYM  +  I
Sbjct: 417 RPYMGGMERI 426


>gi|37525551|ref|NP_928895.1| seryl-tRNA synthetase [Photorhabdus luminescens subsp. laumondii
           TTO1]
 gi|46577174|sp|Q7N6E7|SYS_PHOLL RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|36784979|emb|CAE13897.1| seryl-tRNA synthetase (serine--tRNA ligase) (SERRS) [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 429

 Score =  434 bits (1115), Expect = e-119,   Method: Composition-based stats.
 Identities = 193/430 (44%), Positives = 263/430 (61%), Gaps = 9/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R     +   L +R      + +   +E+ ++L  + E ++A RNS S  IG 
Sbjct: 1   MLDPNILRNELGAVAEKLARRGYTLDVDTLRKQEERRKVLQVETETLQAERNSRSKAIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    +D L+ E + L E+L   + E  ++ + ++ L   IPN+P + VP+G   N
Sbjct: 61  AKARG--EDIDPLRQEVNQLGEKLDTAKAELEKLQAEIRDLALSIPNIPDDSVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G+        ++H  +GE    +DF  A KL+G+RF V+ G +A L RAL Q
Sbjct: 119 DNLEVSRWGEPGKYDFEIQDHVSLGELTNGLDFAAAVKLTGSRFVVMKGQIARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM++LHT +HGY E   P LV  E +YGTGQ+PKF +D+F T            LIPT+E
Sbjct: 179 FMLNLHTEQHGYLETYVPYLVNHETLYGTGQLPKFGEDLFHTKPLEEEAESHYALIPTAE 238

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V +TNL   +I++   LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I   +
Sbjct: 239 VPITNLVRGDILDENELPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQIVHPD 298

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
           +S    E +   AE++L+ L+L YR V LCTGD+GFSACKTYDLEVWL  QN YREISSC
Sbjct: 299 ESMDALEALTGHAEKVLQLLNLPYRKVLLCTGDMGFSACKTYDLEVWLPAQNTYREISSC 358

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR L+A++ENY  ADG + IP VL
Sbjct: 359 SNMWDFQARRMQARFRGKEDKKTQLLHTLNGSGLAVGRTLVAVMENYQQADGRIEIPEVL 418

Query: 414 RPYMNNLAVI 423
           RPYM  L  I
Sbjct: 419 RPYMGGLEYI 428


>gi|304408763|ref|ZP_07390384.1| seryl-tRNA synthetase [Shewanella baltica OS183]
 gi|307302766|ref|ZP_07582521.1| seryl-tRNA synthetase [Shewanella baltica BA175]
 gi|304352584|gb|EFM16981.1| seryl-tRNA synthetase [Shewanella baltica OS183]
 gi|306913126|gb|EFN43548.1| seryl-tRNA synthetase [Shewanella baltica BA175]
          Length = 428

 Score =  434 bits (1115), Expect = e-119,   Method: Composition-based stats.
 Identities = 200/429 (46%), Positives = 263/429 (61%), Gaps = 8/429 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD +++R   E     L  R       ++  L+EK + L    E+++A RN+ S  IGQ
Sbjct: 1   MLDPKFLRNELEVTAERLATRGFILDIAHLTQLEEKRKSLQVTTEELQASRNAISKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    V+A+  +   L  QL   + E   V   +  +   +PN+P E  PIG    
Sbjct: 61  AKARG--EDVEAIMAQVGDLGSQLDAKKIELAAVLEEVNTIAMSMPNLPDESAPIGADET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G   +     ++H ++GE L  +DF  A K++G+RF V+ G +A L RA+GQ
Sbjct: 119 ENVEVRRWGTPRTFDFPIKDHIDLGEGLNGLDFKNAVKITGSRFIVMKGQVARLNRAIGQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG------RWLIPTSEV 234
           FM+DLHT+EHGYTE   PLLV + ++ GTGQ+PKF +D+F T           LIPT+EV
Sbjct: 179 FMLDLHTTEHGYTEAYVPLLVNEASLLGTGQLPKFGEDLFHTKPATEEGQGLSLIPTAEV 238

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            LTNL    I++   LP++ T     FRSEAGS G+DTRG++RQHQF K E+V I + ED
Sbjct: 239 PLTNLVRDSIVDEDELPIKLTAHTACFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVKPED 298

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCS 354
           S    E +   AE +L+RL L YR V LCTGD+GF + KTYD+EVWL  QN YREISSCS
Sbjct: 299 SMAALEALTGHAETVLQRLGLPYRTVILCTGDMGFGSSKTYDIEVWLPAQNTYREISSCS 358

Query: 355 TCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR 414
              +FQ+RRM +RYR          HTLNGSG+AVGR L+AILENY NADGS+TIP VLR
Sbjct: 359 NMKDFQARRMQARYRVKADNKPALLHTLNGSGLAVGRTLVAILENYQNADGSITIPEVLR 418

Query: 415 PYMNNLAVI 423
           PYM  L  I
Sbjct: 419 PYMGGLTKI 427


>gi|169825637|ref|YP_001695795.1| seryl-tRNA synthetase [Lysinibacillus sphaericus C3-41]
 gi|238688179|sp|B1HS47|SYS_LYSSC RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|168990125|gb|ACA37665.1| Seryl-tRNA synthetase [Lysinibacillus sphaericus C3-41]
          Length = 426

 Score =  434 bits (1115), Expect = e-119,   Method: Composition-based stats.
 Identities = 185/428 (43%), Positives = 268/428 (62%), Gaps = 4/428 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ +R N   +   L  R+ +    +   +LD K R LI K E+++A RN  S QI 
Sbjct: 1   MLDIKRVRDNFAEIKEMLLTRNEDLGNLDDFENLDAKRRELIAKTEELKAERNKVSEQIS 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
                 N    D +      + +++  L+ + ++V    K ++  +PNVP E VP+GT+ 
Sbjct: 61  VMKR--NKENADEVIARMRQVGDEIKELDIQLNDVEDRFKDMMMRLPNVPHESVPVGTTE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+   + G+ P+     + H+++   L ++DF+R  K++G+RF    G  A LERAL 
Sbjct: 119 DDNVEEYTWGEIPAFDFEIKAHWDLATDLKIVDFERGAKVTGSRFLFYRGLGARLERALM 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-TTDGRWLIPTSEVSLTN 238
            FM+DLH  EHGY E+  P++V  E++ GTGQ+PKF +D+F       ++IPT+EV +TN
Sbjct: 179 TFMMDLHAEEHGYEEMLPPVIVNRESLTGTGQLPKFEEDVFKLAETDYFMIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  EI+ +++LP  F   +  FRSEAGSAGRDTRG++RQHQF K ELV   + E+S+ +
Sbjct: 239 FYRDEILTAEALPQGFAAYSACFRSEAGSAGRDTRGLIRQHQFNKVELVRFVKPEESYEQ 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E +   AE++L+ L L YR + +CT DLGF+A K YDLEVW+  QN+YREISSCS   +
Sbjct: 299 LELLTGHAEKVLQLLGLPYRKLKMCTADLGFTAAKKYDLEVWIPAQNMYREISSCSNFED 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R   +   ++ HTLNGSG+A+GR + AILENY  ADGSV IP VLRPYM 
Sbjct: 359 FQARRANIRFRREPNAKPEYVHTLNGSGLAIGRTVAAILENYQQADGSVVIPEVLRPYMG 418

Query: 419 NLAVIKKE 426
              VI  +
Sbjct: 419 GKEVIAPK 426


>gi|226941475|ref|YP_002796549.1| Sys [Laribacter hongkongensis HLHK9]
 gi|254783032|sp|C1DBY7|SYS_LARHH RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|226716402|gb|ACO75540.1| Sys [Laribacter hongkongensis HLHK9]
          Length = 426

 Score =  434 bits (1115), Expect = e-119,   Method: Composition-based stats.
 Identities = 204/430 (47%), Positives = 274/430 (63%), Gaps = 7/430 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R   + +   L  R     +E   +L+ + + L  + +D++ARRNS S Q+G+
Sbjct: 1   MLDIQLLRTQLDTVAARLAARGYTLDTEAFTALENERKALQTRTQDLQARRNSLSKQVGE 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G      A+  E S L ++L   E     +   L +L+  IPN+P E VP+G    
Sbjct: 61  AKRRG--EDASAVLAEVSGLGDELKANEAALEGLQGRLAELLQAIPNLPHESVPVGRDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ IR VG   S     ++H +IG  LG +D +   KLSGARF+VL G +A L RAL Q
Sbjct: 119 GNVEIRRVGVPRSFDFQVKDHVDIGTPLG-LDAETGAKLSGARFTVLRGQMARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD---GRWLIPTSEVSLT 237
           FM++ H  EHGYTEV  P +V   +MYGTGQ+PKF +D+F         +L+PT+EV +T
Sbjct: 178 FMLNTHADEHGYTEVYTPYMVNATSMYGTGQLPKFEEDLFRVPRGDENFYLVPTAEVPVT 237

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
           N    EI+++  LPLR+    P FRSEAG+ GRDTRGM+RQHQF K ELV + R E+S  
Sbjct: 238 NFVRDEIVKAADLPLRYVAHTPCFRSEAGAYGRDTRGMIRQHQFDKVELVQVVRPEESLN 297

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
             E +   AE ILK+L L YRV+ LCTGD+GF + KTYD+EVWL  Q+ YREISSCS+ G
Sbjct: 298 ALETLTGHAETILKKLGLPYRVIVLCTGDMGFGSQKTYDIEVWLPAQDTYREISSCSSMG 357

Query: 358 NFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYM 417
           +FQ+RRM +R++D   K+ +  HTLNGSG+AVGR L+A+LENY NADGSVT+P VLRPYM
Sbjct: 358 DFQARRMQARFKDEAGKN-QLVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPEVLRPYM 416

Query: 418 NNLAVIKKEH 427
             L  +  + 
Sbjct: 417 GGLEKLLPQG 426


>gi|307946877|ref|ZP_07662212.1| seryl-tRNA synthetase [Roseibium sp. TrichSKD4]
 gi|307770541|gb|EFO29767.1| seryl-tRNA synthetase [Roseibium sp. TrichSKD4]
          Length = 425

 Score =  434 bits (1115), Expect = e-119,   Method: Composition-based stats.
 Identities = 236/423 (55%), Positives = 309/423 (73%), Gaps = 3/423 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+WIR+N E  D AL KR  EP +  +++LD+  R  I K+++++ RRNS S +IG+
Sbjct: 1   MFDIKWIRENSEAFDAALAKRGYEPSAAKLIALDDARRSHITKLQEVQERRNSTSKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A  +     AL NE + +K  +   E+EE ++ ++++  ++ IPN+P ++VP+G    
Sbjct: 61  AKATKDEEKAQALINEVAEIKAFIQSGEEEERKLVAAVEDAMAVIPNLPHDDVPVGEDEA 120

Query: 121 ENILIRSVGKKPSAIHL--SREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERAL 178
           +N+L R+ G+KP+       +EHFE+GE  G MDF  A  LSG+RF VL G +A LERAL
Sbjct: 121 DNVLYRTHGEKPTFTFNHAPKEHFELGEENGGMDFSTAANLSGSRFVVLKGQIARLERAL 180

Query: 179 GQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTN 238
           GQFMID HT EHGYTEVS PLLV D+ ++GT Q+PKF +D+F T D  +LIPT+EV LTN
Sbjct: 181 GQFMIDTHTQEHGYTEVSPPLLVHDKPLFGTSQLPKFEEDLFKTGDH-YLIPTAEVPLTN 239

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L + +I+  ++LP+R + L   FRSEAGSAGRDTRGMLRQHQF KCELVS+T+ EDS  E
Sbjct: 240 LVADQILIDEALPVRVSALTYCFRSEAGSAGRDTRGMLRQHQFQKCELVSVTKPEDSLNE 299

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            ERML CAE IL++L LHYRV++LCTGD+GF A KTYD+EVWL GQ+ YREISSCS CG+
Sbjct: 300 LERMLGCAETILQKLGLHYRVMTLCTGDMGFGARKTYDIEVWLPGQDTYREISSCSVCGD 359

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRMN+R+R    K     HTLNGSG+AVGR LIA+LENY N DG++T+P VLRPYMN
Sbjct: 360 FQARRMNARFRPQGEKQTVHVHTLNGSGIAVGRALIAVLENYQNGDGTITVPEVLRPYMN 419

Query: 419 NLA 421
            L 
Sbjct: 420 GLE 422


>gi|218532490|ref|YP_002423306.1| seryl-tRNA synthetase [Methylobacterium chloromethanicum CM4]
 gi|254783035|sp|B7KPY5|SYS_METC4 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|218524793|gb|ACK85378.1| seryl-tRNA synthetase [Methylobacterium chloromethanicum CM4]
          Length = 428

 Score =  434 bits (1115), Expect = e-119,   Method: Composition-based stats.
 Identities = 234/428 (54%), Positives = 298/428 (69%), Gaps = 1/428 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NPE  D  L++R L P S  +++LD+  +  +   +  + RRN+ S +IG 
Sbjct: 1   MHDIRAIRENPEAFDRDLERRGLAPLSAELIALDDVRKGAVSAAQAAQERRNALSKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A    + +    L  E + LKE+ P LE  + E   +L + ++ IPN P ++VP G   +
Sbjct: 61  AKKAKDEARATELMAEVARLKEEAPGLEAAQGEAAKALDERLAAIPNRPKDDVPPGADEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+  R        +   R+HFE+GEA GLMDF+ A KLSG+RF VL G LA LERALGQ
Sbjct: 121 GNVEYRRFDSSRERLTQGRQHFELGEATGLMDFEAAAKLSGSRFVVLKGQLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT EHGYTEV  P+LVR+EAM+GT Q+PKF DD F   +  WLIPT+EV LTNL 
Sbjct: 181 FMLDLHTGEHGYTEVVPPVLVREEAMFGTAQLPKFRDDQFAAGENFWLIPTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
              I+    LPLRFT L P FR+EAG+AGRDTRGMLRQHQF K ELVSIT  E S  EHE
Sbjct: 241 RESILAEDELPLRFTALTPCFRAEAGAAGRDTRGMLRQHQFNKVELVSITAPEKSAEEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML+CAE +L++LDL YRV++LCTGD+GF++ KTYD+EVW+ GQ  YREISSCS CG FQ
Sbjct: 301 RMLACAEAVLQKLDLTYRVMTLCTGDMGFASQKTYDIEVWVPGQQTYREISSCSVCGEFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR    + + F HTLNGSGVAVGR LIA++ENY N DGSVTIP+ L+PYM  L
Sbjct: 361 ARRMNARYRAKEGRGVGFVHTLNGSGVAVGRALIAVMENYQNPDGSVTIPSALQPYMGGL 420

Query: 421 AVIK-KEH 427
             I+  ++
Sbjct: 421 TRIEGPKN 428


>gi|269120640|ref|YP_003308817.1| seryl-tRNA synthetase [Sebaldella termitidis ATCC 33386]
 gi|268614518|gb|ACZ08886.1| seryl-tRNA synthetase [Sebaldella termitidis ATCC 33386]
          Length = 423

 Score =  434 bits (1115), Expect = e-119,   Method: Composition-based stats.
 Identities = 194/425 (45%), Positives = 275/425 (64%), Gaps = 2/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M+D+++IR+N E +  +LK R+     + +L  DE  R L+++ E ++  +N  SA IG+
Sbjct: 1   MIDMKFIRENTEIIRKSLKDRNSNFDLDGLLKADEARRELLQEAETLKKEKNDQSALIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG  +  D L  +   + +++  L+++  ++      L+  IPN   E  P+G S +
Sbjct: 61  YKREGKNA--DELLEKMGKVSDKIKELDEKTAKIEEEQNYLLLTIPNKLHESTPVGASED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G+        + H E+G  LG++DF+R  KLSG+RF+V  G  A LERAL  
Sbjct: 119 DNVEVRKWGEPKKFGFEPKPHEELGTELGILDFERGVKLSGSRFTVYKGMAAKLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHTSEHGY E+  P LV+ + M GTGQ+PKF DD + TTD  +LIPT+EV+LTNL+
Sbjct: 179 FMLDLHTSEHGYEEMLTPQLVKRDIMVGTGQLPKFEDDAYKTTDDMFLIPTAEVTLTNLH 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI+    LP  +      FR EAGS G+D +G+LRQHQF K E+V I   E+S+ E E
Sbjct: 239 KDEILAESELPKYYCGFTACFRREAGSHGKDMKGILRQHQFNKVEMVKIVHPENSYDELE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           +M++ AE +L++L++ YRV++LC+GD+GF A KTYDLEVW+  QN YREISSCS   +FQ
Sbjct: 299 KMVNNAETVLQKLNIPYRVLALCSGDIGFGASKTYDLEVWIPSQNKYREISSCSNTEDFQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RR   +YR    K   F HTLNGSG+AVGR L+AI+ENY   DGS+ IP VL PYM  +
Sbjct: 359 ARRAMIKYRSETDKKSYFVHTLNGSGLAVGRTLLAIMENYQKEDGSIEIPEVLIPYMGGI 418

Query: 421 AVIKK 425
             IKK
Sbjct: 419 TEIKK 423


>gi|89053561|ref|YP_509012.1| seryl-tRNA synthetase [Jannaschia sp. CCS1]
 gi|123286896|sp|Q28TH5|SYS_JANSC RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|88863110|gb|ABD53987.1| seryl-tRNA synthetase [Jannaschia sp. CCS1]
          Length = 430

 Score =  434 bits (1115), Expect = e-119,   Method: Composition-based stats.
 Identities = 213/429 (49%), Positives = 285/429 (66%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+ P   D AL  R L   S  IL++DE  R  I + E  +A RN+ S ++G+
Sbjct: 1   MHDIRAIRETPAAFDAALALRGLSAASADILAIDEARRAAITQAETAQADRNAASKEVGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  + L+   ST K+++  L++E     + L  ++  +PN+P  +VP G   +
Sbjct: 61  AKASGDEAEFERLRALVSTKKDEIARLDEEAKAKDAELTAILEALPNLPSPDVPAGADED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+     G   +      EHF+I      MDF+ A KLSGARF  L G +A + RAL Q
Sbjct: 121 DNVEQHRRGTPRAFDFKPLEHFDIPGIAASMDFETAAKLSGARFVTLKGAVARVHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D HT E+G TE++AP+LVRDE MYGTGQ+PKFA+D + TT+G WLIPTSEV+LT+L 
Sbjct: 181 FMLDTHTEENGLTEINAPVLVRDETMYGTGQLPKFAEDSYQTTNGWWLIPTSEVTLTSLD 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           S  I++  +LP R+   +  FRSEAGSAGRDT GMLRQHQF K E+VS+T  + S  E +
Sbjct: 241 SGNIVDEATLPHRYAAHSLCFRSEAGSAGRDTAGMLRQHQFEKVEMVSVTHPDQSNAEQQ 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML+CAE IL +L++ YR V LC GD+GF A +TYD+E WL GQ+ YREISS STCG FQ
Sbjct: 301 RMLACAEGILDKLEIPYRTVLLCAGDMGFGATRTYDIEAWLPGQDTYREISSVSTCGAFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++  +    +F HTLNGSG+AVGRCLIA+LEN  NADGSVT+P  L P++   
Sbjct: 361 ARRMNARFKPSDGGKPEFVHTLNGSGLAVGRCLIAVLENGQNADGSVTLPAALHPWLGGK 420

Query: 421 AVIKKEHIL 429
             I  E  L
Sbjct: 421 TRITAEGNL 429


>gi|299542086|ref|ZP_07052402.1| seryl-tRNA synthetase [Lysinibacillus fusiformis ZC1]
 gi|298725401|gb|EFI66049.1| seryl-tRNA synthetase [Lysinibacillus fusiformis ZC1]
          Length = 426

 Score =  434 bits (1115), Expect = e-119,   Method: Composition-based stats.
 Identities = 184/428 (42%), Positives = 269/428 (62%), Gaps = 4/428 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ +R+N   +   L  R+ +    +    LD K R LI K ED++A RN  S QI 
Sbjct: 1   MLDIKRVRENFTEIKEMLLTRNEDLGNLDDFEDLDAKRRELIAKTEDLKAERNKVSEQIS 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
                 N    D +      + +++  L+ + ++V    K ++  +PN+P E VP+GT+ 
Sbjct: 61  VMKR--NKENADEVITRMRQVGDEIKELDVQLNDVEERFKDMMMRLPNIPHESVPVGTTE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+   + G+ P+     + H+++   L ++DF+R  K++G+RF    G  A LERAL 
Sbjct: 119 DDNVEEYTWGEIPTFDFDIKAHWDLATDLKIVDFERGAKVTGSRFLFYRGLGARLERALM 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-TTDGRWLIPTSEVSLTN 238
            FM+DLH  EHGY E+  P++V  +++ GTGQ+PKF +D+F       ++IPT+EV +TN
Sbjct: 179 TFMMDLHAEEHGYEEMLPPVIVNRDSLTGTGQLPKFEEDVFKLEETDYFMIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  EI+ +++LP  F   +  FRSEAGSAGRDTRG++RQHQF K ELV   + E+S+ +
Sbjct: 239 FYRDEILPAEALPQGFAAYSACFRSEAGSAGRDTRGLIRQHQFNKVELVRFVKPEESYEQ 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E + S AE++L+ L L YR + +CT DLGF+A K YDLEVW+  QN+YREISSCS   +
Sbjct: 299 LELLTSHAEKVLQLLGLPYRKLKMCTADLGFTAAKKYDLEVWIPAQNMYREISSCSNFED 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R   +   ++ HTLNGSG+A+GR + A+LENY  ADGSV IP VLRPYM 
Sbjct: 359 FQARRANIRFRREPNAKPEYVHTLNGSGLAIGRTVAALLENYQQADGSVVIPEVLRPYMG 418

Query: 419 NLAVIKKE 426
              VI  +
Sbjct: 419 GKEVIAPK 426


>gi|226944892|ref|YP_002799965.1| seryl-tRNA synthetase [Azotobacter vinelandii DJ]
 gi|259511660|sp|C1DKY8|SYS_AZOVD RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|226719819|gb|ACO78990.1| seryl-tRNA synthetase [Azotobacter vinelandii DJ]
          Length = 426

 Score =  434 bits (1115), Expect = e-119,   Method: Composition-based stats.
 Identities = 195/427 (45%), Positives = 277/427 (64%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R  +       SL+ + + +  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLVRTQLQEIVGRLATRGFQLDVARFESLEAQRKAVQTRTEQLQAERNARSKTIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A + G    +  L  E   +   L   ++E   + + L  L+  IPN+P E VP+G    
Sbjct: 61  AKSRG--EDIAPLLAEVDRMGSDLEAGKRELDAIQAELDALMLSIPNLPHESVPVGADEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G   +     ++H  +GE  G +DF+ A KLSGARF+++ G +A L RAL Q
Sbjct: 119 DNVEVRRWGVPRTFDFAIKDHVALGERHGWLDFETAAKLSGARFALMRGPIARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD----GRWLIPTSEVSL 236
           FM+DLHT EHGY E   P LV+  A+ GTGQ+PKF +D+F  +       +LIPT+EVSL
Sbjct: 179 FMLDLHTGEHGYEEAYTPYLVQAPALQGTGQLPKFEEDLFKISREGEADFYLIPTAEVSL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+ + EI++++ LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I     S+
Sbjct: 239 TNIVAGEILDARQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVRIVDPAKSY 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
              E + + AE++L+RL+L YRV++LCTGD+GFSA KTYDLEVW+  Q+ YREISSCS C
Sbjct: 299 EALEELTANAEKVLQRLELPYRVLALCTGDMGFSATKTYDLEVWVPSQDKYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P VL+PY
Sbjct: 359 GDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPEVLKPY 418

Query: 417 MNNLAVI 423
           M  + VI
Sbjct: 419 MGGIEVI 425


>gi|27262200|gb|AAN87381.1| Seryl-tRNA synthetase [Heliobacillus mobilis]
          Length = 424

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 187/427 (43%), Positives = 277/427 (64%), Gaps = 4/427 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD +++R NP+ ++ ALK R      +  L LD + R ++ ++E ++A+RN+ SA+I +
Sbjct: 1   MLDTKFVRANPQVVEEALKNRGANLSLDDFLELDRRRRSILVEVEKLKAQRNAVSAEIAR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
                     +A+  E   + +Q+  L+ +  ++   ++KL+  IPN+P   VP+G S  
Sbjct: 61  KKKA--KEDAEAMILEMRQVGDQIKDLDDQLAQIEEDMEKLLYYIPNIPHASVPVGLSEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R+ G   S     + H+++GE L ++DF R  K++GARF+V  G  A LERA+  
Sbjct: 119 ENVEMRTWGTPESFDFPVKAHWDLGEELDILDFQRGAKITGARFTVYKGLGARLERAIIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTNL 239
            M+D H  + GYTE+  P +V  ++M+GTGQ+PKFA+DMF  +   +  IPT+EV +TNL
Sbjct: 179 LMMDTHA-QRGYTEIFPPFMVNKQSMFGTGQLPKFAEDMFAVSGTEYFLIPTAEVPVTNL 237

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y +EI+E++ LP+     +  FR+EAG+AGRDTRG++RQHQF K ELV  T  + S+ E 
Sbjct: 238 YGNEILEAEQLPIYHCAYSACFRAEAGAAGRDTRGLIRQHQFNKVELVKFTHPDHSYEEL 297

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++ + AE IL+ L L YRV++LCTGD+GFS+ KTYD+EVWL     YREISSCS   +F
Sbjct: 298 EKLTADAEHILQLLGLPYRVITLCTGDMGFSSAKTYDIEVWLPSFQTYREISSCSNFEDF 357

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N R+R       +F HTLNGSG+A+GR + AILENY   DG+V IP  LRPYM  
Sbjct: 358 QARRANIRFRPSPKAKPEFVHTLNGSGLAIGRTVAAILENYQQPDGTVLIPEALRPYMGT 417

Query: 420 LAVIKKE 426
             ++ K+
Sbjct: 418 DRIVPKK 424


>gi|304405768|ref|ZP_07387426.1| seryl-tRNA synthetase [Paenibacillus curdlanolyticus YK9]
 gi|304345011|gb|EFM10847.1| seryl-tRNA synthetase [Paenibacillus curdlanolyticus YK9]
          Length = 426

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 189/428 (44%), Positives = 277/428 (64%), Gaps = 4/428 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQ-SEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++W+R + + +  AL  R    +      +LD + R ++++ E ++ RRN+ S ++ 
Sbjct: 1   MLDVKWLRNDYDKVVQALVNRGKSEELVAAFPALDTRRREILQETEQLKNRRNTVSQEVA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           Q    G     +AL  E   + +++  ++ E   + + + +L+  +PN+P E VPIG S 
Sbjct: 61  QLKRTGG--DAEALIIEMREVGDRIKEIDDEVRALEAQIDELMLALPNLPNEGVPIGASE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            +N+ +R  G+  +     + H++I + LG++DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 EDNVEVRRAGEVKTFDFEPKPHWDIAQELGILDFERAAKVTGSRFVFYRGLGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-TDGRWLIPTSEVSLTN 238
            FM+DLH+ +HGY E+  P +V  +++YGTGQ+PKF +D+F       +LIPT+EV +TN
Sbjct: 179 NFMMDLHSDKHGYEEILPPYIVNRDSLYGTGQLPKFEEDLFKIADSDYYLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           +   EI+ S+ LP  F   +  FRSEAG+AGRDTRG++RQHQF K EL+ + + E S+ E
Sbjct: 239 IAREEILSSEELPKYFVAYSACFRSEAGAAGRDTRGLIRQHQFNKVELLKLVKPETSYDE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E M + AE++L+ L L YRV++LCTGD+GFSA KTYDLEVWL   + YREISSCS   +
Sbjct: 299 LEAMTANAEKVLELLGLPYRVLALCTGDMGFSAAKTYDLEVWLPSADTYREISSCSNVED 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R       +F HTLNGSG+AVGR L AILENY  ADGSV +P  LRPYM 
Sbjct: 359 FQARRANIRFRREAKSKPEFVHTLNGSGLAVGRTLAAILENYQQADGSVIVPEALRPYMG 418

Query: 419 NLAVIKKE 426
            + VI K+
Sbjct: 419 GIEVITKK 426


>gi|309378431|emb|CBX22926.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 431

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 202/433 (46%), Positives = 274/433 (63%), Gaps = 9/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L  R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQSLRSNTAAVAERLAARGYEFDAARFNALEEQRKAVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G      A  ++ + +K  L     +   V   L   +S IPN+P E VP G    
Sbjct: 61  LKGRGRHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLSGIPNLPHESVPAGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRRVGTPREFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMRGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM+D HT EHGYTE   P +V    +YGTGQ+PKF +D+F  T         ++LIPT+E
Sbjct: 180 FMLDTHTLEHGYTEHYTPYIVNGGTLYGTGQLPKFGEDLFHVTRGGDESKTAQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II S+ LPL+ T  +P FRSEAG+ G+D RG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVAGSIIPSEQLPLKLTAHSPCFRSEAGAYGKDVRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYGALEEMVGHAENILKALELPYRVITLCTGDMGFGAAKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIKKE 426
           +PYM  +A ++ +
Sbjct: 419 QPYMGGVAKLEAK 431


>gi|153000732|ref|YP_001366413.1| seryl-tRNA synthetase [Shewanella baltica OS185]
 gi|160875431|ref|YP_001554747.1| seryl-tRNA synthetase [Shewanella baltica OS195]
 gi|166223286|sp|A6WNG1|SYS_SHEB8 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|189083585|sp|A9L269|SYS_SHEB9 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|151365350|gb|ABS08350.1| seryl-tRNA synthetase [Shewanella baltica OS185]
 gi|160860953|gb|ABX49487.1| seryl-tRNA synthetase [Shewanella baltica OS195]
 gi|315267621|gb|ADT94474.1| seryl-tRNA synthetase [Shewanella baltica OS678]
          Length = 428

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 200/429 (46%), Positives = 263/429 (61%), Gaps = 8/429 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD +++R   E     L  R       ++  L+EK + L    E+++A RN+ S  IGQ
Sbjct: 1   MLDPKFLRNELEVTAERLATRGFILDIAHLTQLEEKRKSLQVATEELQASRNAISKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    V+A+  +   L  QL   + E   V   +  +   +PN+P E  PIG    
Sbjct: 61  AKARG--EDVEAIMAQVGDLGSQLDAKKIELAAVLEEVNAIAMSMPNLPDESAPIGADET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G   +     ++H ++GE L  +DF  A K++G+RF V+ G +A L RA+GQ
Sbjct: 119 ENVEVRRWGTPRTFDFPIKDHIDLGEGLNGLDFKNAVKITGSRFIVMKGQVARLNRAIGQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG------RWLIPTSEV 234
           FM+DLHT+EHGYTE   PLLV + ++ GTGQ+PKF +D+F T           LIPT+EV
Sbjct: 179 FMLDLHTTEHGYTEAYVPLLVNEASLLGTGQLPKFGEDLFHTKPATEEGQGLSLIPTAEV 238

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            LTNL    I++   LP++ T     FRSEAGS G+DTRG++RQHQF K E+V I + ED
Sbjct: 239 PLTNLVRDSIVDEDELPIKLTAHTACFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVKPED 298

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCS 354
           S    E +   AE +L+RL L YR V LCTGD+GF + KTYD+EVWL  QN YREISSCS
Sbjct: 299 SMAALEALTGHAETVLQRLGLPYRTVILCTGDMGFGSSKTYDIEVWLPAQNTYREISSCS 358

Query: 355 TCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR 414
              +FQ+RRM +RYR          HTLNGSG+AVGR L+AILENY NADGS+TIP VLR
Sbjct: 359 NMKDFQARRMQARYRVKADNKPALLHTLNGSGLAVGRTLVAILENYQNADGSITIPEVLR 418

Query: 415 PYMNNLAVI 423
           PYM  L  I
Sbjct: 419 PYMGGLTQI 427


>gi|120554467|ref|YP_958818.1| seryl-tRNA synthetase [Marinobacter aquaeolei VT8]
 gi|166222740|sp|A1U0W2|SYS_MARAV RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|120324316|gb|ABM18631.1| seryl-tRNA synthetase [Marinobacter aquaeolei VT8]
          Length = 424

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 195/426 (45%), Positives = 270/426 (63%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   E +   L  ++ E        L+E+ R +  + E++++ +N  S  IG+
Sbjct: 1   MLDPKRVRTQTEEIARRLAIKNFEFDIATFEQLEERRRAIQVRTENLQSEQNKRSKSIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    +  L  E  +LK+Q    E E   V  SL    + IPN+P ++VP G S +
Sbjct: 61  AKAAG--EDIKPLLEEVESLKQQRGDAEDELRSVQESLNAFFAGIPNLPDDDVPPGASED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+  R  G         ++H  +GE L  +DF++AT+L+ +RF+V+ G LA L RAL Q
Sbjct: 119 DNVETRVWGTPREFDFEPKDHVALGEQLKGLDFEKATQLAHSRFAVMRGQLARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT--TDGRWLIPTSEVSLTN 238
           FM+D HT +HGYTE   P LV    ++GTGQ+PKF +D+F T   +  +LIPT+EV  TN
Sbjct: 179 FMLDQHTLQHGYTEAYVPYLVNANTLFGTGQLPKFEEDLFRTAGDNPLYLIPTAEVPATN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L +  I++   LPLR     P FRSEAGS GRD RGM+RQHQF K ELV I R ++S   
Sbjct: 239 LVADTILDDAELPLRLVCHTPCFRSEAGSYGRDVRGMIRQHQFDKVELVHIVRPDESTQA 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E +   AE+IL+ L+L YRVV+LC GD+GFSA KTYDLEVWL GQ  YREISSCS   +
Sbjct: 299 LEELTGHAEKILQLLELPYRVVTLCGGDMGFSAAKTYDLEVWLPGQGKYREISSCSNTRD 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRM +R+R+P++   +  HTLNGSG+AVGR +IA++ENY  ADGS+ +P VL+PYM 
Sbjct: 359 FQARRMQARWRNPDTGKPEPVHTLNGSGLAVGRAMIAVMENYQQADGSILVPEVLKPYMG 418

Query: 419 NLAVIK 424
            +  I+
Sbjct: 419 GVERIQ 424


>gi|301156526|emb|CBW15997.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Haemophilus parainfluenzae T3T1]
          Length = 429

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 194/431 (45%), Positives = 263/431 (61%), Gaps = 8/431 (1%)

Query: 1   MLDIQWIRQNPEHLDIALK-KRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           M+D   +R N   +   LK KR+    +E + +L+E+ + L  K E ++A RN+ S  IG
Sbjct: 1   MIDPNLLRNNLAEVAEKLKVKRNFILDTEKLTALEEQRKDLQVKTETLQAERNARSKAIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
            A A G    +  L  E   + EQL   + +   V + + ++   IPN+P +EVP+G   
Sbjct: 61  AAKARG--EDIAPLLAEVDNMGEQLNEAKTQLDAVLAEINQIALSIPNIPADEVPLGKDD 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            EN  I   G   +     ++H  +GE    +DF    KL+GARF+V+ G +A + RAL 
Sbjct: 119 TENKEILRWGTPRTFDFEIKDHVSLGEDANGLDFAAGAKLAGARFAVMKGQIAKMHRALA 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-----TDGRWLIPTSEV 234
           QFM+DLHT +HGY E   P LV    +YGTGQ+PKF +D+F T          LIPT+EV
Sbjct: 179 QFMLDLHTEQHGYLETYVPYLVNHATLYGTGQLPKFGEDLFHTLALEGEQPYALIPTAEV 238

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            +TNL    I++   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I   + 
Sbjct: 239 PVTNLVRDVIVDEADLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVDPDK 298

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCS 354
           S    E +   AE++L+ L+L YR V LCTGD+GF +CKTYDLEVW+  Q+ YREISSCS
Sbjct: 299 SMEALEELTGHAEKVLQLLNLPYRKVLLCTGDMGFGSCKTYDLEVWVPAQDTYREISSCS 358

Query: 355 TCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR 414
              +FQ+RRM +R +    K  +  HTLNGSG+AVGR L+A+LENY NADGS+T+P VLR
Sbjct: 359 NMWDFQARRMQARCKAKGDKKTRLVHTLNGSGLAVGRTLVAVLENYQNADGSITVPEVLR 418

Query: 415 PYMNNLAVIKK 425
           PYM  L VI K
Sbjct: 419 PYMGGLEVICK 429


>gi|171315517|ref|ZP_02904753.1| seryl-tRNA synthetase [Burkholderia ambifaria MEX-5]
 gi|171099354|gb|EDT44092.1| seryl-tRNA synthetase [Burkholderia ambifaria MEX-5]
          Length = 433

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 196/430 (45%), Positives = 271/430 (63%), Gaps = 11/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R +  + E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDLDGVAKRLADRGYTLDVAAFSALEAERRAIQTRTEELQARRNSLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A+  E   + +++   E +  E+ + L  L+  +PN+  E VP+G    
Sbjct: 61  MKGKG--EDTSAVMAEVGGIGDEMKASEVKLGEIQTRLSDLMLGMPNIAHESVPVGDDEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G         ++H ++G  LG +DF+   KL+GARF++L G +A L RAL Q
Sbjct: 119 DNVEVRRWGTPRQFDFAVKDHVDVGTPLG-LDFETGAKLAGARFTMLRGSIARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FMID HT +HGY+E   P +V  E +YGTGQ+PKFADDMF            ++LI TSE
Sbjct: 178 FMIDTHTLQHGYSETYTPYIVNPEILYGTGQLPKFADDMFRVEKGGGENTITQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     I+E  +LP++ T  +P FRSEAGS GRDTRGM+RQHQF K E+V +   +
Sbjct: 238 ISLTNTVRESIVEGSALPIKLTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQVVAPD 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   + M+  AE IL++L L YRV++LCTGD+GFSA KT+DLEVWL  QN YREISSC
Sbjct: 298 ASYAALDEMVGHAEAILQKLGLPYRVITLCTGDMGFSAAKTFDLEVWLPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S    FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+A+LENY NADGSVT+P  L
Sbjct: 358 SNTEAFQARRMQARFRNAQGK-PELVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPEAL 416

Query: 414 RPYMNNLAVI 423
           RPYM  +  I
Sbjct: 417 RPYMGGMERI 426


>gi|270261178|ref|ZP_06189451.1| seryl-tRNA synthetase [Serratia odorifera 4Rx13]
 gi|270044662|gb|EFA17753.1| seryl-tRNA synthetase [Serratia odorifera 4Rx13]
          Length = 430

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 195/431 (45%), Positives = 266/431 (61%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R   + + + L +R  +   + + S +E+ ++L  + E ++A RNS S  IG 
Sbjct: 1   MLDPNLLRNELDAVAVKLARRGFKLDLDLLRSQEERRKVLQVESETLQAERNSRSKSIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L ++L + +     + + ++     +PN+P + VP G   +
Sbjct: 61  AKARG--EDIEPLRREVNELGDKLDVAKAALDSLQTEIRDYALTLPNLPDDAVPNGKDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN  +   G+        R+H ++GE  G +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 ENQEVCRWGEPRQYDFQVRDHVDLGEMAGGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY E   P LV    +YGTGQ+PKF DD+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYLEAYVPYLVNHATLYGTGQLPKFGDDLFHTKPLEEESDSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI+E +SLPL+ T   P FR+EAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEILEEESLPLKMTAHTPCFRAEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E +   AE++L+ L+L YR V LCTGD+GF ACKTYDLEVWL  Q+ YREISS
Sbjct: 299 EDSMAALEELTGHAEKVLQLLNLPYRKVLLCTGDMGFGACKTYDLEVWLPAQDTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R    K  +  HTLNGSG+AVGR L+A+LENY  ADG + +P V
Sbjct: 359 CSNMWDFQARRMQARCRSKTEKKPRLVHTLNGSGLAVGRTLVAVLENYQQADGRIQVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYMN L  I
Sbjct: 419 LRPYMNGLEYI 429


>gi|240949608|ref|ZP_04753943.1| seryl-tRNA synthetase [Actinobacillus minor NM305]
 gi|240295866|gb|EER46542.1| seryl-tRNA synthetase [Actinobacillus minor NM305]
          Length = 435

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 201/436 (46%), Positives = 271/436 (62%), Gaps = 14/436 (3%)

Query: 1   MLDIQWIRQNPEHLDIALK-KRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           M+D   +R N + +   LK KR+     E I SL+E+ + L  K E ++A RN+ S  IG
Sbjct: 1   MIDQNLLRTNLDEIAQTLKIKRNFTLDVERIKSLEEQRKTLQVKTETLQAERNARSKNIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
            A A G    +  L  E   +  +L   +    +V + ++ ++  +PN+P EEVP+G   
Sbjct: 61  AAKARG--EDISVLLAEVDNMGNELTEAKNALDQVQAEIRDILLAVPNLPAEEVPLGKDD 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +EN+ +   G+        ++H  +GE LG +DF    KL+ +RF V+ G LA L RAL 
Sbjct: 119 SENLEVARWGEPRQFDFEVKDHVTLGENLGGLDFAAGVKLTASRFVVMKGKLARLHRALS 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-----------GRWL 228
           QFM+DLHT +HGY E + P LV  + ++GTGQ+PKF +D+F T                L
Sbjct: 179 QFMLDLHTEQHGYVETNVPFLVNHDTLFGTGQLPKFGEDLFHTQPLTGQDPNETQRPFSL 238

Query: 229 IPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVS 288
           IPT+EV +TNL   EII+ ++LPLR+T   P FRSEAGS GRDTRG++R HQF K E+V 
Sbjct: 239 IPTAEVPVTNLVRDEIIDEETLPLRYTAHTPCFRSEAGSYGRDTRGLIRMHQFEKVEMVQ 298

Query: 289 ITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYR 348
           I   E S    E +   AE++L+ L+L YR V LCTGD+GF + KTYDLEVWL  QN YR
Sbjct: 299 IVAPEKSMEALEELTGHAEKVLQLLNLPYRKVLLCTGDMGFGSAKTYDLEVWLPAQNTYR 358

Query: 349 EISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVT 408
           EISSCS   +FQ+RRM++R +  N K  +  HTLNGSG+AVGR L+A+LENY NADGS+T
Sbjct: 359 EISSCSNMWDFQARRMSARCKAKNDKKTRLVHTLNGSGLAVGRTLVAVLENYQNADGSIT 418

Query: 409 IPTVLRPYMNNLAVIK 424
           IP VLRPYM    VIK
Sbjct: 419 IPEVLRPYMGGQEVIK 434


>gi|332993163|gb|AEF03218.1| seryl-tRNA synthetase [Alteromonas sp. SN2]
          Length = 430

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 203/431 (47%), Positives = 269/431 (62%), Gaps = 9/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R + E     L  R          SL+EK + L  K +D++  RN  S  IG+
Sbjct: 1   MLDPKCLRSDIEETAKRLAARGYNLDVATFNSLEEKRKTLQSKTQDLQNERNVRSKSIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A ++G    +  L  E   L + L   + E   +   +      IPN+P E VP G   +
Sbjct: 61  AKSQG--EDIAPLLAEVGKLGDDLDAAKAELTVLLDEITAFTQGIPNLPHESVPEGKDED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGE-ALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +N+ I   G+  +     ++H +IGE     +DF  ATKL+G+RF V+   +A L RA+ 
Sbjct: 119 DNVEISRWGEPRAFDFDVKDHVDIGEGLNNSLDFATATKLTGSRFVVMRREMARLNRAIA 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG------RWLIPTSE 233
           QFM+D+HT+EHGY E+  P LV  +++YGTGQ+PKF +D+F T           LIPT+E
Sbjct: 179 QFMLDVHTTEHGYDEMYVPFLVNADSLYGTGQLPKFGEDLFHTQPATEEGQGLSLIPTAE 238

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V LTN+   EI++ KSLP++ T   P FRSEAGS GRDTRG++RQHQF K ELV + + E
Sbjct: 239 VPLTNIARDEILDEKSLPIKMTAHTPCFRSEAGSYGRDTRGLIRQHQFDKVELVQLVKPE 298

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
           DSF   E +   AE IL++L+L YR V LCTGD+GF ACKTYDLEVWL  QN YREISSC
Sbjct: 299 DSFDALEELTQHAETILQKLELPYRKVLLCTGDMGFGACKTYDLEVWLPAQNTYREISSC 358

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+AILENY  ADGSVT+P  L
Sbjct: 359 SNMVDFQARRMQARFRNPETNKPELLHTLNGSGLAVGRTLVAILENYQQADGSVTVPKAL 418

Query: 414 RPYMNNLAVIK 424
            PYMN L VIK
Sbjct: 419 VPYMNGLEVIK 429


>gi|313896743|ref|ZP_07830291.1| serine--tRNA ligase [Selenomonas sp. oral taxon 137 str. F0430]
 gi|312974660|gb|EFR40127.1| serine--tRNA ligase [Selenomonas sp. oral taxon 137 str. F0430]
          Length = 423

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 190/425 (44%), Positives = 271/425 (63%), Gaps = 3/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++++R+N + +   LK R          +LDE+ R +++ +E+ +ARRN+ S +IG 
Sbjct: 1   MLDMKFVRENLDAVREMLKNRCNGLDLSPFTALDEERRRILQDVEEKKARRNAVSKEIGV 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G     + +  E  TL +++  L+++  +V   L+ L+  IPN+P  +VP+G    
Sbjct: 61  RKKAG--EAAEDVVAEMRTLGDEIAALDEDLRDVELKLRDLLLQIPNMPKADVPVGRDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN  +R  G         + H++IGE LG++D +RA K++GARF+   G  A LERA   
Sbjct: 119 ENPEVRRTGTPRVFDFEPKAHWDIGEQLGILDAERAAKVTGARFTFYKGLGARLERACIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-TTDGRWLIPTSEVSLTNL 239
           FM+DLH  +HGYTE+ AP +V + +M GTGQ+PKFA+DMF       +L+PT+EV  TN 
Sbjct: 179 FMMDLHAEKHGYTEMLAPYIVNESSMVGTGQLPKFAEDMFKLEGLDYYLVPTAEVPTTNY 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +  EI+++  LP  +T+    FR+EAGSAGRDTRG++RQHQF K EL+     E S+ E 
Sbjct: 239 HRDEILDAAQLPEYYTSYTACFRAEAGSAGRDTRGLIRQHQFNKVELIKFVTPETSWDEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E M+  AE++L+ L+L YRV+ LCTGD+ F++ KTYDLEVW+  QN YREISSCS C ++
Sbjct: 299 ESMVEAAEDVLRTLELPYRVIQLCTGDMSFTSAKTYDLEVWMPAQNKYREISSCSNCTDY 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N +YR        F HTLNGSGVAVGR + AILEN    DGSV +P  L PYM  
Sbjct: 359 QARRANIKYRPARGAKPAFLHTLNGSGVAVGRTVAAILENNQQEDGSVVVPQALVPYMGG 418

Query: 420 LAVIK 424
           + VI+
Sbjct: 419 VTVIR 423


>gi|212635388|ref|YP_002311913.1| seryl-tRNA synthetase [Shewanella piezotolerans WP3]
 gi|226701397|sp|B8CP82|SYS_SHEPW RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|212556872|gb|ACJ29326.1| Seryl-tRNA synthetase, class IIa [Shewanella piezotolerans WP3]
          Length = 428

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 197/429 (45%), Positives = 265/429 (61%), Gaps = 8/429 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD +++R   E     L  R      E +  L+EK + L    E+++A RN+ S  IGQ
Sbjct: 1   MLDPKFLRNELEVTAERLATRGFILDVERLGKLEEKRKSLQVSTEELQASRNAISKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G    V  +  +  TL  +L   + E   +   L  +   +PN+P E  PIG   +
Sbjct: 61  AKAKG--EDVAPIMAKVGTLGAELDAKKVELAALLDELNAIAMSVPNLPDESAPIGADES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ IR  G         ++H E+GE LG +DF  A KL+G+RF ++ G +A + RAL Q
Sbjct: 119 ENVEIRRWGTPKEFNFEVKDHVELGETLGGLDFKNAVKLTGSRFIIMKGQIARMHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG------RWLIPTSEV 234
           FM+DLHT+EHGYTE   PLLV ++++ GTGQ+PKF +D+F T           LIPT+EV
Sbjct: 179 FMLDLHTTEHGYTEAYVPLLVNEDSLLGTGQLPKFGEDLFHTKPATEEGQGLSLIPTAEV 238

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            LTN+    II+   LP+  T   P FRSEAGS GRDTRG++RQHQF K ELV + + ED
Sbjct: 239 PLTNIARDSIIDEDDLPVMMTAHTPCFRSEAGSYGRDTRGLIRQHQFDKVELVQLVKPED 298

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCS 354
           S    E +   AE +L++L L YR V LCTGD+GF A KT+D+EVWL  Q+ +REISSCS
Sbjct: 299 SMQALEELTGHAETVLQKLGLPYRTVVLCTGDMGFGAAKTFDIEVWLPAQDTFREISSCS 358

Query: 355 TCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR 414
              +FQSRRM +R++  ++K     HTLNGSG+AVGR L+A+LENY N DGS+T+P VLR
Sbjct: 359 NMQDFQSRRMQARFKAKSAKKPSLLHTLNGSGLAVGRTLVAVLENYQNEDGSITVPEVLR 418

Query: 415 PYMNNLAVI 423
            YM  L  I
Sbjct: 419 GYMGGLEKI 427


>gi|56459772|ref|YP_155053.1| seryl-tRNA synthetase [Idiomarina loihiensis L2TR]
 gi|67461667|sp|Q5R0B0|SYS_IDILO RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|56178782|gb|AAV81504.1| Seryl-tRNA synthetase [Idiomarina loihiensis L2TR]
          Length = 430

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 199/431 (46%), Positives = 269/431 (62%), Gaps = 9/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD ++ R+  +     L  R  +     +  L+E+ + +  + E ++A RNS S  IG+
Sbjct: 1   MLDAKYFREELDQTAKKLATRGFDLDVAKLQKLEEQRKEVQVRTEQLQAERNSRSKAIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    +  L +  S L EQL   ++E   +   L  +I  +PN+P +EVP G   +
Sbjct: 61  AKASG--EDIQPLLDAVSDLGEQLDNAKEELKVIQQELNDIIMGVPNLPADEVPEGADED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEA-LGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           EN  + + GK  S     ++H ++GEA    MDF+ A KL+GARF V+ G +A + RAL 
Sbjct: 119 ENQEVLTWGKPKSFDFEVKDHVDLGEALAKGMDFETAAKLTGARFVVMRGGIARMHRALT 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT------TDGRWLIPTSE 233
           QFM+DLHT EHGY E   P +V  +++YGTGQ+PKF  D+F             LIPT+E
Sbjct: 179 QFMLDLHTDEHGYLETYVPYMVNQDSLYGTGQLPKFGKDLFHIEGESQDQIPMSLIPTAE 238

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V LTNLY  EI + + LPL+FT   P FRSEAGS GRDTRG++RQHQF K ELV + + E
Sbjct: 239 VPLTNLYRDEIADEEELPLKFTAHTPCFRSEAGSHGRDTRGLIRQHQFDKVELVWLVKPE 298

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S    E++   AE +L++L+L YR V LCTGD+GF A KTYDLEVWL  Q  YREISSC
Sbjct: 299 QSMDALEQLTGHAETVLQKLELPYRKVLLCTGDMGFGAAKTYDLEVWLPAQEAYREISSC 358

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RRM +R+R   +K  +  HTLNGSG+AVGR L+A+LENY   DGS+ +P VL
Sbjct: 359 SNMQDFQARRMQARFRRKGAKKPELMHTLNGSGLAVGRALVAVLENYQQEDGSIVVPEVL 418

Query: 414 RPYMNNLAVIK 424
           RPYM  + V+K
Sbjct: 419 RPYMGGVEVLK 429


>gi|312882486|ref|ZP_07742227.1| seryl-tRNA synthetase [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309369886|gb|EFP97397.1| seryl-tRNA synthetase [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 435

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 191/434 (44%), Positives = 271/434 (62%), Gaps = 11/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   +     L +R  +   + I +L+E+ + +  ++E++++ RNS S QIGQ
Sbjct: 1   MLDSKLLRTELDETAEKLARRGFKLDVDTIRTLEEQRKSIQVEVENLQSSRNSISKQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            +A G+    +A+K +   L   L   + +   + S L+++   +PN+P ++VP G   +
Sbjct: 61  KMAAGDKEGAEAIKLQIGNLGNDLEAKKAQLDHIQSQLEEVTLSVPNLPADDVPQGKDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I   G+  S     ++H ++GE  G +DF  ATKL+GARF V+ G  A L RA+ Q
Sbjct: 121 DNVEISRWGEPKSYDFELKDHVDLGEIGGGLDFASATKLTGARFIVMKGQFARLHRAIAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-----------TDGRWLI 229
           FM+DLHT EHGYTE+  P LV  ++++GTGQ+PKF +D+F T                LI
Sbjct: 181 FMLDLHTEEHGYTEMYVPYLVNSDSLFGTGQLPKFGEDLFHTEPLTEKVNDEDPRKLSLI 240

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV LTN+    I +   LP++ T   P FRSEAGS GRDTRG++R HQF K ELV I
Sbjct: 241 PTAEVPLTNMVRDTITDEDELPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQI 300

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
           T+ EDS    E++ + AE++L+ L+L YR V LCTGD+GF A KTYDLEVW+  Q  YRE
Sbjct: 301 TKPEDSMDALEQLTAHAEKVLQLLELPYRKVILCTGDMGFGARKTYDLEVWVPAQETYRE 360

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS   +FQ+RRM +R+R    K  +  HTLNGSG+AVGR ++AILEN    DG + I
Sbjct: 361 ISSCSNMWDFQARRMQARFRRKGEKKPELVHTLNGSGLAVGRTMVAILENNQQKDGRIAI 420

Query: 410 PTVLRPYMNNLAVI 423
           P VL+ YMN L  I
Sbjct: 421 PAVLQKYMNGLTHI 434


>gi|126652931|ref|ZP_01725073.1| seryl-tRNA synthetase [Bacillus sp. B14905]
 gi|126590261|gb|EAZ84383.1| seryl-tRNA synthetase [Bacillus sp. B14905]
          Length = 426

 Score =  433 bits (1114), Expect = e-119,   Method: Composition-based stats.
 Identities = 183/428 (42%), Positives = 268/428 (62%), Gaps = 4/428 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ +R N   +   L  R+ +    +   +LD K R LI K E+++A RN  S QI 
Sbjct: 1   MLDIKRVRDNFAEIKEMLLTRNEDLGNLDDFENLDAKRRELIAKTEELKAERNKVSEQIS 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
                 N    D +      + +++  L+ + ++V    K ++  +PNVP E VP+GT+ 
Sbjct: 61  VMKR--NKENADEVIARMRQVGDEIKELDIQLNDVEDRFKDMMMRLPNVPHESVPVGTTE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+   + G+ P+     + H+++   L ++DF+R  K++G+RF    G  A LERAL 
Sbjct: 119 DDNVEEYTWGEIPAFDFDIKAHWDLATDLKIVDFERGAKVTGSRFLFYRGLGARLERALM 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-TTDGRWLIPTSEVSLTN 238
            FM+DLH  EHGY E+  P++V  +++ GTGQ+PKF +D+F       ++IPT+EV +TN
Sbjct: 179 TFMMDLHAEEHGYEEMLPPVIVNRDSLTGTGQLPKFEEDVFKLEETDYFMIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            Y  EI+ +++LP  F   +  FRSEAGSAGRDTRG++RQHQF K ELV   + E+S+ +
Sbjct: 239 FYRDEILTAEALPQGFAAYSACFRSEAGSAGRDTRGLIRQHQFNKVELVRFVKPEESYEQ 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E +   AE++L+ L L YR + +CT DLGF+A K YDLEVW+  QN+YREISSCS   +
Sbjct: 299 LELLTGHAEKVLQLLGLPYRKLKMCTADLGFTAAKKYDLEVWIPAQNMYREISSCSNFED 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R   +   ++ HTLNGSG+A+GR + A+LENY  ADGSV IP VLRPYM 
Sbjct: 359 FQARRANIRFRRDPNAKPEYVHTLNGSGLAIGRTVAALLENYQQADGSVVIPEVLRPYMG 418

Query: 419 NLAVIKKE 426
              VI  +
Sbjct: 419 GKEVIAPK 426


>gi|150387877|ref|YP_001317926.1| seryl-tRNA synthetase [Alkaliphilus metalliredigens QYMF]
 gi|166987307|sp|A6TJ99|SYS_ALKMQ RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|149947739|gb|ABR46267.1| seryl-tRNA synthetase [Alkaliphilus metalliredigens QYMF]
          Length = 426

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 183/428 (42%), Positives = 274/428 (64%), Gaps = 4/428 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLE-PQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IR N + +  A+ +R  +    + +++LDE  R +++++E ++  + + S ++ 
Sbjct: 1   MLDIKRIRMNLDEIKAAMARRGEKGFDLDAVVALDEDRRTILQEVEQMKNEQKTVSKEVP 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           +   EG    V  +  +  TL  ++  L+ +  E+   +++++  IPNVP  +VP G + 
Sbjct: 61  KLKKEGK--DVSEVMEKMKTLSAEIKNLDVKVKEIEEKMEEILLRIPNVPHPDVPQGDTD 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++NI +R+ G+        + H+E+G  LG++DF+ A+K++G+RF++  G  A LERAL 
Sbjct: 119 DDNIEVRTWGEPTQFSFEPKPHWEVGVNLGILDFEAASKVTGSRFTLYRGMAARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLHT EHGYTE+  P +V   +M GTGQ+PKF +D F      +  +PT+EV +TN
Sbjct: 179 SFMLDLHTDEHGYTELLPPFMVNRASMIGTGQLPKFEEDAFKIPQKDYFLVPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           +Y  +IIE   LP+++    P FRSEAGSAGRDTRG++RQHQF K ELV   R EDS+ E
Sbjct: 239 IYRDDIIEGDQLPIKYVAYTPCFRSEAGSAGRDTRGLIRQHQFNKVELVKFVRPEDSYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++ + AE++L+ L L YR+V +CTGDLGF+A   YD+EVW+   N Y EISSCS   +
Sbjct: 299 LEKLTNNAEKVLQLLGLPYRIVRICTGDLGFTAAFKYDIEVWMPSYNRYVEISSCSNFED 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N RYR      ++F HTLNGSG+AVGR + AILEN+   DGSV IP  +R YM 
Sbjct: 359 FQARRANIRYRPDTKSKVEFVHTLNGSGLAVGRTVAAILENFQQEDGSVVIPEAIRSYMK 418

Query: 419 NLAVIKKE 426
               I  +
Sbjct: 419 GFEKITAK 426


>gi|312898436|ref|ZP_07757826.1| seryl-tRNA synthetase [Megasphaera micronuciformis F0359]
 gi|310620355|gb|EFQ03925.1| seryl-tRNA synthetase [Megasphaera micronuciformis F0359]
          Length = 425

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 189/426 (44%), Positives = 263/426 (61%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI++IR++ E +   LK RH +   + +L  D + R L+ ++E ++ RRN  + +I  
Sbjct: 1   MLDIKFIREHTEEVRQNLKNRHAQVDLDALLEADARRRELLGQVEAMKNRRNDVTKEISV 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
                N    D        L +++ +L+ +  E    +  +   IPN+    VP+G   +
Sbjct: 61  LKR--NKENADEKIAAMKELGDEIAVLDGKVKETEEQMLAVQLMIPNMCHPSVPVGNDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N  +R  G   +    ++ H+EIGE LG++D +RA K++G+RF    G  A LERA+  
Sbjct: 119 DNPEVRKWGDVTTFDFEAKNHWEIGEHLGILDAERAGKVAGSRFYFYLGAGARLERAVYN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT-DGRWLIPTSEVSLTNL 239
           FM+D+HT   GYTEV  P +V  ++M GTGQ+PKF +DMF       ++IPT+EV LTN 
Sbjct: 179 FMLDMHTEVDGYTEVIPPYIVNRDSMLGTGQLPKFYEDMFRIEGQEMFMIPTAEVPLTNY 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y  EII+   LP+  T + P FR+EAGSAGRDTRG++RQHQF K E+V     E S+ E 
Sbjct: 239 YRGEIIDGNKLPVYLTAMTPCFRAEAGSAGRDTRGLIRQHQFHKVEMVKYVAPETSYDEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           +++ + AE IL+ L L Y VV LCTGD+GFSA KT+D+EVW   Q  YREISSCS   +F
Sbjct: 299 DKLTNNAEAILQALKLPYHVVCLCTGDIGFSAAKTFDVEVWFPAQGKYREISSCSNTEDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N R+R       ++ HTLNGSG+AVGR + AILENY  ADGSV +P VLRPYM  
Sbjct: 359 QARRANIRFRRDAKSKPEYVHTLNGSGLAVGRTVAAILENYQQADGSVIVPEVLRPYMK- 417

Query: 420 LAVIKK 425
             VIK 
Sbjct: 418 CDVIKP 423


>gi|315925305|ref|ZP_07921517.1| serine--tRNA ligase [Pseudoramibacter alactolyticus ATCC 23263]
 gi|315621426|gb|EFV01395.1| serine--tRNA ligase [Pseudoramibacter alactolyticus ATCC 23263]
          Length = 424

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 191/426 (44%), Positives = 274/426 (64%), Gaps = 3/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+ IRQNPE +  AL  R  E   + +L LD + R +I ++E ++A++N+ S  I Q
Sbjct: 1   MLDIKRIRQNPEAVLAALGSRGGEYSVDKVLELDNQRREIIGRVEALKAQKNATSKAIPQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G    +  L  E   + E++   ++   ++  +++  +  +PN+P  EV +G   +
Sbjct: 61  RKLAG--EDLAPLFAEMKAVSEKIKADDEALADINQAIRNELLGLPNIPNPEVAVGLDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ IR  G+  +     + H+++G  L ++DFDRA KL+GARFS+  G  A LERAL  
Sbjct: 119 ENVEIRKWGEPTAFDFEPKAHWDLGTELDILDFDRAHKLTGARFSMFKGLGAKLERALTN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-TTDGRWLIPTSEVSLTNL 239
           FM+ +HT +  Y E++ P +V   +M GTGQ+PKF +D F    +  +L+PT+EV +TN+
Sbjct: 179 FMLYVHTVDQDYIEIAPPFMVNRASMTGTGQLPKFEEDAFHLEREDFFLVPTAEVPVTNI 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +  EII   ++P+ +T   P FR EAGSAGRDTRG++R HQF K E+V   R EDS+ E 
Sbjct: 239 HRDEIIPDDAMPIYYTAYTPCFREEAGSAGRDTRGLIRNHQFDKVEMVKFVRPEDSYDEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E++ + AE IL++L + YRVV LCTGDLGFS+ KTYD+EVW+     Y EISSCS   ++
Sbjct: 299 EKLTADAEVILQQLAIPYRVVELCTGDLGFSSAKTYDIEVWMPSYGRYVEISSCSNFEDY 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N RYRDP +K  ++ HTLNGSG+AVGR   A+LENY NADGS+TIP  L  YM  
Sbjct: 359 QARRANIRYRDPATKHTQYVHTLNGSGLAVGRTFAAVLENYQNADGSITIPDALVHYMGG 418

Query: 420 LAVIKK 425
           +  IKK
Sbjct: 419 VTKIKK 424


>gi|284047518|ref|YP_003397857.1| seryl-tRNA synthetase [Acidaminococcus fermentans DSM 20731]
 gi|283951739|gb|ADB46542.1| seryl-tRNA synthetase [Acidaminococcus fermentans DSM 20731]
          Length = 426

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 195/419 (46%), Positives = 265/419 (63%), Gaps = 3/419 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++++R N E +  ALK RH +   E    LD++ R L++++E  +++RN+ SA+I Q
Sbjct: 1   MLDLKFVRDNTEKVAQALKNRHAKVDLEEFKKLDQERRSLLQEVEADKSQRNTVSAEISQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G              L +++   +K+  +V + L+ ++  IPN+P  +VP+G    
Sbjct: 61  MKRNG--EDATEKITAMRALGDKIAEADKKVKDVEARLQAVMLTIPNMPAADVPVGKDDT 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN  +R  G+        + H+EIGE LG++D +RA K+SGARF    G  A LERA+  
Sbjct: 119 ENPEVRKWGEPTHFDFEPKAHWEIGEKLGILDAERAAKVSGARFYYYKGAGARLERAVYN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT-DGRWLIPTSEVSLTNL 239
           FM+D HT + GY EV  P +V   +M GTGQ+PKF +DM+       +LIPT+EV LTN 
Sbjct: 179 FMLDQHTRKDGYMEVIPPYIVNTASMTGTGQLPKFHEDMYKVEGQDMYLIPTAEVPLTNY 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y  EI+    LP+  T + P FR+EAGSAGRDTRG++RQHQF K E+V   + E S+ E 
Sbjct: 239 YRGEILNGDDLPIYLTAMTPCFRAEAGSAGRDTRGLIRQHQFHKVEMVKFCKPETSYDEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E+++  AE+ILK L L Y VV LCTGDLGFSA K YD+EVW   QN YREISSCS   +F
Sbjct: 299 EKLVGNAEDILKALKLPYHVVCLCTGDLGFSAAKCYDVEVWFPEQNKYREISSCSNTEDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           Q+RR N R+R       ++ HTLNGSG+AVGR + AILENY  ADGSV +P VLRPYM 
Sbjct: 359 QARRANIRFRRDAKSKPEYVHTLNGSGLAVGRTVAAILENYQQADGSVVVPEVLRPYMG 417


>gi|325578023|ref|ZP_08148217.1| serine--tRNA ligase [Haemophilus parainfluenzae ATCC 33392]
 gi|325160256|gb|EGC72384.1| serine--tRNA ligase [Haemophilus parainfluenzae ATCC 33392]
          Length = 429

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 194/431 (45%), Positives = 263/431 (61%), Gaps = 8/431 (1%)

Query: 1   MLDIQWIRQNPEHLDIALK-KRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           M+D   +R N   +   LK KR+    +E + +L+E+ + L  K E ++A RN+ S  IG
Sbjct: 1   MIDPNLLRNNLTEVAEKLKVKRNFILDTEKLTALEEQRKDLQVKTETLQAERNARSKAIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
            A A G    +  L  E   + EQL   + +   V + + ++   IPN+P +EVP+G   
Sbjct: 61  AAKARG--EDIAPLLAEVDNMGEQLNEAKTQLDAVLAEINQIALSIPNIPADEVPLGKDD 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            EN  I   G   +     ++H  +GE    +DF    KL+GARF+V+ G +A + RAL 
Sbjct: 119 TENKEILRWGTPRTFDFEIKDHVSLGEDANGLDFAAGAKLAGARFAVMKGQIAKMHRALA 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-----TDGRWLIPTSEV 234
           QFM+DLHT +HGY E   P LV    +YGTGQ+PKF +D+F T          LIPT+EV
Sbjct: 179 QFMLDLHTEQHGYLETYVPYLVNHATLYGTGQLPKFGEDLFHTLALEGEQPYALIPTAEV 238

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            +TNL    I++   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I   + 
Sbjct: 239 PVTNLVRDVIVDEADLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVDPDK 298

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCS 354
           S    E +   AE++L+ L+L YR V LCTGD+GF +CKTYDLEVW+  Q+ YREISSCS
Sbjct: 299 SMEALEELTGHAEKVLQLLNLPYRKVLLCTGDMGFGSCKTYDLEVWVPAQDTYREISSCS 358

Query: 355 TCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR 414
              +FQ+RRM +R +    K  +  HTLNGSG+AVGR L+A+LENY NADGS+T+P VLR
Sbjct: 359 NMWDFQARRMQARCKAKGDKKTRLVHTLNGSGLAVGRTLVAVLENYQNADGSITVPEVLR 418

Query: 415 PYMNNLAVIKK 425
           PYM  L VI K
Sbjct: 419 PYMGGLEVICK 429


>gi|239502305|ref|ZP_04661615.1| seryl-tRNA synthetase [Acinetobacter baumannii AB900]
          Length = 423

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 190/425 (44%), Positives = 266/425 (62%), Gaps = 5/425 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M+D + +R N E ++ AL KR ++   +   SL+ + + L  K E ++A RN+ + Q+GQ
Sbjct: 1   MIDPKLLRNNIEVVNAALAKRGVQLDVQEWASLETRRKDLQSKTEKLQAERNAGAKQVGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G       +      + +++   E    E+ + +++    IPN+P E VP G   N
Sbjct: 61  IKKSGG--DASEIMARMQAIGDEIKAAEVALSELQNEIEQKALSIPNLPDESVPAGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I   G         ++H ++GE +G ++F+ ATKL+G+RFSVL G LA L+RAL Q
Sbjct: 119 DNVEISKWGTPRQFDFEIKDHTDLGEWMGGLEFETATKLTGSRFSVLKGPLARLQRALTQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT--DGRWLIPTSEVSLTN 238
           FM+D HT ++GYTE   P LV  +++ GTGQ+PKF +D+F        +LIPT+EV +TN
Sbjct: 179 FMLDTHTLKNGYTEAYVPYLVNADSLRGTGQLPKFEEDLFKLQGEKEYYLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
               EII++  LPL++    P FRSEAGS GRDTRG++RQHQF K E+V I + E S   
Sbjct: 239 FVRDEIIDADRLPLKYAAHTPCFRSEAGSYGRDTRGLIRQHQFDKVEMVQIVKPETSMQA 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E + + AE IL+ L L YR + LC GD+GF A KTYDLEVW+  QN YREISSCS  G+
Sbjct: 299 LEELTAHAEGILQALGLPYRKILLCGGDMGFGATKTYDLEVWVPSQNTYREISSCSNMGD 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRM +RYR  + K  +  HTLNGSG+AVGR L+A++ENY   DGS+ IP VLRPYM 
Sbjct: 359 FQARRMKARYR-MDQKKTELVHTLNGSGLAVGRTLLAVMENYQREDGSIEIPEVLRPYMG 417

Query: 419 NLAVI 423
               I
Sbjct: 418 GATFI 422


>gi|261365211|ref|ZP_05978094.1| serine--tRNA ligase [Neisseria mucosa ATCC 25996]
 gi|288566473|gb|EFC88033.1| serine--tRNA ligase [Neisseria mucosa ATCC 25996]
          Length = 431

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 198/431 (45%), Positives = 272/431 (63%), Gaps = 9/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R +   +   L +R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 1   MLDIQQLRSHTAAVAERLAQRGYEFDTARFNALEEQRKAVQVKTEELQASRNSISKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +  IPN+P E VP G    
Sbjct: 61  LKGQGKHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLLSIPNLPHESVPAGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPREFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMKGQIARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM+D HT +HGYTE   P +V D  + GTGQ+PKFA+D+F  T         ++LIPT+E
Sbjct: 180 FMLDTHTLKHGYTEHYTPYIVDDTTLQGTGQLPKFAEDLFHVTRGGDESKKTQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  I+    LPL+ T  +P FRSEAG+ G+D RG++RQHQF K E+V I   E
Sbjct: 240 VTLTNTVADSIVAGSDLPLKLTAHSPCFRSEAGAYGKDVRGLIRQHQFDKVEMVQIVHPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 KSYEALEEMVGHAENILKALELPYRVITLCTGDMGFGATKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPAAL 418

Query: 414 RPYMNNLAVIK 424
           +PYM  +  I+
Sbjct: 419 QPYMGGVEKIE 429


>gi|71737900|ref|YP_275259.1| seryl-tRNA synthetase [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|257485413|ref|ZP_05639454.1| seryl-tRNA synthetase [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|289625403|ref|ZP_06458357.1| seryl-tRNA synthetase [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289649314|ref|ZP_06480657.1| seryl-tRNA synthetase [Pseudomonas syringae pv. aesculi str. 2250]
 gi|298487528|ref|ZP_07005570.1| Seryl-tRNA synthetase [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|123635963|sp|Q48H74|SYS_PSE14 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|71558453|gb|AAZ37664.1| seryl-tRNA synthetase [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|298157912|gb|EFH98990.1| Seryl-tRNA synthetase [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|330866860|gb|EGH01569.1| seryl-tRNA synthetase [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330987919|gb|EGH86022.1| seryl-tRNA synthetase [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 426

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 199/427 (46%), Positives = 273/427 (63%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R        I SL+ + +++  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRTQLQDVADRLASRGFTLDVARIESLEAQRKVVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G    +  L  +   +  +L   + E   + + L  L+  IPN+P E VP+G    
Sbjct: 61  AKQRG--EDIAPLMADVERMGNELSEGKVELDGIQAELDALVLSIPNLPHESVPVGADEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G   +     ++H  +GE  G +DF+ A KLSGARF++L G +A L RAL Q
Sbjct: 119 GNVEVRRWGTPTAFDFEVKDHVALGEKFGWLDFETAAKLSGARFALLRGPIARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD----GRWLIPTSEVSL 236
           FMI+LH +EHGY E   P LV+  A+ GTGQ+PKF +D+F  T       +LIPT+EVSL
Sbjct: 179 FMINLHINEHGYEETYTPYLVQAPALQGTGQLPKFEEDLFKITREGEADLYLIPTAEVSL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+ S EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I   EDS 
Sbjct: 239 TNIVSGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVAPEDSM 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
              E +   AE +L+ L+L YR ++LCTGD+GFSA KTYDLEVW+  Q+ YREISSCS C
Sbjct: 299 AALESLTGNAERVLQLLELPYRTLALCTGDMGFSAVKTYDLEVWIPSQDKYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P VL+PY
Sbjct: 359 GDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPEVLKPY 418

Query: 417 MNNLAVI 423
           M  L VI
Sbjct: 419 MGGLEVI 425


>gi|138893692|ref|YP_001124145.1| seryl-tRNA synthetase [Geobacillus thermodenitrificans NG80-2]
 gi|166222728|sp|A4IJ96|SYS_GEOTN RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|134265205|gb|ABO65400.1| Seryl-tRNA synthetase [Geobacillus thermodenitrificans NG80-2]
          Length = 424

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 193/426 (45%), Positives = 269/426 (63%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ +R   + +   L +R  +    +    LD++ R LI ++E+++++RN  S QI 
Sbjct: 1   MLDVKLLRTQFQEVKEKLLQRGDDLANIDRFEQLDKERRRLIAQVEELKSKRNEVSQQIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      ++L  E   + +++  ++++  ++   L  L+  IPNVP E VP+G S 
Sbjct: 61  VLKREKK--DAESLIAEMREVGDRIKQMDEQIRQLEEELDSLLLSIPNVPHESVPVGQSE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            +N+ +R  G+  S     + H++I + LGL+DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 EDNVEVRRWGEPRSFSFEPKPHWDIADQLGLLDFERAAKVAGSRFVFYKGLGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+D+H  E GY EV  P LV   +M GTGQ+PKFA+D F   +  +  IPT+EV +TN
Sbjct: 179 NFMLDIHLDEFGYQEVLPPYLVNRASMIGTGQLPKFAEDAFHLDNEDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L+  EI+ +  LPL +   +  FR+EAGSAGRDTRG++RQHQF K ELV   + EDS+ E
Sbjct: 239 LHRDEILTADDLPLYYAAYSACFRAEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYDE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++   AE IL+RL L YRVV+LCTGDLGFSA KTYD+EVWL     YREISSCS    
Sbjct: 299 LEKLTHQAETILQRLGLPYRVVALCTGDLGFSAAKTYDIEVWLPSYGTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R       ++ HTLNGSG+A+GR + AILENY   DGSV IP  LRPYM 
Sbjct: 359 FQARRANIRFRREPKAKPEYVHTLNGSGLAIGRTVAAILENYQQEDGSVVIPGALRPYMG 418

Query: 419 NLAVIK 424
           N  VI+
Sbjct: 419 NRDVIR 424


>gi|212637862|ref|YP_002314382.1| seryl-tRNA synthetase [Anoxybacillus flavithermus WK1]
 gi|212559342|gb|ACJ32397.1| Seryl-tRNA synthetase [Anoxybacillus flavithermus WK1]
          Length = 426

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 193/425 (45%), Positives = 264/425 (62%), Gaps = 4/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++++R + E +   L+ R  +    E    LD + R LI + E+++ +RN  S QI 
Sbjct: 3   MLDLKFLRTHFEEVKQKLQHRGEDLADFERFEQLDRRRRELIAQAEELKNKRNDVSQQIA 62

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      D L  E   + +++ +L+ E  EV   L  L+  IPN+P E VPIG S 
Sbjct: 63  LLKREKK--DADHLIAEMRQVGDRIKVLDDELREVEQQLDTLLLSIPNIPHESVPIGESE 120

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+ IR  G+  S     + H+EI + LG++DF+RA K++G+RF    G  A LERAL 
Sbjct: 121 DDNVEIRKWGEPRSFSFEPKPHWEIADQLGILDFERAAKVTGSRFVFYKGLGARLERALI 180

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+D+H  +HGY EV  P +V   +M GTGQ+PKF +D F      +  IPT+EV +TN
Sbjct: 181 NFMLDVHVEQHGYEEVLPPYIVNRASMTGTGQLPKFEEDAFRIESEDYFLIPTAEVPVTN 240

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L+  EI+ +  LP+++   +  FRSEAGSAGRDTRG++RQHQF K ELV   + EDS+ E
Sbjct: 241 LHRDEILSADDLPIKYAAYSACFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYEE 300

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++ + AE IL+ L L YRV+S+CT DLGF+A K YD+EVWL     YREISSCS    
Sbjct: 301 LEKLTNDAERILQLLGLPYRVMSMCTADLGFTAAKKYDIEVWLPSYGTYREISSCSNFEA 360

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R       +  HTLNGSG+A+GR + AILENY   DG+V IP VLRPYM 
Sbjct: 361 FQARRANIRFRRDPKAKPEHVHTLNGSGLAIGRTVAAILENYQQEDGTVVIPEVLRPYMG 420

Query: 419 NLAVI 423
              VI
Sbjct: 421 GKEVI 425


>gi|292493548|ref|YP_003528987.1| seryl-tRNA synthetase [Nitrosococcus halophilus Nc4]
 gi|291582143|gb|ADE16600.1| seryl-tRNA synthetase [Nitrosococcus halophilus Nc4]
          Length = 429

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 198/426 (46%), Positives = 276/426 (64%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R         L +R  E       +L+ + + +  + ++++A RN+ S  IG+
Sbjct: 1   MLDPKLLRNALAETARQLARRGFELDVTAFAALEAERKEVQVRTQELQAERNARSKAIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G       L  E + L ++L   E    E+ S + +++  IPN+P    P G    
Sbjct: 61  AKAQG--EDAAPLLVEVAELGDRLKAAEARLGEIQSQIDEILMGIPNLPDASTPEGRDER 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G+ P+     ++H ++G  LG MDF+ A KLSGARF  L+G LA L RAL Q
Sbjct: 119 DNVEVRRWGEPPALGFAPKDHVDLGGPLG-MDFETAAKLSGARFVTLSGLLARLHRALIQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG-RWLIPTSEVSLTNL 239
           FM+D+HTSEHGYTEV  P LV  +++ GTGQ+PKF +D+F   D   +LIPT+EV +TNL
Sbjct: 178 FMLDVHTSEHGYTEVYVPYLVNRQSLEGTGQLPKFEEDLFAIRDTGYYLIPTAEVPVTNL 237

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
              EI+ ++ LPL++    P FRSEAGS G+DTRGM+RQHQF K ELV I   +DS   H
Sbjct: 238 VRAEILPAERLPLKYVAHTPCFRSEAGSYGKDTRGMIRQHQFEKVELVQIVPPKDSPQAH 297

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E +   AE IL+RL L YRV++LC GDLGF++ KTYDLEVWL GQ  YREISSCS   +F
Sbjct: 298 ENLTGHAEVILQRLGLPYRVMNLCAGDLGFASSKTYDLEVWLPGQQAYREISSCSNFLDF 357

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR+ +R+RDP ++   + HTLNGSG+AVGR L+A++ENY  ADGS+ +P VL PYM  
Sbjct: 358 QARRLQARWRDPETQKPAWLHTLNGSGLAVGRALVAVMENYQQADGSIRVPEVLHPYMGG 417

Query: 420 LAVIKK 425
           ++VI+ 
Sbjct: 418 VSVIQP 423


>gi|15602123|ref|NP_245195.1| seryl-tRNA synthetase [Pasteurella multocida subsp. multocida str.
           Pm70]
 gi|13431879|sp|P57836|SYS_PASMU RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|12720487|gb|AAK02342.1| SerS [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 428

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 204/429 (47%), Positives = 268/429 (62%), Gaps = 8/429 (1%)

Query: 1   MLDIQWIRQNPEHLDIALK-KRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           M+D   +R N E +   LK KR+       +  L+E+ + L  K E ++A RN+ S  IG
Sbjct: 1   MIDPNLLRNNLEEVAEKLKVKRNFVLDVALLSELEEQRKSLQVKTESLQAERNARSKNIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           QA A G    + AL NE   +  +L   +    EV + + +++  IPN+P +EVP+G   
Sbjct: 61  QAKARG--EDISALLNEVEHMGIELSTTKAHLDEVLAEINQIVLAIPNLPADEVPLGKDE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           +EN+ +   G   +     ++H  +GE L  +DF    KLSG+RF V+ G +A L RAL 
Sbjct: 119 SENLEVFRWGTPKTFDFDVKDHVSLGEGLKGLDFAAGVKLSGSRFVVMKGQIAKLHRALS 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT-----DGRWLIPTSEV 234
           QFM+DLHT +HGYTE   P LV    +YGTGQ+PKF +D+F T          LIPT+EV
Sbjct: 179 QFMLDLHTEQHGYTETYVPYLVNHATLYGTGQLPKFGEDLFHTNALEGEQPYALIPTAEV 238

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            +TNL   EI++   LPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I   E 
Sbjct: 239 PVTNLVRDEILDEADLPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQIVAPET 298

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCS 354
           S    E +   AE++L+ L+L YR V LCTGD+GF +CKTYDLEVWL  QN YREISSCS
Sbjct: 299 SMQVLEELTGQAEKVLQLLELPYRKVLLCTGDMGFGSCKTYDLEVWLPAQNTYREISSCS 358

Query: 355 TCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR 414
              +FQ+RRM +R R    K  +  HTLNGSG+AVGR L+AILENY NADG++T+P+VLR
Sbjct: 359 NMWDFQARRMQARCRSKTDKKTRLVHTLNGSGLAVGRTLVAILENYQNADGTITVPSVLR 418

Query: 415 PYMNNLAVI 423
           PYM  LA I
Sbjct: 419 PYMGGLAQI 427


>gi|253582385|ref|ZP_04859608.1| seryl-tRNA synthetase [Fusobacterium varium ATCC 27725]
 gi|251835924|gb|EES64462.1| seryl-tRNA synthetase [Fusobacterium varium ATCC 27725]
          Length = 423

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 196/425 (46%), Positives = 270/425 (63%), Gaps = 2/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           ML++++IR+N E +   L  R+          LDE+ R ++ ++E ++ +RN+ SA+I +
Sbjct: 1   MLELKFIRENRELVKEMLANRNSNIDLTEFDKLDEERRAILGEVELLKQKRNTESAEIAR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              E        +  E   +  Q+  L+ +  EV   L      IPN+  E  P+G    
Sbjct: 61  LKKEKK--DASQIIEEMGKVSAQIKELDTKLAEVDEKLTYFQMVIPNMYQEGTPVGKDEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G         + H+EIGE LG++DF+R +KL G+RF +  G  A +ERAL  
Sbjct: 119 SNVEVRRWGTPRKFTFEPKSHWEIGENLGILDFERGSKLGGSRFVLYRGMGARIERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D+HT+EHGYTE   P LV+ E   GTGQ+PKF +DM+ TTD  +LI TSE+++TN++
Sbjct: 179 FMLDMHTTEHGYTEHITPFLVKREICEGTGQLPKFEEDMYKTTDDMFLISTSEITMTNIH 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ K LP  +T  +P FR EAGS G+D +G++R HQF K E++ I  +E S+ E E
Sbjct: 239 RKEILDEKELPKYYTAYSPCFRREAGSYGKDVKGIIRVHQFNKVEMIKIATQESSYDELE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           +M+  AEE+LKRL+L YRV+ LCTGDLGFSA KTYDLEVWL  QN YREISSCS C +FQ
Sbjct: 299 KMVVNAEEVLKRLELPYRVIQLCTGDLGFSAAKTYDLEVWLPSQNKYREISSCSNCTDFQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM  +YR   S   +F HTLNGSG+AVGR  +AI+ENY   DGS  IP  L PYM  +
Sbjct: 359 ARRMGLKYRPNGSSKSEFCHTLNGSGLAVGRTFVAIMENYQQEDGSFLIPKALVPYMGGI 418

Query: 421 AVIKK 425
            VIKK
Sbjct: 419 DVIKK 423


>gi|149182704|ref|ZP_01861171.1| seryl-tRNA synthetase [Bacillus sp. SG-1]
 gi|148849614|gb|EDL63797.1| seryl-tRNA synthetase [Bacillus sp. SG-1]
          Length = 426

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 191/428 (44%), Positives = 269/428 (62%), Gaps = 4/428 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ +R N E +   L+ R  +    E    LD + R L+ + E+++++RN  S +I 
Sbjct: 1   MLDIRHLRANFEDVKNRLQDRGEDLSDFEKFEELDVRRRELLVETENLKSKRNEVSQKIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           +     N    D L  E   +   +  L++E  EV  SL  L+  IPN+P E VP+G + 
Sbjct: 61  EMKK--NKENADDLIVEMREVGGMIKKLDEELKEVEGSLDHLMLSIPNIPHESVPVGATE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+  R  G+ PS     + H+++   LG++DF+RA+K++G+RF    G  A LERAL 
Sbjct: 119 DDNVEARKWGEVPSFDFEPKPHWDLATELGVLDFERASKVTGSRFVFYKGLGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLH  EHGY E+  P +V  E+M GTGQ+PKF +D F      +  +PT+EV +TN
Sbjct: 179 NFMMDLHMDEHGYEEMLPPYMVNRESMTGTGQLPKFEEDAFLIESEDYFLVPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            +  EI+ +  LP+ +T  +  FRSEAGSAGRDTRG++RQHQF K ELV   R E+S+ E
Sbjct: 239 YHRDEILTNDQLPIAYTAFSACFRSEAGSAGRDTRGLIRQHQFNKVELVRFVRPEESYDE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++   AE++L+ L+L YRV+S+CT DLGF+A K YD+EVW+     YREISSCS    
Sbjct: 299 LEKLTGHAEKVLQLLNLPYRVMSMCTADLGFTAAKKYDIEVWIPSYGTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R       +  HTLNGSG+A+GR + AILENY  ADGS+ IP VLRPYM 
Sbjct: 359 FQARRANIRFRREPGCKPEHVHTLNGSGLALGRTVAAILENYQQADGSIVIPEVLRPYMR 418

Query: 419 NLAVIKKE 426
            + VIK +
Sbjct: 419 GVEVIKPK 426


>gi|261417513|ref|YP_003251195.1| seryl-tRNA synthetase [Geobacillus sp. Y412MC61]
 gi|319765171|ref|YP_004130672.1| seryl-tRNA synthetase [Geobacillus sp. Y412MC52]
 gi|261373970|gb|ACX76713.1| seryl-tRNA synthetase [Geobacillus sp. Y412MC61]
 gi|317110037|gb|ADU92529.1| seryl-tRNA synthetase [Geobacillus sp. Y412MC52]
          Length = 424

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 193/426 (45%), Positives = 268/426 (62%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ +R   E +   L +R  +    +    LD+  R LI ++E+++++RN  S QI 
Sbjct: 1   MLDVKILRTQFEEVKEKLMQRGGDLTNIDRFEQLDKDRRRLIAEVEELKSKRNDVSQQIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      + L  +   + +++  ++++  ++ + L  L+  IPNVP E VPIG S 
Sbjct: 61  VLKREKK--DAEPLIAQMREVGDRIKRMDEQIRQLEAELDDLLLSIPNVPHESVPIGQSE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            +N+ +R  G+  S     + H+EI + LGL+DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 EDNVEVRRWGEPRSFSFEPKPHWEIADRLGLLDFERAAKVAGSRFVFYKGLGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+D+H  E GY EV  P LV   +M GTGQ+PKFA+D+F      +  IPT+EV +TN
Sbjct: 179 NFMLDIHLDEFGYEEVLPPYLVNRASMIGTGQLPKFAEDVFHLDSEDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L+  EI+ +  LP+ +   +  FR+EAGSAGRDTRG++RQHQF K ELV   + EDS+ E
Sbjct: 239 LHRDEILAADDLPIYYAAYSACFRAEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYDE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++   AE IL+RL L YRVV+LCTGDLGFSA KTYD+EVWL     YREISSCS    
Sbjct: 299 LEKLTRQAETILQRLGLPYRVVALCTGDLGFSAAKTYDIEVWLPSYGTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R       ++ HTLNGSG+A+GR + AILENY   DGSV +P  LRPYM 
Sbjct: 359 FQARRANIRFRRDPKAKPEYVHTLNGSGLAIGRTVAAILENYQQEDGSVIVPEALRPYMG 418

Query: 419 NLAVIK 424
           N  VI+
Sbjct: 419 NRDVIR 424


>gi|258517403|ref|YP_003193625.1| seryl-tRNA synthetase [Desulfotomaculum acetoxidans DSM 771]
 gi|257781108|gb|ACV65002.1| seryl-tRNA synthetase [Desulfotomaculum acetoxidans DSM 771]
          Length = 423

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 187/426 (43%), Positives = 275/426 (64%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++++R NPE +  AL KR      +  L LDE+ R  +  +E ++ RRN+ S ++G+
Sbjct: 1   MLDLKFVRNNPETVKEALAKRGNRGSLDEFLKLDEQRREKLVVVEQLKNRRNTVSQEVGR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG  +  + +  E   + +++  L+ +   +   L+ ++  IPN+P   VP+G S  
Sbjct: 61  LKKEGQPA--EQIVLEMRQVSQEIKDLDDQLRVIEEELQAILLGIPNIPDVSVPVGKSET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +NI IR  G+        + H++IGE L ++DF+R  K++GARFS   G  A LERAL  
Sbjct: 119 DNIEIRLWGEPTKFDFEPKAHWDIGEGLDIIDFERGAKVTGARFSFYKGLGARLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-TTDGRWLIPTSEVSLTNL 239
           FM+DLHTS+H Y E+  P +   ++M GTGQ+PKFA+DMF       +LIPT+EV +TNL
Sbjct: 179 FMLDLHTSQHNYVEIFPPFIANQDSMQGTGQLPKFAEDMFKLENTNYYLIPTAEVPVTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y  EI++ + LP+     +  FR+EAG+AGRDTRG++RQHQF K E+V     + SF E 
Sbjct: 239 YREEILDGEKLPICHVAYSACFRAEAGAAGRDTRGLIRQHQFNKVEMVKFCHPDTSFEEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           ++++  AE++L+ L+L YR++ LCTGDLGFS+ KT+DLEVWL G   YREISSCS   +F
Sbjct: 299 DKLVLNAEKVLQLLELPYRLIILCTGDLGFSSAKTFDLEVWLPGYQTYREISSCSNFTDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR   +++   +K  ++ HTLNGSG+A+GR L A+LENY   DGSV +P VL+PYM  
Sbjct: 359 QARRAGIKFKTGKAK-PQYVHTLNGSGLAIGRTLAAVLENYQQRDGSVKVPRVLQPYMGG 417

Query: 420 LAVIKK 425
           L  I +
Sbjct: 418 LKEIAR 423


>gi|213157669|ref|YP_002320467.1| seryl-tRNA synthetase [Acinetobacter baumannii AB0057]
 gi|215482472|ref|YP_002324658.1| seryl-tRNA synthetase [Acinetobacter baumannii AB307-0294]
 gi|301344900|ref|ZP_07225641.1| seryl-tRNA synthetase [Acinetobacter baumannii AB056]
 gi|301511071|ref|ZP_07236308.1| seryl-tRNA synthetase [Acinetobacter baumannii AB058]
 gi|332854214|ref|ZP_08435234.1| serine--tRNA ligase [Acinetobacter baumannii 6013150]
 gi|332866344|ref|ZP_08436949.1| serine--tRNA ligase [Acinetobacter baumannii 6013113]
 gi|226701385|sp|B7GXI2|SYS_ACIB3 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|226701417|sp|B7I6V5|SYS_ACIB5 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|213056829|gb|ACJ41731.1| seryl-tRNA synthetase [Acinetobacter baumannii AB0057]
 gi|213987623|gb|ACJ57922.1| seryl-tRNA synthetase [Acinetobacter baumannii AB307-0294]
 gi|332728139|gb|EGJ59527.1| serine--tRNA ligase [Acinetobacter baumannii 6013150]
 gi|332734692|gb|EGJ65796.1| serine--tRNA ligase [Acinetobacter baumannii 6013113]
          Length = 423

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 189/425 (44%), Positives = 265/425 (62%), Gaps = 5/425 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M+D + +R N E ++  L KR ++   +   SL+ + + L  K E ++A RN+ + Q+GQ
Sbjct: 1   MIDPKLLRNNIEVVNAGLAKRGVQLDVQEWASLETRRKDLQSKTEKLQAERNAGAKQVGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G       +      + +++   E    E+ + +++    IPN+P E VP G   N
Sbjct: 61  IKKSGG--DASEIMARMQAIGDEIKAAEVALSELQNEIEQKALSIPNLPDESVPAGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I   G         ++H ++GE +G ++F+ ATKL+G+RFSVL G LA L+RAL Q
Sbjct: 119 DNVEISKWGTPRQFDFEIKDHTDLGEWMGGLEFETATKLTGSRFSVLKGPLARLQRALTQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT--DGRWLIPTSEVSLTN 238
           FM+D HT ++GYTE   P LV  +++ GTGQ+PKF +D+F        +LIPT+EV +TN
Sbjct: 179 FMLDTHTLKNGYTEAYVPYLVNADSLRGTGQLPKFEEDLFKLQGEKEYYLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
               EII++  LPL++    P FRSEAGS GRDTRG++RQHQF K E+V I + E S   
Sbjct: 239 FVRDEIIDADRLPLKYAAHTPCFRSEAGSYGRDTRGLIRQHQFDKVEMVQIVKPETSMQA 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E + + AE IL+ L L YR + LC GD+GF A KTYDLEVW+  QN YREISSCS  G+
Sbjct: 299 LEELTAHAEGILQALGLPYRKILLCGGDMGFGATKTYDLEVWVPSQNTYREISSCSNMGD 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRM +RYR  + K  +  HTLNGSG+AVGR L+A++ENY   DGS+ IP VLRPYM 
Sbjct: 359 FQARRMKARYR-MDQKKTELVHTLNGSGLAVGRTLLAVMENYQREDGSIEIPEVLRPYMG 417

Query: 419 NLAVI 423
               I
Sbjct: 418 GATFI 422


>gi|330875798|gb|EGH09947.1| seryl-tRNA synthetase [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
          Length = 426

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 197/427 (46%), Positives = 273/427 (63%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R        I SL+ + +++  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRTQLQDVADRLASRGFTLDVARIESLEAQRKVVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G    +  L  +   +  +L   + E   + + L  L+  IPN+P E VP+G    
Sbjct: 61  AKQRG--EDIAPLMADVERMGNELSEGKVELDAIQAELDALVLNIPNLPHESVPVGADEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G   +     ++H  +GE  G +DF+ A KLSGARF++L G +A L RAL Q
Sbjct: 119 GNVEVRRWGTPTAFDFEVKDHVALGEKFGWLDFETAAKLSGARFALLRGPIARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD----GRWLIPTSEVSL 236
           FMI+LH +EHGY E   P LV+  A+ GTGQ+PKF +D+F  +       +LIPT+EVSL
Sbjct: 179 FMINLHINEHGYEETYTPYLVQAPALQGTGQLPKFEEDLFKISREGEADLYLIPTAEVSL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+ S EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I   +DS 
Sbjct: 239 TNIVSGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVAPDDSM 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
              E +   AE +L+ L+L YR ++LCTGD+GFSA KTYDLEVW+  Q+ YREISSCS C
Sbjct: 299 AALESLTGNAERVLQLLELPYRTLALCTGDMGFSAVKTYDLEVWIPSQDKYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P VL+PY
Sbjct: 359 GDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPEVLKPY 418

Query: 417 MNNLAVI 423
           M  L VI
Sbjct: 419 MGGLEVI 425


>gi|237748955|ref|ZP_04579435.1| seryl-tRNA synthetase [Oxalobacter formigenes OXCC13]
 gi|229380317|gb|EEO30408.1| seryl-tRNA synthetase [Oxalobacter formigenes OXCC13]
          Length = 436

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 201/433 (46%), Positives = 273/433 (63%), Gaps = 12/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M+DIQ +R++ + +   LK R  E        L+ + R L  + E+++ARRNS S QIG 
Sbjct: 1   MIDIQLLRKDIDAVAARLKTRKFELDVNAFNVLESERRQLQTQTEEMQARRNSLSKQIGI 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G      A+  E S + +QL   E    E+ + L + +  IPNVP E VP+G   +
Sbjct: 61  LK--GKKEDASAVMAEVSGIGDQLKANEVALAELQAKLSEFMLSIPNVPHESVPVGQDES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R VG         ++H ++G  LG +DF+ ATKL+GARF ++ G++A L RAL Q
Sbjct: 119 ANVEVRRVGTPREFDFEVKDHVDVGTPLG-LDFETATKLTGARFCLMRGNMARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADD--------MFCTTDGRWLIPTS 232
           FM+DL T+EHGYTE   P +   +++YGTGQ+PKFA+D             +  +LIPT+
Sbjct: 178 FMLDLQTTEHGYTECYTPYMANADSLYGTGQLPKFAEDLFAARKGGQEGEGENLYLIPTA 237

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV+LTN    EI+ ++ LP++ T   P FRSEAGS GRDTRGM+RQHQF K E+V +   
Sbjct: 238 EVTLTNTVRGEILSAEQLPVKLTAHTPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQVVHP 297

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E S+   E M+  A  +L++L L YRVVSL TGD+GFSA KTYDLEVWL  QN YREISS
Sbjct: 298 EKSYEALEEMVKNAGRVLEKLGLPYRVVSLSTGDMGFSAAKTYDLEVWLPAQNTYREISS 357

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
            S C  FQ+RRM +R+R+   +  +  HTLNGSG+AVGR L+A+LEN+  ADGSVTIPT 
Sbjct: 358 VSNCEAFQARRMQARFRNDKGR-PELVHTLNGSGLAVGRTLVALLENFQQADGSVTIPTA 416

Query: 413 LRPYMNNLAVIKK 425
           L+PYM  L  +  
Sbjct: 417 LQPYMGGLTRLTP 429


>gi|169632602|ref|YP_001706338.1| seryl-tRNA synthetase [Acinetobacter baumannii SDF]
 gi|260557291|ref|ZP_05829507.1| seryl-tRNA synthetase [Acinetobacter baumannii ATCC 19606]
 gi|169151394|emb|CAP00119.1| seryl-tRNA synthetase ; also charges selenocystein tRNA with serine
           [Acinetobacter baumannii]
 gi|260409397|gb|EEX02699.1| seryl-tRNA synthetase [Acinetobacter baumannii ATCC 19606]
          Length = 425

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 190/425 (44%), Positives = 266/425 (62%), Gaps = 5/425 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M+D + +R N E ++ AL KR ++   +   SL+ + + L  K E ++A RN+ + Q+GQ
Sbjct: 3   MIDPKLLRNNIEVVNAALAKRGVQLDVQEWASLETRRKDLQSKTEKLQAERNAGAKQVGQ 62

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G       +      + +++   E    E+ + +++    IPN+P E VP G   N
Sbjct: 63  IKKSGG--DASEIMARMQAIGDEIKAAEVALSELQNEIEQKALSIPNLPDESVPAGKDEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I   G         ++H ++GE +G ++F+ ATKL+G+RFSVL G LA L+RAL Q
Sbjct: 121 DNVEISKWGTPRQFDFEIKDHTDLGEWMGGLEFETATKLTGSRFSVLKGPLARLQRALTQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT--DGRWLIPTSEVSLTN 238
           FM+D HT ++GYTE   P LV  +++ GTGQ+PKF +D+F        +LIPT+EV +TN
Sbjct: 181 FMLDTHTLKNGYTEAYVPYLVNADSLRGTGQLPKFEEDLFKLQGEKEYYLIPTAEVPVTN 240

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
               EII++  LPL++    P FRSEAGS GRDTRG++RQHQF K E+V I + E S   
Sbjct: 241 FVRDEIIDADRLPLKYAAHTPCFRSEAGSYGRDTRGLIRQHQFDKVEMVQIVKPETSMQA 300

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E + + AE IL+ L L YR + LC GD+GF A KTYDLEVW+  QN YREISSCS  G+
Sbjct: 301 LEELTAHAEGILQALGLPYRKILLCGGDMGFGATKTYDLEVWVPSQNTYREISSCSNMGD 360

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRM +RYR  + K  +  HTLNGSG+AVGR L+A++ENY   DGS+ IP VLRPYM 
Sbjct: 361 FQARRMKARYR-MDQKKTELVHTLNGSGLAVGRTLLAVMENYQREDGSIEIPEVLRPYMG 419

Query: 419 NLAVI 423
               I
Sbjct: 420 GATFI 424


>gi|302344707|ref|YP_003809236.1| seryl-tRNA synthetase [Desulfarculus baarsii DSM 2075]
 gi|301641320|gb|ADK86642.1| seryl-tRNA synthetase [Desulfarculus baarsii DSM 2075]
          Length = 426

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 195/425 (45%), Positives = 267/425 (62%), Gaps = 3/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD++++R+N + +  ++ +R+ +   E    LDE+ R ++ ++E +R+ RN  SAQ+ +
Sbjct: 1   MLDLKFVRENFDLVQRSIAQRNGKVDLETYGRLDERRRQVLPELESLRSTRNDVSAQVAR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G       L  +   +  ++  LE E  +V   L +L+  IPN+P +  P+G    
Sbjct: 61  LKKAG--EDASGLFEQMKDVGARIKDLEAELAQVEQELGQLMLTIPNLPHQSTPVGKGEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N ++   G+ P        H++IG  L ++DF+RA +++G+RF+V+ G  A LERAL  
Sbjct: 119 DNPVVSVWGQPPVFDFEPLNHWDIGVNLDIIDFERAVRMAGSRFAVMKGAGARLERALIG 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT-DGRWLIPTSEVSLTNL 239
            M+D HT+ HGYTE+  PL+V   A+ GTGQ+PKFA+D F       WLIPT+EV LTNL
Sbjct: 179 LMLDTHTTAHGYTEILPPLMVNTRALTGTGQLPKFAEDSFKVEGADYWLIPTAEVPLTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +  E+++   LPL +T   P FR+EAGS G+D RG++R HQF K ELV I R EDS+   
Sbjct: 239 HMDEVLDGDKLPLCYTAYTPCFRAEAGSHGKDVRGLIRLHQFDKVELVRICRPEDSYENL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E +   AE IL+ L L YR + LCTGDLGFSA KTYDLEVWL GQN YREISSCS C  F
Sbjct: 299 EVLTGHAEAILRLLGLPYRKIVLCTGDLGFSAAKTYDLEVWLPGQNRYREISSCSNCEAF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR   R++D   K     HTLNGSG+AVGR L+AILENY  ADGSV IP  L PYM  
Sbjct: 359 QARRAGIRFKDKGRKGTTLAHTLNGSGLAVGRALVAILENYQQADGSVKIPEALLPYMGG 418

Query: 420 LAVIK 424
              IK
Sbjct: 419 QQTIK 423


>gi|322417644|ref|YP_004196867.1| seryl-tRNA synthetase [Geobacter sp. M18]
 gi|320124031|gb|ADW11591.1| seryl-tRNA synthetase [Geobacter sp. M18]
          Length = 422

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 192/424 (45%), Positives = 269/424 (63%), Gaps = 4/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD +++R+N E ++  LK R           LD + R L+++ E ++A RN  + +I +
Sbjct: 1   MLDARYLRENLETVEARLKTRGEGVDIARFRELDGRRRELLQQSETLKALRNKVTEEIAR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
                + S     K E   + +Q+  +++    V   L+  +  +PN+P E  PIG S  
Sbjct: 61  LK---DKSQAADRKAEMREVSQQIKGIDESLKSVEEELQGFLLTVPNIPNETTPIGKSEE 117

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+++R  G   S     + H+EIGE+L ++DF+R  KL+GARF++  G  A LERAL  
Sbjct: 118 DNVVVRLEGDIRSYSFEPKPHWEIGESLDILDFERGAKLTGARFTLYKGLGARLERALIN 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFC-TTDGRWLIPTSEVSLTNL 239
           FM+DLH  EH Y E+  P +V  ++M GTGQ+PKF +D+F       +LIPT+EV +TN+
Sbjct: 178 FMLDLHIDEHKYIEMLPPFMVNRDSMTGTGQLPKFEEDLFHLEGVDFFLIPTAEVPVTNI 237

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +  EI++   LP+ +    P FR EAGS G+DTRG++RQHQF K ELV  T  E+S+ E 
Sbjct: 238 HRGEILKGSDLPISYCAYTPCFRKEAGSYGKDTRGLIRQHQFNKVELVKFTAPEESYQEL 297

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           +++L  AEE+L+RL + YRVV LCTGD+GFSA KT+D+EVWL GQN YREISSCS   +F
Sbjct: 298 QKLLGHAEEVLRRLQIPYRVVELCTGDIGFSAAKTFDIEVWLPGQNCYREISSCSCFEDF 357

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR   R+R       +F HTLNGSG+AVGR L+A+LENY  ADGSV IP VLRPYM  
Sbjct: 358 QARRAGIRFRPDEKAKPEFVHTLNGSGLAVGRTLVAVLENYQQADGSVLIPEVLRPYMGG 417

Query: 420 LAVI 423
              I
Sbjct: 418 AERI 421


>gi|257468587|ref|ZP_05632681.1| seryl-tRNA synthetase [Fusobacterium ulcerans ATCC 49185]
 gi|317062844|ref|ZP_07927329.1| seryl-tRNA synthetase [Fusobacterium ulcerans ATCC 49185]
 gi|313688520|gb|EFS25355.1| seryl-tRNA synthetase [Fusobacterium ulcerans ATCC 49185]
          Length = 423

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 197/425 (46%), Positives = 270/425 (63%), Gaps = 2/425 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           ML++++IR+N E +   L  R+          LDE+ R ++ ++E ++ +RN+ SA+I +
Sbjct: 1   MLELKFIRENRELVKEMLANRNSSIDLAEFDKLDEERRTILGEVELLKQKRNTESAEIAR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              E        +  E   +  Q+  L+ +  EV   L      IPN+  E  P+G    
Sbjct: 61  LKKEKQ--DASQIIEEMGKVSAQIKELDAKLAEVDEKLTYFQMVIPNMYQEGTPVGKDEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G         + H+EIGE LG++DF+R +KL G+RF +  G  A +ERAL  
Sbjct: 119 SNVEVRRWGTPREFTFEPKAHWEIGENLGILDFERGSKLGGSRFVLYRGMGARVERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D+HT+EHGYTE   P LV+ E   GTGQ+PKF DDM+ TTD  +LI TSE+++TN++
Sbjct: 179 FMLDMHTTEHGYTEHITPFLVKREICEGTGQLPKFEDDMYRTTDDMFLISTSEITMTNIH 238

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             EI++ K LP  +T  +P FR EAGS G+D +G++R HQF K E+V I  +E S+ E E
Sbjct: 239 RKEILDEKELPKYYTAYSPCFRREAGSYGKDVKGIIRVHQFNKVEMVKIATQESSYEELE 298

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           +M+  AEE+L+RL+L YRV+ LCTGDLGFSA KTYDLEVWL  QN YREISSCS C +FQ
Sbjct: 299 KMVVNAEEVLQRLELPYRVIQLCTGDLGFSAAKTYDLEVWLPSQNKYREISSCSNCTDFQ 358

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRM  +YR   S   +F HTLNGSG+AVGR  +AI+ENY   DGS  IP  L PYM  +
Sbjct: 359 ARRMGLKYRPNGSSKSEFCHTLNGSGLAVGRTFVAIMENYQQEDGSFLIPKALVPYMGGI 418

Query: 421 AVIKK 425
            VIKK
Sbjct: 419 DVIKK 423


>gi|302185001|ref|ZP_07261674.1| seryl-tRNA synthetase [Pseudomonas syringae pv. syringae 642]
          Length = 426

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 198/427 (46%), Positives = 272/427 (63%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R        I SL+ + +++  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRTQLQDVADRLASRGFTLDVARIESLEAQRKVVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G    +  L  +   +  +L   + E   + + L  L+  IPN+P E VPIG    
Sbjct: 61  AKQRG--EDIAPLMADVERMGNELSEGKVELDAIQAELDALVLSIPNLPHESVPIGADEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G         ++H  +GE  G +DF+ A KLSGARF++L G +A L RAL Q
Sbjct: 119 GNVEVRRWGTPAQFDFEVKDHVALGEKFGWLDFETAAKLSGARFALLRGPIARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD----GRWLIPTSEVSL 236
           FMI+LH +EHGY E   P LV+  A+ GTGQ+PKF +D+F  +       +LIPT+EVSL
Sbjct: 179 FMINLHINEHGYEETYTPYLVQAPALQGTGQLPKFEEDLFKISREGEADLYLIPTAEVSL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+ S EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I   +DS 
Sbjct: 239 TNIVSGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVAPDDSM 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
              E +   AE +L+ L+L YR ++LCTGD+GFSA KTYDLEVW+  Q+ YREISSCS C
Sbjct: 299 AALESLTGNAERVLQLLELPYRTLALCTGDMGFSAVKTYDLEVWIPSQDKYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P VL+PY
Sbjct: 359 GDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPEVLKPY 418

Query: 417 MNNLAVI 423
           M  L VI
Sbjct: 419 MGGLEVI 425


>gi|85703424|ref|ZP_01034528.1| seryl-tRNA synthetase [Roseovarius sp. 217]
 gi|85672352|gb|EAQ27209.1| seryl-tRNA synthetase [Roseovarius sp. 217]
          Length = 430

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 205/429 (47%), Positives = 274/429 (63%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+ P+  D AL +R L P +  IL+LDE  R  I   E  +A +N  S + G 
Sbjct: 1   MHDIRAIRETPDAFDAALARRGLAPVTPEILALDEARRTRIHAAETAQAEQNRASKEAGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G+ +  + L+   +  K ++  ++ E   +   L   +  +PN+P ++VP GT  +
Sbjct: 61  AKGRGDEAEFERLRALVADKKAEMAAMQAEAKALDMQLTDHLMALPNLPFDDVPDGTDES 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G         +EH+EI      MDF+ A KLSGARF VL+G +A L RAL Q
Sbjct: 121 GNVELRRWGTPAIFDFQPKEHYEITGVQPGMDFETAAKLSGARFVVLSGSIARLHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D H  E+G  E   P+LVR E M GTGQ+PKF +D + TT+G WL+PT+EV+LTN+ 
Sbjct: 181 FMLDTHIEENGLQETWTPVLVRPEMMLGTGQLPKFGEDSYETTNGWWLVPTAEVTLTNIV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
             E +E+ +LP R+      FRSEAGSAGRDT GMLRQHQF K E+VSIT  ++S  E +
Sbjct: 241 HGETVEAATLPRRYVAHTQCFRSEAGSAGRDTAGMLRQHQFEKVEMVSITHPDESRAELD 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE IL+RL L YR + LCTGD+GF A +T+D+EVWL GQN YREISS S CG+FQ
Sbjct: 301 RMTGCAEGILERLGLPYRTIVLCTGDMGFGARRTHDIEVWLPGQNTYREISSVSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++       +F HTLNGSG+AVGRCLIA+LEN   ADGSV IP  L PY+   
Sbjct: 361 ARRMNARFKPQGGGKPEFLHTLNGSGLAVGRCLIAVLENGQQADGSVRIPDALHPYLRGK 420

Query: 421 AVIKKEHIL 429
            ++  +  L
Sbjct: 421 TILNADGSL 429


>gi|157369929|ref|YP_001477918.1| seryl-tRNA synthetase [Serratia proteamaculans 568]
 gi|166987317|sp|A8GCF0|SYS_SERP5 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|157321693|gb|ABV40790.1| seryl-tRNA synthetase [Serratia proteamaculans 568]
          Length = 430

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 190/431 (44%), Positives = 267/431 (61%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R   + + + L +R  +   + + S +E+ ++L  + E ++A RNS S  IG 
Sbjct: 1   MLDPNLLRNELDAVAVKLARRGFKLDLDLLRSQEERRKVLQVETETLQAERNSRSKSIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L ++L   +    ++ + ++     IPN+P +EVP G   +
Sbjct: 61  AKARG--EDIEPLRREVNELGDKLDTAKAALDQLQAEIRDYALAIPNLPDDEVPDGKDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G+        R+H ++GE  G +DF  A KL+G+RF V+ G +A + RAL Q
Sbjct: 119 DNLEVSRWGEPRQYDFAVRDHVDLGEMAGGLDFAAAVKLTGSRFVVMKGQIARMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY E   P LV    ++GTGQ+PKF +D+F T             LIPT+
Sbjct: 179 FMLDLHTEQHGYQETYVPYLVNHATLFGTGQLPKFGEDLFHTKPLEEESDSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTNL   EI+E +SLPL+ T   P FR+EAGS GRDTRG++R HQF K E+V I R 
Sbjct: 239 EVPLTNLVRDEILEEESLPLKMTAHTPCFRAEAGSYGRDTRGLIRMHQFDKVEMVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS T  E +   AE++L+ L+L YR + LCTGD+G  +CKTYDLEVWL  Q+ YREISS
Sbjct: 299 EDSMTTLEELTGHAEKVLQLLNLPYRKMLLCTGDMGAGSCKTYDLEVWLPAQDTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   ++Q+RRM +R R    K  +  HTLNGSG+AVGR L+A+LENY  ADG + +P V
Sbjct: 359 CSNMWDYQARRMQARCRSKTEKKPRLVHTLNGSGLAVGRTLVAVLENYQQADGRIQVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMGGLEYI 429


>gi|66046404|ref|YP_236245.1| seryl-tRNA synthetase [Pseudomonas syringae pv. syringae B728a]
 gi|289679158|ref|ZP_06500048.1| seryl-tRNA synthetase [Pseudomonas syringae pv. syringae FF5]
 gi|81308101|sp|Q4ZRL5|SYS_PSEU2 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|63257111|gb|AAY38207.1| Seryl-tRNA synthetase, class IIa [Pseudomonas syringae pv. syringae
           B728a]
 gi|330900602|gb|EGH32021.1| seryl-tRNA synthetase [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330940282|gb|EGH43412.1| seryl-tRNA synthetase [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330981394|gb|EGH79497.1| seryl-tRNA synthetase [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 426

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 198/427 (46%), Positives = 273/427 (63%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R        I SL+ + +++  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRTQLQDVADRLASRGFTLDVARIESLEAQRKVVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G    +  L  +   +  +L   + E   + + L  L+  IPN+P E VP+G    
Sbjct: 61  AKQRG--EDIAPLMADVERMGNELSEGKVELDGIQAELDALVLSIPNLPHESVPVGADEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G   S     ++H  +GE  G +DF+ A KLSGARF++L G +A L RAL Q
Sbjct: 119 GNVEVRRWGTPTSFDFEVKDHVALGEKFGWLDFETAAKLSGARFALLRGPIARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD----GRWLIPTSEVSL 236
           FMI+LH +EHGY E   P LV+  A+ GTGQ+PKF +D+F  +       +LIPT+EVSL
Sbjct: 179 FMINLHINEHGYEETYTPYLVQAPALQGTGQLPKFEEDLFKISREGEADLYLIPTAEVSL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+ S EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I   +DS 
Sbjct: 239 TNIVSGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVAPDDSM 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
              E +   AE +L+ L+L YR ++LCTGD+GFSA KTYDLEVW+  Q+ YREISSCS C
Sbjct: 299 AALESLTGNAERVLQLLELPYRTLALCTGDMGFSAVKTYDLEVWIPSQDKYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P VL+PY
Sbjct: 359 GDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPEVLKPY 418

Query: 417 MNNLAVI 423
           M  L VI
Sbjct: 419 MGGLEVI 425


>gi|257065307|ref|YP_003144979.1| seryl-tRNA synthetase [Slackia heliotrinireducens DSM 20476]
 gi|256792960|gb|ACV23630.1| seryl-tRNA synthetase [Slackia heliotrinireducens DSM 20476]
          Length = 428

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 196/429 (45%), Positives = 274/429 (63%), Gaps = 2/429 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+++R+N + +  A+K R+     +    LDE  R  I   E ++A+RN+ S QIG 
Sbjct: 1   MLDIKFVRENQDVITQAMKNRNGSWDVDKFNELDESRRSYIADEEAMQAKRNTASKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            + EG     +A K E   L E++  +  +  E  ++L +++  IPN+P E  P+G    
Sbjct: 61  LMREGKADEAEASKEEVRALNEKIAEVSAKRSEAETALNEMLCRIPNIPHESTPVGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN  +R  G         + H+++G  L ++D +RATKL+G+RF +L G  A LERAL  
Sbjct: 121 ENPEVRRWGTPRKFDFEFKAHWDLGADLNIIDSERATKLAGSRFVLLGGLGARLERALIN 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM D H    GY E   P++     +YGTGQ+PKF +D+F TT+G +LIPT+EV LTN++
Sbjct: 181 FMADTH-GSRGYKEWWCPVMANGNTLYGTGQLPKFEEDLFHTTEGLYLIPTAEVQLTNIH 239

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + +++E+  LPL++      FR EAGSAGRDTRG++R HQF K E+V     ED F + E
Sbjct: 240 AGDVLEASQLPLKYCGYTACFREEAGSAGRDTRGLIRVHQFDKVEMVKFATPEDGFNQLE 299

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
            M+  AE IL+ L L YRV+SLCTGDLGFSA KTYDLEVWL   + Y+EISSCS C +FQ
Sbjct: 300 LMVEDAENILQLLGLPYRVISLCTGDLGFSAAKTYDLEVWLPSYDAYKEISSCSCCTDFQ 359

Query: 361 SRRMNSRYRDPNS-KSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           +RR N RYRDPN  K  ++ +TLNGSG+AVGR + A++ENY  ADGS+ +P VL PYM  
Sbjct: 360 ARRANIRYRDPNKFKGTRYVYTLNGSGLAVGRTMAAVMENYQQADGSIKVPDVLVPYMGG 419

Query: 420 LAVIKKEHI 428
           + VI  + +
Sbjct: 420 VEVIAADQL 428


>gi|238789329|ref|ZP_04633116.1| Seryl-tRNA synthetase [Yersinia frederiksenii ATCC 33641]
 gi|238722661|gb|EEQ14314.1| Seryl-tRNA synthetase [Yersinia frederiksenii ATCC 33641]
          Length = 430

 Score =  433 bits (1112), Expect = e-119,   Method: Composition-based stats.
 Identities = 197/431 (45%), Positives = 266/431 (61%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R   + +   L +R  +   E +   +E+ ++L  + E ++A RNS S  IG 
Sbjct: 1   MLDPNMLRNELDAVAEKLARRGFKLDVEMLRQQEERRKVLQVETESLQAERNSRSKMIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E  ++ + ++ L   IPN+P + VP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNVLGEKLDAAKAELDKLQNEIRDLALSIPNLPDDSVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G+        R+H  +GE  G +DF  A KL+GARF V+ G +A + RAL Q
Sbjct: 119 DNVEVSRWGEPRKYDFEVRDHVSLGEMAGGLDFAAAVKLTGARFVVMKGQIARMHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY E   P LV    +YGTGQ+PKF  D+F T             LIPT+
Sbjct: 179 FMLDLHTEKHGYLETYVPYLVNHATLYGTGQLPKFGGDLFHTKPLEEESDSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV +TNL   EI+E +SLPL+ T   P FRSEAGS GRDTRG++R HQF K E+V ITR 
Sbjct: 239 EVPVTNLVRDEILEEESLPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQITRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E +   AE++L+ L+L YR V LCTGD+GF + KTYDLEVWL  QN YREISS
Sbjct: 299 EDSMAALEELTGHAEKVLQLLELPYRKVLLCTGDMGFGSSKTYDLEVWLPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R+   +  +  HTLNGSG+AVGR L+A+LENY  ADG + +P V
Sbjct: 359 CSNMWDFQARRMQARCRNKTDRKTRLVHTLNGSGLAVGRTLVAVLENYQQADGRIQVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMGGLEFI 429


>gi|126725452|ref|ZP_01741294.1| seryl-tRNA synthetase [Rhodobacterales bacterium HTCC2150]
 gi|126704656|gb|EBA03747.1| seryl-tRNA synthetase [Rhodobacterales bacterium HTCC2150]
          Length = 430

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 207/429 (48%), Positives = 278/429 (64%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR NP   D  L +R   P S  IL++DE  R  I+  E   A RN+ S Q+G 
Sbjct: 1   MHDIRAIRANPAEFDQQLARRGKSPMSADILAIDEARRAKIQAAETALADRNAASKQVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G+ +  + L+   S  K+++  L+       + L  L+  I N+P ++VP+G+  +
Sbjct: 61  AKAKGDEAEFERLRALVSAKKDEIAELDAASKAEDARLNDLLMSIDNIPFDDVPVGSDED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ I   G+ P       EHFEIG     MDF+ A K+SG+RF +++G +A + RAL Q
Sbjct: 121 ANVEINRNGEPPRMNFTPVEHFEIGGVKSGMDFETAGKISGSRFVIMSGAVARIHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+D HT+E+  TEV+ P+LVR EAM GTGQ+PKFA+D + TT+G WLIPTSEV+LTN+ 
Sbjct: 181 FMLDTHTTENDLTEVNTPVLVRTEAMTGTGQLPKFAEDSYQTTNGWWLIPTSEVTLTNIV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           S   +E   LP R+   +  FRSEAGSAGRDT GMLRQHQF K E+VS+T  ++S  E +
Sbjct: 241 SGLTVEESYLPRRYVAHSLCFRSEAGSAGRDTSGMLRQHQFEKVEMVSVTHPDNSRAELD 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CAE IL+ L L YR V LCTGD+GF A +T+D+EVWL GQ+ YREISS S CG+FQ
Sbjct: 301 RMTRCAEGILEALGLAYRTVVLCTGDMGFGARRTHDIEVWLPGQDTYREISSVSVCGDFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R++       +F HTLNGSG+AVGRCLIA+LEN    DGSV +P  L  ++   
Sbjct: 361 ARRMNARFKPSEGGKPEFVHTLNGSGLAVGRCLIAVLENGQQEDGSVKLPAALHGHLGGK 420

Query: 421 AVIKKEHIL 429
             +  E  L
Sbjct: 421 TTLTPEGTL 429


>gi|113866791|ref|YP_725280.1| seryl-tRNA synthetase [Ralstonia eutropha H16]
 gi|123329502|sp|Q0KDK9|SYS_RALEH RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|113525567|emb|CAJ91912.1| Seryl-tRNA synthetase [Ralstonia eutropha H16]
          Length = 434

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 197/437 (45%), Positives = 269/437 (61%), Gaps = 15/437 (3%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ  R++ + +   L  R  +       +L+ + + L  + E+++ARRNS S QIG 
Sbjct: 1   MLDIQLFRKDIDAVAQRLATRGYQLDVAAFQALEAERKQLQTQTEELQARRNSLSKQIGM 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A+  E   + + L        E+ + L +L+  IPN+P E VP+G    
Sbjct: 61  LKGKG--EDASAVMAEVGGIGDTLKASAARLDEIQAHLAELMLAIPNLPHESVPVGNDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R VG+        R+H ++G+ LG +DFD A K++G+RFS+L G LA + RAL Q
Sbjct: 119 QNVEVRRVGEPRQFDFAVRDHVDVGDKLG-LDFDTAVKVTGSRFSMLRGGLARMNRALVQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-----------GRWLI 229
            M+D HT EHGYTE+  P +V   +M GTGQ+PKF +D+F                 +LI
Sbjct: 178 LMLDTHTQEHGYTEMYVPYMVNAASMRGTGQLPKFEEDLFKVPRKVGSEDGERIENFYLI 237

Query: 230 PTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSI 289
           PT+EV LTN+    I+  + LPLRF    P FRSEAGS G+DTRGM+RQHQF K ELV +
Sbjct: 238 PTAEVPLTNIVRDAIVAGEKLPLRFVAHTPCFRSEAGSYGKDTRGMIRQHQFDKVELVQV 297

Query: 290 TREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYRE 349
                SF   E++   AE ILK+L+L +R + LCTGD+GF + KTYDLEVW+  QN YRE
Sbjct: 298 VPAAQSFEALEQLTGHAEAILKKLELPFRTIVLCTGDMGFGSTKTYDLEVWIPAQNTYRE 357

Query: 350 ISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTI 409
           ISSCS  G+FQ+RRM +R R    K  +  HTLNGSG+AVGR L+AILENY NADGSVT+
Sbjct: 358 ISSCSNMGDFQARRMQARMRAGQGK-PELVHTLNGSGLAVGRTLVAILENYQNADGSVTV 416

Query: 410 PTVLRPYMNNLAVIKKE 426
           P  L+PYM  +  ++ E
Sbjct: 417 PAALQPYMGGITRLEPE 433


>gi|312961665|ref|ZP_07776163.1| Seryl-tRNA synthetase [Pseudomonas fluorescens WH6]
 gi|311283924|gb|EFQ62507.1| Seryl-tRNA synthetase [Pseudomonas fluorescens WH6]
          Length = 426

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 194/428 (45%), Positives = 278/428 (64%), Gaps = 6/428 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R N + +   L  R        I +L+E+ + +  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRSNLQDVADRLASRGFALDVARIEALEEQRKTVQTRTEALQAERNARSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G    +  L  +   +  +L   + E  ++ S L  ++  IPN+P E VPIG   +
Sbjct: 61  AKQRG--EDIAPLMADVERMGTELSDGKVELDKIQSELDSILLGIPNIPHESVPIGADED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G   +     ++H  +GE  G +DF+ A K+SGARF++L G +A + RAL Q
Sbjct: 119 GNVEVRRWGTPKAFDFEIKDHVALGELTGGLDFETAAKMSGARFALLRGPIARMHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG----RWLIPTSEVSL 236
           FMI+LHT+EHGY E   P LV+  A+ GT Q+PKF +D+F  +       +LIPT+EVSL
Sbjct: 179 FMINLHTAEHGYEEAYTPYLVQAPALVGTSQLPKFEEDLFKISRDGEADLYLIPTAEVSL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+ + EI+++K LP++F   +P FRSEAG++GRDTRGM+RQHQF K E+V +     S 
Sbjct: 239 TNIVAGEILDAKQLPIKFVAHSPCFRSEAGASGRDTRGMIRQHQFDKVEMVQVVEPSTSM 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
              E + + AE +L+ L+L YRV+SLCTGD+GFSA KTYDLEVW+  Q+ YREISSCS C
Sbjct: 299 QALEGLTANAERVLQLLELPYRVLSLCTGDMGFSAVKTYDLEVWVPSQDKYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P VL+PY
Sbjct: 359 GDFQARRMQARFRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPEVLKPY 418

Query: 417 MNNLAVIK 424
           M  + VI+
Sbjct: 419 MAGVEVIR 426


>gi|299768961|ref|YP_003730987.1| seryl-tRNA synthetase [Acinetobacter sp. DR1]
 gi|298699049|gb|ADI89614.1| seryl-tRNA synthetase [Acinetobacter sp. DR1]
          Length = 423

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 190/425 (44%), Positives = 268/425 (63%), Gaps = 5/425 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M+D + +R N E ++ AL KR ++   +   SL+ + + L  K E ++A RN+ + Q+GQ
Sbjct: 1   MIDPKLLRNNIEAVNAALAKRGVQLDVQEWASLETRRKDLQSKTEKLQAERNAGAKQVGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G       +      + +++   E    E+ + +++    IPN+P E VP G   +
Sbjct: 61  IKKSGG--DASEIMARMQAIGDEIKAAEVALSELQNEIEQKALSIPNLPDESVPAGKDED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I   G         ++H ++GE +G ++F+ ATKL+G+RFSVL G LA L+RAL Q
Sbjct: 119 DNVEISKWGTPRQFDFEIKDHTDLGEWMGGLEFETATKLTGSRFSVLKGSLARLQRALTQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT--DGRWLIPTSEVSLTN 238
           FM+D HT ++GYTE   P LV  +++ GTGQ+PKF +D+F        +LIPT+EV +TN
Sbjct: 179 FMLDTHTLKNGYTEAYVPYLVNADSLRGTGQLPKFEEDLFKLQGEKEYYLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
               EII+++ LPL++    P FRSEAGS GRDTRG++RQHQF K E+V I + E S   
Sbjct: 239 FVRDEIIDTERLPLKYAAHTPCFRSEAGSYGRDTRGLIRQHQFDKVEMVQIVKPETSMQA 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E + + AE IL+ L L YR + LC GD+GF A KTYDLEVW+  QN YREISSCS  G+
Sbjct: 299 LEDLTAHAEGILQALGLPYRKILLCGGDMGFGATKTYDLEVWVPSQNTYREISSCSNMGD 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRM +RYR  + K  +  HTLNGSG+AVGR L+A++ENY   DGS+ IP VLRPYM 
Sbjct: 359 FQARRMKARYR-MDQKKTELVHTLNGSGLAVGRTLLAVMENYQREDGSIEIPEVLRPYMG 417

Query: 419 NLAVI 423
            L  I
Sbjct: 418 GLTFI 422


>gi|320323766|gb|EFW79850.1| seryl-tRNA synthetase [Pseudomonas syringae pv. glycinea str. B076]
 gi|320327907|gb|EFW83912.1| seryl-tRNA synthetase [Pseudomonas syringae pv. glycinea str. race
           4]
          Length = 426

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 200/427 (46%), Positives = 273/427 (63%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R        I SL+ + +++  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRTQLQDVADRLASRGFTLDVARIESLEAQRKVVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G    +  L  +   +  +L   + E   + + L  L+  IPN+P E VP+G    
Sbjct: 61  AKQRG--EDIAPLMADVERMGNELSEGKVELDGIQAELDALVLSIPNLPHESVPVGADEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G   +     ++H  +GE  G +DFD A KLSGARF++L G +A L RAL Q
Sbjct: 119 GNVEVRRWGTPTAFDFEVKDHVALGEKFGWLDFDTAAKLSGARFALLRGPIARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD----GRWLIPTSEVSL 236
           FMI+LH +EHGY E   P LV+  A+ GTGQ+PKF +D+F  T       +LIPT+EVSL
Sbjct: 179 FMINLHINEHGYEETYTPYLVQAPALQGTGQLPKFEEDLFKITREGEADLYLIPTAEVSL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+ S EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I   EDS 
Sbjct: 239 TNIVSGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVAPEDSM 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
              E +   AE +L+ L+L YR ++LCTGD+GFSA KTYDLEVW+  Q+ YREISSCS C
Sbjct: 299 AALESLTGNAERVLQLLELPYRTLALCTGDMGFSAVKTYDLEVWIPSQDKYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P VL+PY
Sbjct: 359 GDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPEVLKPY 418

Query: 417 MNNLAVI 423
           M  L VI
Sbjct: 419 MGGLEVI 425


>gi|213970055|ref|ZP_03398187.1| seryl-tRNA synthetase [Pseudomonas syringae pv. tomato T1]
 gi|301381411|ref|ZP_07229829.1| seryl-tRNA synthetase [Pseudomonas syringae pv. tomato Max13]
 gi|302058409|ref|ZP_07249950.1| seryl-tRNA synthetase [Pseudomonas syringae pv. tomato K40]
 gi|302130342|ref|ZP_07256332.1| seryl-tRNA synthetase [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|213925159|gb|EEB58722.1| seryl-tRNA synthetase [Pseudomonas syringae pv. tomato T1]
          Length = 426

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 197/427 (46%), Positives = 273/427 (63%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R        I SL+ + +++  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRTQLQDVADRLASRGFTLDVARIESLEAQRKVVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G    +  L  +   +  +L   + E   + + L  L+  IPN+P E VP+G    
Sbjct: 61  AKQRG--EDIAPLMADVERMGNELSEGKVELDAIQAELDALVLSIPNLPHESVPVGADEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G   +     ++H  +GE  G +DF+ A KLSGARF++L G +A L RAL Q
Sbjct: 119 GNVEVRRWGTPTAFDFEVKDHVALGEKFGWLDFETAAKLSGARFALLRGPIARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD----GRWLIPTSEVSL 236
           FMI+LH +EHGY E   P LV+  A+ GTGQ+PKF +D+F  +       +LIPT+EVSL
Sbjct: 179 FMINLHINEHGYEETYTPYLVQAPALQGTGQLPKFEEDLFKISREGEADLYLIPTAEVSL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+ S EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I   +DS 
Sbjct: 239 TNIVSGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVAPDDSM 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
              E +   AE +L+ L+L YR ++LCTGD+GFSA KTYDLEVW+  Q+ YREISSCS C
Sbjct: 299 AALESLTGNAERVLQLLELPYRTLALCTGDMGFSAVKTYDLEVWIPSQDKYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P VL+PY
Sbjct: 359 GDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPEVLKPY 418

Query: 417 MNNLAVI 423
           M  L VI
Sbjct: 419 MGGLEVI 425


>gi|194018062|ref|ZP_03056667.1| seryl-tRNA synthetase [Bacillus pumilus ATCC 7061]
 gi|194010254|gb|EDW19831.1| seryl-tRNA synthetase [Bacillus pumilus ATCC 7061]
          Length = 424

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 190/426 (44%), Positives = 272/426 (63%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ +R + + +   L  R  +    +    LD+K R LI K E +++RRN  S Q+ 
Sbjct: 1   MLDIKQLRTDFDQIKEKLAHRGEDLADFDKFGELDQKRRELIGKTEVLKSRRNEVSQQVA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      D +  E   + +++  L+ E   V  SL+ ++  IPN+P + VP+G + 
Sbjct: 61  VLKREKK--DADHIIQEMREVGDEIKKLDDELRTVEESLQHILFSIPNIPHDTVPVGETE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+ +R  G++P+     + H+++ + L ++DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 DDNVEVRKWGEQPAFSFEPKPHWDVADELNILDFERAGKVTGSRFVFYKGLGARLERALY 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLH  E G+TEV  P +V   +M GTGQ+PKF +D F   +  +  IPT+EV +TN
Sbjct: 179 NFMLDLHVDEFGFTEVLPPYMVNRASMTGTGQLPKFEEDAFKIREEDYFLIPTAEVPITN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           ++  EI+E + LP+ +   +  FRSEAGSAGRDTRG++RQHQF K ELV   R EDS+ E
Sbjct: 239 MHRDEILEGEQLPINYAAFSACFRSEAGSAGRDTRGLIRQHQFNKVELVKFVRPEDSYEE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++ + AE++L+ L+L YRV+S+CTGDLGF+A K YD+EVW+  Q+ YREISSCS    
Sbjct: 299 LEKLTNQAEKVLQLLNLPYRVMSMCTGDLGFTAAKKYDIEVWIPSQDTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R       +  HTLNGSG+AVGR + AILENY   DG+V IP VLRPYM 
Sbjct: 359 FQARRANIRFRPEPKAKPEHVHTLNGSGLAVGRTVAAILENYQQEDGTVIIPEVLRPYMG 418

Query: 419 NLAVIK 424
           N  VIK
Sbjct: 419 NKEVIK 424


>gi|327475192|gb|AEA77191.1| seryl-tRNA synthetase [Bacillus sp. 15.4]
          Length = 426

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 190/428 (44%), Positives = 272/428 (63%), Gaps = 4/428 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+++R N E +   L+ R  +    E    LD + R L+ + E+++++RN  S +I 
Sbjct: 1   MLDIRYLRANFEDVKNRLQDRGEDLSDFEKFEELDVRRRELLVETENLKSKRNEVSQRIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           +   E   +  D L  E   +  ++  L++E  EV   L +L+  IPN+P E VP+G++ 
Sbjct: 61  EMKKEKQNA--DDLILEMREVGSEIKKLDEELKEVEGKLDRLMLSIPNIPHESVPVGSTE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           ++N+  R  G  P+     + H+++    G++DF+RA+K++G+RF    G  A LERAL 
Sbjct: 119 DDNVEARKWGAVPTFDFEPKPHWDLATDSGILDFERASKVTGSRFVFYKGLGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT-DGRWLIPTSEVSLTN 238
            FM+DLH  EHGY E+  P +V  E+M GTGQ+PKF +D F    +  +L+PT+EV +TN
Sbjct: 179 NFMMDLHMDEHGYEEMLPPYIVNRESMTGTGQLPKFEEDAFLIESEDYYLVPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
            +  EI+ +  LP+ +T  +  FRSEAGSAGRDTRG++RQHQF K ELV   R EDS+TE
Sbjct: 239 YHRDEILTNDQLPIAYTAFSACFRSEAGSAGRDTRGLIRQHQFNKVELVRFVRPEDSYTE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++   AE++L+ L+L YRV+S+CT DLGF+A K YD+EVW+     YREISSCS    
Sbjct: 299 LEKLTGHAEKVLQLLNLPYRVMSMCTADLGFTAAKKYDIEVWIPSYRTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R       +  HTLNGSG+A+GR + AILENY   DGS+ IP VLRPYM 
Sbjct: 359 FQARRANIRFRREPGAKPEHVHTLNGSGLALGRTVAAILENYQQEDGSIIIPEVLRPYMR 418

Query: 419 NLAVIKKE 426
              VIK +
Sbjct: 419 GAEVIKPK 426


>gi|319896555|ref|YP_004134748.1| seryl-tRNA synthetase [Haemophilus influenzae F3031]
 gi|317432057|emb|CBY80406.1| Seryl-tRNA synthetase [Haemophilus influenzae F3031]
          Length = 429

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 192/431 (44%), Positives = 262/431 (60%), Gaps = 8/431 (1%)

Query: 1   MLDIQWIRQNPEHLDIALK-KRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           M+D   +R N   +   LK KR+    +E + +L+++ + L    E+++A RN+ S  IG
Sbjct: 1   MIDPNLLRNNLAEVAEKLKVKRNFMLDTEKLTALEDQRKNLQVTTENLQAERNARSKAIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
            A A G    +  L  E   +  QL   + +   V + + ++   IPN+P +EVP+G   
Sbjct: 61  AAKARGK--DIAPLLAEMDDIGNQLTEAKAQLDAVLAEINQIALSIPNLPADEVPLGKDD 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            EN  I   G   +     ++H  +G+    +DF    KL+GARF+V+ G +A + RAL 
Sbjct: 119 TENKEILRWGTPRTFDFEVKDHVTLGKEANGLDFAAGAKLTGARFAVMKGQIAKMHRALA 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-----TDGRWLIPTSEV 234
           QFM+DLHT +HGY E   P LV    +YGTGQ+PKF +D+F T          LIPT+EV
Sbjct: 179 QFMLDLHTEQHGYLETYVPYLVNHATLYGTGQLPKFGEDLFHTLALQGEQPYALIPTAEV 238

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            +TNL    II+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I   + 
Sbjct: 239 PVTNLVRDVIIDEAELPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVDPDK 298

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCS 354
           S    E +   AE++L+ L+L YR V LCTGD+GF +CKTYDLEVW+  QN YREISSCS
Sbjct: 299 SMEALEELTGHAEKVLQLLNLPYRKVLLCTGDMGFGSCKTYDLEVWVPAQNTYREISSCS 358

Query: 355 TCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR 414
              +FQ+RRM +R +    K  +  HTLNGSG+AVGR L+A+LENY NADGS+T+P VLR
Sbjct: 359 NMWDFQARRMQARCKAKGDKKTRLVHTLNGSGLAVGRTLVAVLENYQNADGSITVPEVLR 418

Query: 415 PYMNNLAVIKK 425
           PYM  L VI K
Sbjct: 419 PYMGGLDVIGK 429


>gi|261821270|ref|YP_003259376.1| seryl-tRNA synthetase [Pectobacterium wasabiae WPP163]
 gi|261605283|gb|ACX87769.1| seryl-tRNA synthetase [Pectobacterium wasabiae WPP163]
          Length = 431

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 198/432 (45%), Positives = 265/432 (61%), Gaps = 11/432 (2%)

Query: 1   MLDIQWIRQNPEHLDIAL-KKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD   +R   + +   L  +R  +   E +   +E+ ++L  + E+++A RNS S +IG
Sbjct: 1   MLDPNLLRNELDAVAEKLLARRGFKLDVETLRKQEERRKVLQVETENLQAVRNSRSKEIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
            A A G    ++ L+ E +TL E+L   + E  ++ + ++ L   IPN+P + VP+G   
Sbjct: 61  AAKARG--EDIEPLRREVNTLGEELDAAKAELDQLQNEIRDLALTIPNLPDDSVPLGKDE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            +N  +   G+        R+H E+GE    +DF  A KL+GARF V+ G +A L RAL 
Sbjct: 119 TQNQEVARWGEPRKYDFPVRDHVELGEMAAGLDFAAAVKLTGARFVVMKGQIARLHRALA 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPT 231
           QFM+DLHT +HGY E   P LV    +YGTGQ+PKF +D+F T             LIPT
Sbjct: 179 QFMLDLHTQQHGYQEAYVPYLVNHATLYGTGQLPKFGEDLFHTNPLSEEADSSQYALIPT 238

Query: 232 SEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITR 291
           +EV LTNL   EI++ +SLPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I R
Sbjct: 239 AEVPLTNLVRDEILDEESLPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQIVR 298

Query: 292 EEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREIS 351
            EDS    E + + AE +L+ L L YR V LCTGD+GF + KTYDLEVWL  Q+ YREIS
Sbjct: 299 PEDSMQALEELTTHAETVLQLLKLPYRKVLLCTGDMGFGSTKTYDLEVWLPAQDTYREIS 358

Query: 352 SCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPT 411
           SCS   +FQ+RRM +R R  + K  +  HTLNGSG+AVGR L+A+LENY  ADG + IP 
Sbjct: 359 SCSNMWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVLENYQQADGRIEIPE 418

Query: 412 VLRPYMNNLAVI 423
            LRPYM  L  I
Sbjct: 419 ALRPYMGGLEFI 430


>gi|238022770|ref|ZP_04603196.1| hypothetical protein GCWU000324_02681 [Kingella oralis ATCC 51147]
 gi|237865973|gb|EEP67109.1| hypothetical protein GCWU000324_02681 [Kingella oralis ATCC 51147]
          Length = 430

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 199/432 (46%), Positives = 285/432 (65%), Gaps = 9/432 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R +   +   L  R  E        L+ + ++L  + E+ +A+ N+ S QIG+
Sbjct: 1   MLDIQLLRNDLAGVAARLATRGFELDIAAFEQLENQRKVLQVQNEEAQAKVNTLSKQIGE 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            + +G     +A+K E + +K     L ++   + ++L  L+  IPN+P   VP+G    
Sbjct: 61  LMKQGKREEAEAVKAEVAQVKALQEQLNQDLPRIQAALDDLLLRIPNLPHSSVPVGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG   +     ++H ++G ALG +DF++A +LSGARFS++ G +A L RAL Q
Sbjct: 121 ENVEVRKVGTPKTFDFEVKDHVDLGAALG-LDFEKAAELSGARFSLMKGKVARLHRALAQ 179

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM+D HT +HGYTE   P +V D A+ GTGQ+PKFA+D+F  T         ++LIPT+E
Sbjct: 180 FMLDTHTQQHGYTECYTPYIVSDAALLGTGQLPKFAEDLFHVTRGGDESKLSQYLIPTAE 239

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN+    I+  K LPL+FT  +P FRSEAGS G+DTRG++RQHQF K E+V + + E
Sbjct: 240 VTLTNIVRDTIVAEKDLPLKFTAHSPCFRSEAGSHGKDTRGLIRQHQFDKVEMVQVVQPE 299

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
           +S+   E M+S AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 300 NSYAALEEMVSHAENILKLLELPYRVITLCTGDMGFGAAKTYDLEVWVPAQNTYREISSC 359

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++  + K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IP  L
Sbjct: 360 SNCEDFQARRMKARFKGEDGKN-RLLHTLNGSGLAVGRTLVAVLENHQNADGSINIPQAL 418

Query: 414 RPYMNNLAVIKK 425
           RPY+  L  ++ 
Sbjct: 419 RPYLGGLEKLEP 430


>gi|83746913|ref|ZP_00943960.1| Seryl-tRNA synthetase [Ralstonia solanacearum UW551]
 gi|207723628|ref|YP_002254026.1| seryl-trna synthetase protein [Ralstonia solanacearum MolK2]
 gi|300703435|ref|YP_003745037.1| serine tRNA synthetase; also charges selenocystein tRNA with serine
           [Ralstonia solanacearum CFBP2957]
 gi|83726498|gb|EAP73629.1| Seryl-tRNA synthetase [Ralstonia solanacearum UW551]
 gi|206588831|emb|CAQ35793.1| seryl-trna synthetase protein [Ralstonia solanacearum MolK2]
 gi|299071098|emb|CBJ42409.1| serine tRNA synthetase; also charges selenocystein tRNA with serine
           [Ralstonia solanacearum CFBP2957]
          Length = 438

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 198/440 (45%), Positives = 272/440 (61%), Gaps = 19/440 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R  E       +L+ + + +  + E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDIDAVAARLNDRGYELDVAGFAALEAERKAIQTRTEELQARRNSLSKQIGM 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A+  E S + ++L     +   V + L+ L+  +PNVP E VP G    
Sbjct: 61  LKGKG--EDASAVMAEVSGIGDELKASAAQLDVVQTRLQDLLLSMPNVPHESVPAGKDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G   +     ++H ++G  LG +DFD A KLSG+RF+VL G +A L RAL Q
Sbjct: 119 QNVEVRREGTPRAFDFAVKDHVDLGAGLG-LDFDVAAKLSGSRFAVLKGPVARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD---------------G 225
           FM+D HT EHGYTE   P +V   +M GTGQ+PKF +D+F                    
Sbjct: 178 FMLDTHTQEHGYTETYVPYIVNAASMRGTGQLPKFEEDLFRVPRKMGQAAEGEAGEHVEN 237

Query: 226 RWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCE 285
            +LIPT+EV LTNL   EI+   +LP++F   +P FRSEAGS G+DTRGM+RQHQF K E
Sbjct: 238 FYLIPTAEVPLTNLVRDEIVSGDALPMKFAAHSPCFRSEAGSYGKDTRGMIRQHQFDKVE 297

Query: 286 LVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQN 345
           +V I   + SF   + M   AE IL++L+L +R V LCTGD+GF + KTYD+EVW+  QN
Sbjct: 298 MVQIVHPDTSFEALDTMTHHAENILRKLELPFRTVVLCTGDMGFGSTKTYDIEVWIPAQN 357

Query: 346 LYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADG 405
            YREISSCS  G+FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+A+LENY NADG
Sbjct: 358 TYREISSCSNMGDFQARRMQARFRNAQGK-PELLHTLNGSGLAVGRTLVAVLENYQNADG 416

Query: 406 SVTIPTVLRPYMNNLAVIKK 425
           SVT+P  LRPY+    V+K 
Sbjct: 417 SVTVPAALRPYLGGQDVLKP 436


>gi|169794926|ref|YP_001712719.1| seryl-tRNA synthetase [Acinetobacter baumannii AYE]
 gi|169147853|emb|CAM85716.1| seryl-tRNA synthetase ; also charges selenocystein tRNA with serine
           [Acinetobacter baumannii AYE]
          Length = 425

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 189/425 (44%), Positives = 265/425 (62%), Gaps = 5/425 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M+D + +R N E ++  L KR ++   +   SL+ + + L  K E ++A RN+ + Q+GQ
Sbjct: 3   MIDPKLLRNNIEVVNAGLAKRGVQLDVQEWASLETRRKDLQSKTEKLQAERNAGAKQVGQ 62

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G       +      + +++   E    E+ + +++    IPN+P E VP G   N
Sbjct: 63  IKKSGG--DASEIMARMQAIGDEIKAAEVALSELQNEIEQKALSIPNLPDESVPAGKDEN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I   G         ++H ++GE +G ++F+ ATKL+G+RFSVL G LA L+RAL Q
Sbjct: 121 DNVEISKWGTPRQFDFEIKDHTDLGEWMGGLEFETATKLTGSRFSVLKGPLARLQRALTQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT--DGRWLIPTSEVSLTN 238
           FM+D HT ++GYTE   P LV  +++ GTGQ+PKF +D+F        +LIPT+EV +TN
Sbjct: 181 FMLDTHTLKNGYTEAYVPYLVNADSLRGTGQLPKFEEDLFKLQGEKEYYLIPTAEVPVTN 240

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
               EII++  LPL++    P FRSEAGS GRDTRG++RQHQF K E+V I + E S   
Sbjct: 241 FVRDEIIDADRLPLKYAAHTPCFRSEAGSYGRDTRGLIRQHQFDKVEMVQIVKPETSMQA 300

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E + + AE IL+ L L YR + LC GD+GF A KTYDLEVW+  QN YREISSCS  G+
Sbjct: 301 LEELTAHAEGILQALGLPYRKILLCGGDMGFGATKTYDLEVWVPSQNTYREISSCSNMGD 360

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRM +RYR  + K  +  HTLNGSG+AVGR L+A++ENY   DGS+ IP VLRPYM 
Sbjct: 361 FQARRMKARYR-MDQKKTELVHTLNGSGLAVGRTLLAVMENYQREDGSIEIPEVLRPYMG 419

Query: 419 NLAVI 423
               I
Sbjct: 420 GATFI 424


>gi|251794129|ref|YP_003008860.1| seryl-tRNA synthetase [Paenibacillus sp. JDR-2]
 gi|247541755|gb|ACS98773.1| seryl-tRNA synthetase [Paenibacillus sp. JDR-2]
          Length = 427

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 189/428 (44%), Positives = 278/428 (64%), Gaps = 4/428 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQ-SEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++W+R   E ++ ALK R            LD K R L+ + ++++ RRN+ S ++ 
Sbjct: 1   MLDVKWLRNEYEQVEKALKNRSASLDLISGFPELDVKRRALLVETDNLKTRRNTVSQEVA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           +    G     +AL  E   + +++  L++E   V + +++L+  IPN+P E VP+G+S 
Sbjct: 61  KLKKSGG--DAEALIIEMREVGDRIKELDEEIRTVEAQVEELMLAIPNLPHESVPVGSSE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            +N+ IR  G++ +     + H+++ + LG++DF+RA K++G+RF+   G  A LERAL 
Sbjct: 119 EDNVEIRRNGEQTTFDFEPKAHWDLAQDLGILDFERAGKVTGSRFTFYRGLGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+DLH+ +HGY EV  P LV  +++ GTGQ+PKF +D+F  +D  +  IPT+EV +TN
Sbjct: 179 SFMMDLHSDQHGYEEVLPPYLVNRDSLIGTGQLPKFEEDLFKISDSDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L+  EI+  + LP  F   +  FRSEAG+AGRDTRG++RQHQF K EL+ + + E+S+ E
Sbjct: 239 LHREEILSIEELPKHFVAYSSCFRSEAGAAGRDTRGLIRQHQFNKVELIKLAKPEESYDE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E+M + AE++L+ L L YRV++LCTGD+GF+A KTYDLEVWL     YREISSCS   +
Sbjct: 299 LEKMTANAEKVLQLLGLPYRVLALCTGDMGFTAAKTYDLEVWLPSAGTYREISSCSNVED 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR   R+R       +F HTLNGSG+AVGR   AILENY  ADG++ +P VLRPYM 
Sbjct: 359 FQARRAGIRFRRDAKSKPEFVHTLNGSGLAVGRTFAAILENYQQADGTIVVPEVLRPYMG 418

Query: 419 NLAVIKKE 426
            L  I   
Sbjct: 419 GLEKISPR 426


>gi|184159299|ref|YP_001847638.1| seryl-tRNA synthetase [Acinetobacter baumannii ACICU]
 gi|332872559|ref|ZP_08440528.1| serine--tRNA ligase [Acinetobacter baumannii 6014059]
 gi|238690993|sp|B2HXU5|SYS_ACIBC RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|183210893|gb|ACC58291.1| Seryl-tRNA synthetase [Acinetobacter baumannii ACICU]
 gi|322509210|gb|ADX04664.1| seryl-tRNA synthetase [Acinetobacter baumannii 1656-2]
 gi|323519239|gb|ADX93620.1| seryl-tRNA synthetase [Acinetobacter baumannii TCDC-AB0715]
 gi|332739245|gb|EGJ70103.1| serine--tRNA ligase [Acinetobacter baumannii 6014059]
          Length = 423

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 190/425 (44%), Positives = 266/425 (62%), Gaps = 5/425 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M+D + +R N E ++ AL KR ++   +   SL+ + + L  K E ++A RN+ + Q+GQ
Sbjct: 1   MIDPKLLRNNIEVVNAALAKRGVQLDVQEWASLETRRKDLQSKTEKLQAERNAGAKQVGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G       +      + +++   E    E+ + +++    IPN+P E VP G   N
Sbjct: 61  IKKSGG--DASEIMARMQAIGDEIKAAEVALSELQNEIEQKALSIPNLPDESVPAGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I   G         ++H ++GE +G ++F+ ATKL+G+RFSVL G LA L+RAL Q
Sbjct: 119 DNVEISKWGTPRQFDFEIKDHTDLGEWMGGLEFETATKLTGSRFSVLKGPLARLQRALTQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT--DGRWLIPTSEVSLTN 238
           FM+D HT ++GYTE   P LV  +++ GTGQ+PKF +D+F        +LIPT+EV +TN
Sbjct: 179 FMLDTHTLKNGYTEAYVPYLVNADSLRGTGQLPKFEEDLFKLQGEKEYYLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
               EII++  LPL++    P FRSEAGS GRDTRG++RQHQF K E+V I + E S   
Sbjct: 239 FVRDEIIDADRLPLKYAAHTPCFRSEAGSYGRDTRGLIRQHQFDKVEMVQIVKPETSMQA 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E + + AE IL+ L L YR + LC GD+GF A KTYDLEVW+  QN YREISSCS  G+
Sbjct: 299 LEELTAHAEGILQALGLPYRKILLCGGDMGFGATKTYDLEVWVPSQNTYREISSCSNMGD 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRM +RYR  + K  +  HTLNGSG+AVGR L+A++ENY   DGS+ IP VLRPYM 
Sbjct: 359 FQARRMKARYR-MDQKKTELVHTLNGSGLAVGRTLLAVMENYQRKDGSIEIPEVLRPYMG 417

Query: 419 NLAVI 423
               I
Sbjct: 418 GATFI 422


>gi|152980660|ref|YP_001352847.1| seryl-tRNA synthetase [Janthinobacterium sp. Marseille]
 gi|166222735|sp|A6SX50|SYS_JANMA RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|151280737|gb|ABR89147.1| Seryl-tRNA synthetase [Janthinobacterium sp. Marseille]
          Length = 431

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 197/434 (45%), Positives = 271/434 (62%), Gaps = 12/434 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M+DIQ +R++ + +   L  R  +       +L+ + + +    ED++ +RN+ S QIG 
Sbjct: 1   MIDIQLLRKDIDSVAARLAGRKFKLDVAAFNALEAERKQIQSSTEDLQNKRNTLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A+  E + + ++L         V + + + +  IPN+P E VP+GT   
Sbjct: 61  LKGKG--EDTSAVMAEVAGIGDELKASAARLDIVQAKISEFMLSIPNLPHESVPVGTDEA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R VG   S     R+H ++G ALG +DFD A K++G+RFSV+ G +A L RAL Q
Sbjct: 119 GNVELRKVGTPRSFDFEIRDHVDVGAALG-LDFDVAAKITGSRFSVMKGGIARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT--------DGRWLIPTS 232
           FM+D HT+EHGYTE   P +V  +++ GTGQ+PKF  D+F           +  +LIPT+
Sbjct: 178 FMLDTHTAEHGYTECYTPYIVNADSLQGTGQLPKFEADLFAVKKGGQEGEGEALYLIPTA 237

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTN+   EI+   +LP+R T  +P FRSEAGS GRDTRGM+RQHQF K E+V +   
Sbjct: 238 EVPLTNIVRDEIVAGDALPIRMTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQVVHP 297

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           E S+   + M   AE ILK+L L YRV++LCTGD+GF A KTYDLEVWL  QN YREISS
Sbjct: 298 EKSYEALDEMCGHAENILKKLGLPYRVITLCTGDMGFGATKTYDLEVWLPAQNTYREISS 357

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
            S C  FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+A+LENY  ADGSVTIP V
Sbjct: 358 VSNCEAFQARRMQARFRNAQGK-PESVHTLNGSGLAVGRTLVAVLENYQQADGSVTIPEV 416

Query: 413 LRPYMNNLAVIKKE 426
           L PYM  L  +  +
Sbjct: 417 LHPYMGGLQRLTPQ 430


>gi|325123239|gb|ADY82762.1| seryl-tRNA synthetase [Acinetobacter calcoaceticus PHEA-2]
          Length = 423

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 189/425 (44%), Positives = 267/425 (62%), Gaps = 5/425 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M+D + +R N E ++ AL KR ++   +   SL+ + + L  K E ++A RN+ + Q+GQ
Sbjct: 1   MIDPKLLRNNIEAVNAALAKRGVQLDVQEWASLETRRKDLQSKTEKLQAERNAGAKQVGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G       +      + +++   E    E+ + +++    IPN+P E VP G   +
Sbjct: 61  IKKSGG--DASEIMARMQAIGDEIKAAEVALSELQNEIEQKALSIPNLPDESVPAGKDED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I   G         ++H ++GE +G ++F+ ATKL+G+RFSVL G LA L+RAL Q
Sbjct: 119 DNVEISKWGTPRQFDFEIKDHTDLGEWMGGLEFETATKLTGSRFSVLKGSLARLQRALTQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT--DGRWLIPTSEVSLTN 238
           FM+D HT ++GYTE   P LV  +++ GTGQ+PKF +D+F        +LIPT+EV +TN
Sbjct: 179 FMLDTHTLKNGYTEAYVPYLVNADSLRGTGQLPKFEEDLFKLQGEKEYYLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
               EII+++ LPL++    P FRSEAGS GRDTRG++RQHQF K E+V I + E S   
Sbjct: 239 FVRDEIIDTERLPLKYAAHTPCFRSEAGSYGRDTRGLIRQHQFDKVEMVQIVKPETSMQA 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E + + AE IL+ L L YR + LC GD+GF A KTYDLEVW+  QN YREISSCS  G+
Sbjct: 299 LEELTAHAEGILQALGLPYRKILLCGGDMGFGATKTYDLEVWVPSQNTYREISSCSNMGD 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRM +RYR  + K  +  HTLNGSG+AVGR L+A++ENY   DGS+ IP VLRPYM 
Sbjct: 359 FQARRMKARYR-MDQKKTELVHTLNGSGLAVGRTLLAVMENYQREDGSIEIPEVLRPYMG 417

Query: 419 NLAVI 423
               I
Sbjct: 418 GATFI 422


>gi|123441840|ref|YP_001005823.1| seryl-tRNA synthetase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|332162217|ref|YP_004298794.1| seryl-tRNA synthetase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|166223310|sp|A1JMG0|SYS_YERE8 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|122088801|emb|CAL11607.1| seryl-tRNA synthetase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318606280|emb|CBY27778.1| seryl-tRNA synthetase [Yersinia enterocolitica subsp. palearctica
           Y11]
 gi|325666447|gb|ADZ43091.1| seryl-tRNA synthetase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
          Length = 430

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 196/431 (45%), Positives = 266/431 (61%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R   + +   L +R  +   E +   +E+ ++L  + E ++A RNS S  IG 
Sbjct: 1   MLDPNMLRNELDAVAEKLARRGFKLDVEMLRQQEERRKVLQVETESLQAERNSRSKLIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E+L   + E  ++ + ++ L   IPN+P + VP+G   N
Sbjct: 61  AKARG--EDIEPLRLEVNELGEKLDAAKAELDKLQNEIRDLALSIPNLPDDSVPVGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G+        R+H  +GE  G +DF  A KL+GARF V+ G +A + RAL Q
Sbjct: 119 DNLEVSRWGEPRQYDFEVRDHVSLGEMAGGLDFAAAVKLTGARFVVMKGQIARMHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY E   P LV    +YGTGQ+PKF  D+F T             LIPT+
Sbjct: 179 FMLDLHTEKHGYLETYVPYLVNHATLYGTGQLPKFGGDLFHTKPLEEESDSSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV +TNL   EI+E +SLPL+ T   P FRSEAGS GRDTRG++R HQF K E+V ITR 
Sbjct: 239 EVPVTNLVRDEILEEESLPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQITRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E +   AE++L+ L+L YR + LCTGD+GF + KTYDLEVWL  QN YREISS
Sbjct: 299 EDSMAALEELTGHAEKVLQLLELPYRKMLLCTGDMGFGSSKTYDLEVWLPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQ+RRM +R R+   +  +  HTLNGSG+AVGR L+A+LENY  ADG + +P V
Sbjct: 359 CSNMWDFQARRMQARCRNKTDRKTRLVHTLNGSGLAVGRTLVAVLENYQQADGRIQVPEV 418

Query: 413 LRPYMNNLAVI 423
           LRPYM  L  I
Sbjct: 419 LRPYMGGLEFI 429


>gi|329123881|ref|ZP_08252435.1| serine--tRNA ligase [Haemophilus aegyptius ATCC 11116]
 gi|327468488|gb|EGF13969.1| serine--tRNA ligase [Haemophilus aegyptius ATCC 11116]
          Length = 429

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 192/431 (44%), Positives = 262/431 (60%), Gaps = 8/431 (1%)

Query: 1   MLDIQWIRQNPEHLDIALK-KRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           M+D   +R N   +   LK KR+    +E + +L+++ + L    E+++A RN+ S  IG
Sbjct: 1   MIDPNLLRNNLAEVAEKLKVKRNFMLDTEKLTALEDQRKNLQVTTENLQAERNARSKAIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
            A A G    +  L  E   +  QL   + +   V + + ++   IPN+P +EVP+G   
Sbjct: 61  AAKARGK--DIAPLLAEMDDIGNQLTEAKAQLDAVLAEINQIALSIPNLPADEVPLGKDD 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            EN  I   G   +     ++H  +G+    +DF    KL+GARF+V+ G +A + RAL 
Sbjct: 119 TENKEILRWGTPRTFDFEVKDHVTLGKEANGLDFAAGAKLTGARFAVMKGQIAKMHRALA 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-----TDGRWLIPTSEV 234
           QFM+DLHT +HGY E   P LV    +YGTGQ+PKF +D+F T          LIPT+EV
Sbjct: 179 QFMLDLHTEQHGYLETYVPYLVNHATLYGTGQLPKFGEDLFHTLALEGEQPYALIPTAEV 238

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            +TNL    II+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I   + 
Sbjct: 239 PVTNLVRDVIIDEAELPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVDPDK 298

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCS 354
           S    E +   AE++L+ L+L YR V LCTGD+GF +CKTYDLEVW+  QN YREISSCS
Sbjct: 299 SMEALEELTGHAEKVLQLLNLPYRKVLLCTGDMGFGSCKTYDLEVWVPAQNTYREISSCS 358

Query: 355 TCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR 414
              +FQ+RRM +R +    K  +  HTLNGSG+AVGR L+A+LENY NADGS+T+P VLR
Sbjct: 359 NMWDFQARRMQARCKAKGDKKTRLVHTLNGSGLAVGRTLVAVLENYQNADGSITVPEVLR 418

Query: 415 PYMNNLAVIKK 425
           PYM  L VI K
Sbjct: 419 PYMGGLDVIGK 429


>gi|229591232|ref|YP_002873351.1| seryl-tRNA synthetase [Pseudomonas fluorescens SBW25]
 gi|259511678|sp|C3JY54|SYS_PSEFS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|229363098|emb|CAY50099.1| serine tRNA synthetase [Pseudomonas fluorescens SBW25]
          Length = 426

 Score =  432 bits (1111), Expect = e-119,   Method: Composition-based stats.
 Identities = 195/428 (45%), Positives = 278/428 (64%), Gaps = 6/428 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R N + +   L  R        I +L+E+ + +  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRSNLQDVADRLASRGFALDVARIEALEEQRKTVQTRTEALQAERNARSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G    +  L  +   +  +L   + E  ++ S L  ++  IPN+P E VPIG   +
Sbjct: 61  AKQRG--EDIAPLMADVERMGTELSDGKVELEKIQSELDSILLGIPNLPHESVPIGEDED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G   +     ++H  +GE  G +DF+ A K+SGARF++L G +A + RAL Q
Sbjct: 119 GNVEVRRWGTPTAFDFEIKDHVALGELTGGLDFETAAKMSGARFALLRGPIARMHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG----RWLIPTSEVSL 236
           FMI+LHT+EHGY E   P LV+  A+ GT Q+PKF +D+F  +       +LIPT+EVSL
Sbjct: 179 FMINLHTAEHGYEEAYTPYLVQAPALMGTSQLPKFEEDLFKISRDGEADLYLIPTAEVSL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+ S EI+++K LPL+F   +P FRSEAG++GRDTRGM+RQHQF K E+V +     S 
Sbjct: 239 TNIVSGEILDAKQLPLKFVAHSPCFRSEAGASGRDTRGMIRQHQFDKVEMVQVVEPSTSM 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
              E + + AE +L+ L+L YRV++LCTGD+GFSA KTYDLEVW+  Q+ YREISSCS C
Sbjct: 299 EALEGLTANAERVLQLLELPYRVLALCTGDMGFSAVKTYDLEVWVPSQDKYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P VL+PY
Sbjct: 359 GDFQARRMQARFRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPEVLKPY 418

Query: 417 MNNLAVIK 424
           M  + VI+
Sbjct: 419 MAGVEVIR 426


>gi|301168770|emb|CBW28361.1| seryl-tRNA synthetase, also charges selenocysteinyl-tRNA with
           serine [Haemophilus influenzae 10810]
          Length = 429

 Score =  432 bits (1110), Expect = e-119,   Method: Composition-based stats.
 Identities = 193/431 (44%), Positives = 262/431 (60%), Gaps = 8/431 (1%)

Query: 1   MLDIQWIRQNPEHLDIALK-KRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           M+D   +R N   +   LK KR+    +E + +L+++ + L    E+++A RN+ S  IG
Sbjct: 1   MIDPNLLRNNLAEVAEKLKVKRNFMLDTEKLTALEDQRKNLQVTTENLQAERNARSKAIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
            A A G    +  L  E   +  QL   + +   V + + ++   IPN+P +EVP+G   
Sbjct: 61  AAKARG--EDIAPLLAEMDDMGNQLTEAKAQLDAVLAEINQIALSIPNLPADEVPLGKDD 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            EN  I   G   +     ++H  +GE    +DF    KL+GARF+V+ G +A + RAL 
Sbjct: 119 TENKEILCWGTPRTFDFEVKDHVTLGEEANGLDFAAGAKLTGARFAVMKGQIAKMHRALA 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT-----TDGRWLIPTSEV 234
           QFM+DLHT +HGY E   P LV    +YGTGQ+PKF +D+F T          LIPT+EV
Sbjct: 179 QFMLDLHTEQHGYLETYVPYLVNHATLYGTGQLPKFGEDLFHTLALQGEQPYALIPTAEV 238

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            +TNL    II+   LP++ T   P FRSEAGS GRDTRG++R HQF K E+V I   + 
Sbjct: 239 PVTNLVRDVIIDEAELPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVDPDK 298

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCS 354
           S    E +   AE++L+ L+L YR V LCTGD+GF +CKTYDLEVW+  QN YREISSCS
Sbjct: 299 SMEALEELTGHAEKVLQLLNLPYRKVLLCTGDMGFGSCKTYDLEVWVPAQNTYREISSCS 358

Query: 355 TCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR 414
              +FQ+RRM +R +    K  +  HTLNGSG+AVGR L+A+LENY NADGS+T+P VLR
Sbjct: 359 NMWDFQARRMQARCKAKGDKKTRLVHTLNGSGLAVGRTLVAVLENYQNADGSITVPEVLR 418

Query: 415 PYMNNLAVIKK 425
           PYM  L VI K
Sbjct: 419 PYMGGLDVIGK 429


>gi|260548984|ref|ZP_05823206.1| seryl-tRNA synthetase [Acinetobacter sp. RUH2624]
 gi|260408152|gb|EEX01623.1| seryl-tRNA synthetase [Acinetobacter sp. RUH2624]
          Length = 423

 Score =  432 bits (1110), Expect = e-119,   Method: Composition-based stats.
 Identities = 188/425 (44%), Positives = 266/425 (62%), Gaps = 5/425 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M+D + +R N E ++ AL KR ++   +   SL+ + + L  K E ++A RN+ + Q+GQ
Sbjct: 1   MIDPKLLRNNIEVVNAALAKRGVQLDVQEWASLETRRKDLQSKTEKLQAERNAGAKQVGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G       +      + +++   E    E+ + +++    IPN+P E VP G   +
Sbjct: 61  IKKSGG--DASKIMARMQAIGDEIKAAEVALSELQNEIEQKALSIPNLPDESVPAGKDES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I   G         ++H ++GE +G ++F+ ATKL+G+RFSVL G LA L+RAL Q
Sbjct: 119 DNVEISKWGTPRQFDFEIKDHTDLGEWMGGLEFETATKLTGSRFSVLKGPLARLQRALTQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT--DGRWLIPTSEVSLTN 238
           FM+D HT ++GYTE   P LV  +++ GTGQ+PKF +D+F        +LIPT+EV +TN
Sbjct: 179 FMLDTHTLKNGYTEAYVPYLVNADSLRGTGQLPKFEEDLFKLQGEKEYYLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
               EII++  LPL++    P FRSEAGS GRDTRG++RQHQF K E+V I + E S   
Sbjct: 239 FVRDEIIDADRLPLKYAAHTPCFRSEAGSYGRDTRGLIRQHQFDKVEMVQIVKPETSMQA 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E + + AE IL+ L L YR + LC GD+GF A KTYDLEVW+  QN YREISSCS  G+
Sbjct: 299 LEELTAHAEGILQALGLPYRKILLCGGDMGFGAMKTYDLEVWVPSQNTYREISSCSNMGD 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RRM +R+R  + K  +  HTLNGSG+AVGR L+A++ENY   DGS+ IP VLRPYM 
Sbjct: 359 FQARRMKARFR-MDQKKTELVHTLNGSGLAVGRTLLAVMENYQREDGSIEIPEVLRPYMG 417

Query: 419 NLAVI 423
               I
Sbjct: 418 GATFI 422


>gi|167825379|ref|ZP_02456850.1| seryl-tRNA synthetase [Burkholderia pseudomallei 9]
 gi|167895446|ref|ZP_02482848.1| seryl-tRNA synthetase [Burkholderia pseudomallei 7894]
 gi|167920072|ref|ZP_02507163.1| seryl-tRNA synthetase [Burkholderia pseudomallei BCC215]
 gi|226193869|ref|ZP_03789471.1| serine--tRNA ligase [Burkholderia pseudomallei Pakistan 9]
 gi|225934174|gb|EEH30159.1| serine--tRNA ligase [Burkholderia pseudomallei Pakistan 9]
          Length = 433

 Score =  432 bits (1110), Expect = e-119,   Method: Composition-based stats.
 Identities = 200/430 (46%), Positives = 274/430 (63%), Gaps = 11/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R +  + E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDLDGVAKRLADRGYPLDVAAFSALEAERRAIQTRTEELQARRNSLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G      A+  E   + +++     +  E+ + L +L+  +PNVP E VP+G    
Sbjct: 61  MK--GRSEDTSAVMAEVGGIGDEMKASAVKLDEIQARLSELMLEMPNVPHESVPVGRDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G         ++H ++G  LG +DF+   KLSGARF+VL G +A L RAL Q
Sbjct: 119 ENVEVRRWGAPRQFDFDVKDHVDVGTPLG-LDFETGAKLSGARFTVLRGPIARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM+D HT +HGY+E   P +V  + +YGTGQ+PKFA+DMF            ++LI TSE
Sbjct: 178 FMLDTHTQQHGYSETYTPYIVNPDVLYGTGQLPKFAEDMFRVEKGGAENTVTQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     I+E+ +LP++ T  +P FRSEAGS GRDTRGM+RQHQF K E+V I   E
Sbjct: 238 ISLTNTVRDSIVEASALPIKLTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQIVAPE 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   + M+  AE IL++L+L YRVV+LCTGD+GFSA KT+DLEVWL  QN YREISSC
Sbjct: 298 ASYAALDEMVGHAEAILQKLELPYRVVALCTGDMGFSAAKTFDLEVWLPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+A+LENY NADGSVT+P  L
Sbjct: 358 SNTESFQARRMQARFRNAQGK-PELVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPVAL 416

Query: 414 RPYMNNLAVI 423
           RPYM  +  I
Sbjct: 417 RPYMGGVERI 426


>gi|300690798|ref|YP_003751793.1| serine tRNA synthetase; also charges selenocystein tRNA with serine
           [Ralstonia solanacearum PSI07]
 gi|299077858|emb|CBJ50496.1| serine tRNA synthetase; also charges selenocystein tRNA with serine
           [Ralstonia solanacearum PSI07]
          Length = 438

 Score =  432 bits (1110), Expect = e-119,   Method: Composition-based stats.
 Identities = 199/440 (45%), Positives = 272/440 (61%), Gaps = 19/440 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R  +       +L+ + + +  + E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDIDAVAARLNDRGYDLDVAGFAALEAERKAIQTRTEELQARRNSLSKQIGM 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A+  E S + ++L     +   V + L+ L+  IPNVP E VP G    
Sbjct: 61  LKGKG--EDASAVMAEVSGIGDELKASAAQLDVVQAKLQDLLLSIPNVPHESVPAGKDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N  +R  G   +     ++H ++G ALG +DFD   KLSG+RF+VL G +A L RAL Q
Sbjct: 119 QNAEVRREGTPRTFDFPVKDHVDLGAALG-LDFDAGAKLSGSRFTVLKGQVARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD---------------G 225
           FM+D HT EHGYTE   P +V   +M GTGQ+PKF +D+F                    
Sbjct: 178 FMLDTHTQEHGYTEAYVPYIVNAASMRGTGQLPKFEEDLFRVPRKMGQTTESETGEHVEN 237

Query: 226 RWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCE 285
            +LIPT+EV LTNL   EI+   +LP++F   +P FRSEAGS G+DTRGM+RQHQF K E
Sbjct: 238 FYLIPTAEVPLTNLVRDEIVLGDALPMKFAAHSPCFRSEAGSYGKDTRGMIRQHQFDKVE 297

Query: 286 LVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQN 345
           +V I   + SF   + M   AE IL++L+L +R V LCTGD+GF + KTYD+EVW+  QN
Sbjct: 298 MVQIVHPDTSFDALDTMTHHAENILRKLELPFRTVVLCTGDMGFGSTKTYDIEVWIPAQN 357

Query: 346 LYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADG 405
            YREISSCS  G+FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+A+LENY NADG
Sbjct: 358 TYREISSCSNMGDFQARRMQARFRNAQGK-PELLHTLNGSGLAVGRTLVAVLENYQNADG 416

Query: 406 SVTIPTVLRPYMNNLAVIKK 425
           SVT+P VLRPY+    V+K 
Sbjct: 417 SVTVPAVLRPYLGGQDVLKP 436


>gi|126440240|ref|YP_001059999.1| seryl-tRNA synthetase [Burkholderia pseudomallei 668]
 gi|167903832|ref|ZP_02491037.1| seryl-tRNA synthetase [Burkholderia pseudomallei NCTC 13177]
 gi|254298870|ref|ZP_04966320.1| seryl-tRNA synthetase [Burkholderia pseudomallei 406e]
 gi|166201240|sp|A3NCC8|SYS_BURP6 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|126219733|gb|ABN83239.1| serine--tRNA ligase [Burkholderia pseudomallei 668]
 gi|157808968|gb|EDO86138.1| seryl-tRNA synthetase [Burkholderia pseudomallei 406e]
          Length = 433

 Score =  432 bits (1110), Expect = e-119,   Method: Composition-based stats.
 Identities = 201/430 (46%), Positives = 274/430 (63%), Gaps = 11/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R +  + E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDLDGVAKRLADRGYPLDVAAFSALEAERRAIQTRTEELQARRNSLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G      A+  E   + +++     +  E+ + L +L+  +PNVP E VP+G    
Sbjct: 61  MKGRG--EDTSAVMAEVGGIGDEMKASAVKLDEIQARLSELMLEMPNVPHESVPVGRDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G         ++H ++G  LG +DF+   KLSGARF+VL G +A L RAL Q
Sbjct: 119 ENVEVRRWGAPRQFDFDVKDHVDVGTPLG-LDFETGAKLSGARFTVLRGPIARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM+D HT +HGY+E   P +V  + +YGTGQ+PKFA+DMF            ++LI TSE
Sbjct: 178 FMLDTHTQQHGYSETYTPYIVNPDVLYGTGQLPKFAEDMFRVEKGGAENTVTQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     IIE+ +LP++ T  +P FRSEAGS GRDTRGM+RQHQF K E+V I   E
Sbjct: 238 ISLTNTVRDSIIEASALPIKLTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQIVAPE 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   + M+  AE IL++L+L YRVV+LCTGD+GFSA KT+DLEVWL  QN YREISSC
Sbjct: 298 ASYAALDEMVGHAEAILQKLELPYRVVALCTGDMGFSAAKTFDLEVWLPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+A+LENY NADGSVT+P  L
Sbjct: 358 SNTESFQARRMQARFRNAQGK-PELVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPVAL 416

Query: 414 RPYMNNLAVI 423
           RPYM  +  I
Sbjct: 417 RPYMGGVERI 426


>gi|238753493|ref|ZP_04614856.1| Seryl-tRNA synthetase [Yersinia ruckeri ATCC 29473]
 gi|238708446|gb|EEQ00801.1| Seryl-tRNA synthetase [Yersinia ruckeri ATCC 29473]
          Length = 431

 Score =  432 bits (1110), Expect = e-119,   Method: Composition-based stats.
 Identities = 193/431 (44%), Positives = 259/431 (60%), Gaps = 10/431 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R   + +   L +R  +   + + + + + ++L  + E ++A RNS S  IG 
Sbjct: 1   MLDPNMLRNELDAVAEKLARRGFKLDVDTLRAQEARRKVLQTETESLQAERNSRSKMIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E +TL ++L   + E   + + ++ L   IPN+P + VPIG   N
Sbjct: 61  AKARG--EDIEPLRLEVNTLGDKLDAAKAELETLQNEIRDLALSIPNLPDDSVPIGKDEN 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +   G+        R+H  +GE    +DF    KL+GARF V+ G +A + RAL Q
Sbjct: 119 DNLEVSRWGQPQQYDFDVRDHVSLGEMAAGLDFAAGVKLTGARFVVMKGQIARMHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY E   P LV    +YGTGQ+PKF  D+F T             LIPT+
Sbjct: 179 FMLDLHTEKHGYLETYVPYLVNHATLYGTGQLPKFGGDLFHTKPLDEESASSNYALIPTA 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV +TNL   EI+E +SLPL+ T   P FRSEAGS GRDTRG++R HQF K ELV I R 
Sbjct: 239 EVPVTNLVRDEILEEESLPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQIVRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E +   AE++L+ L L YR + LCTGD+GF + KTYDLEVWL  QN YREISS
Sbjct: 299 EDSTEALEELTGHAEKVLQLLGLPYRKMLLCTGDMGFGSRKTYDLEVWLPAQNTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS   +FQSRRM +R R       +  HTLNGSG+AVGR L+A+LENY  ADG + +P V
Sbjct: 359 CSNMWDFQSRRMQARCRSKTDNKPRLVHTLNGSGLAVGRTLVAVLENYQQADGRIKVPEV 418

Query: 413 LRPYMNNLAVI 423
           LR YM  L  I
Sbjct: 419 LRSYMGGLEFI 429


>gi|269214206|ref|ZP_05986067.2| serine--tRNA ligase [Neisseria lactamica ATCC 23970]
 gi|269210393|gb|EEZ76848.1| serine--tRNA ligase [Neisseria lactamica ATCC 23970]
          Length = 441

 Score =  432 bits (1110), Expect = e-119,   Method: Composition-based stats.
 Identities = 202/433 (46%), Positives = 276/433 (63%), Gaps = 9/433 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R N   +   L  R  E  +    +L+E+ + +  K E+++A RNS S QIG 
Sbjct: 11  MLDIQSLRSNTAAVAERLAARGYEFDAARFNALEEQRKAVQVKTEELQASRNSISKQIGA 70

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              +G      A  ++ + +K  L     +   V   L   +S IPN+P + VP G    
Sbjct: 71  LKGQGRHEEAQAAMDQVAQIKTDLEQAAADLDAVQKELDAWLSGIPNLPHKSVPAGKDET 130

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R VG         ++H ++GE LG +DF+   KLSGARF+V+ G +A L RAL Q
Sbjct: 131 ENVEVRRVGTPREFDFEIKDHVDLGEPLG-LDFEGGAKLSGARFTVMRGQIARLHRALAQ 189

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM+D HT EHGYTE   P +V    +YGTGQ+PKFA+D+F  T         ++LIPT+E
Sbjct: 190 FMLDTHTLEHGYTEHYTPYIVNGGTLYGTGQLPKFAEDLFHVTRGGDESKTAQYLIPTAE 249

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           V+LTN  +  II  + LPL+ T  +P FRSEAG+ G+D RG++RQHQF K E+V I   E
Sbjct: 250 VTLTNTVAGSIIPFEQLPLKLTAHSPCFRSEAGAYGKDVRGLIRQHQFDKVEMVQIVHPE 309

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   E M+  AE ILK L+L YRV++LCTGD+GF A KTYDLEVW+  QN YREISSC
Sbjct: 310 KSYGALEEMVGHAENILKALELPYRVITLCTGDMGFGAAKTYDLEVWVPAQNTYREISSC 369

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S C +FQ+RRM +R++D N K+ +  HTLNGSG+AVGR L+A+LEN+ NADGS+ IPT L
Sbjct: 370 SNCEDFQARRMKARFKDENGKN-RLVHTLNGSGLAVGRTLVAVLENHQNADGSINIPTAL 428

Query: 414 RPYMNNLAVIKKE 426
           +PYM  +A ++ +
Sbjct: 429 QPYMGGVAKLEVK 441


>gi|217973367|ref|YP_002358118.1| seryl-tRNA synthetase [Shewanella baltica OS223]
 gi|254783045|sp|B8EET7|SYS_SHEB2 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|217498502|gb|ACK46695.1| seryl-tRNA synthetase [Shewanella baltica OS223]
          Length = 428

 Score =  432 bits (1110), Expect = e-119,   Method: Composition-based stats.
 Identities = 200/429 (46%), Positives = 263/429 (61%), Gaps = 8/429 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD +++R   E     L  R       ++  L+EK ++L    E+++A RN+ S  IGQ
Sbjct: 1   MLDPKFLRNELEVTAERLATRGFILDIAHLTQLEEKRKLLQVATEELQASRNAISKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    V+A+  +   L  QL   + E   V   +  +   +PN+P E  PIG    
Sbjct: 61  AKARG--EDVEAIMAQVGDLGSQLDARKIELAAVLEEVNAIAMSMPNLPDESAPIGADET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G   +     ++H ++GE L  +DF  A K++G+RF V+ G +A L RA+GQ
Sbjct: 119 ENVEVRRWGTPRTFNFPIKDHIDLGEGLNGLDFKNAVKITGSRFIVMKGQVARLNRAIGQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG------RWLIPTSEV 234
           FM+DLHT EHGYTE   PLLV + ++ GTGQ+PKF +D+F T           LIPT+EV
Sbjct: 179 FMLDLHTIEHGYTEAYVPLLVNEASLLGTGQLPKFGEDLFHTKPATEEGQGLSLIPTAEV 238

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            LTNL    I++   LP++ T     FRSEAGS G+DTRG++RQHQF K E+V I + ED
Sbjct: 239 PLTNLVRDSIVDEDELPIKLTAHTACFRSEAGSYGKDTRGLIRQHQFDKVEMVQIVKPED 298

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCS 354
           S    E +   AE +L+RL L YR V LCTGD+GF + KTYD+EVWL  QN YREISSCS
Sbjct: 299 SMAALEALTGHAETVLQRLGLPYRTVILCTGDMGFGSSKTYDIEVWLPAQNTYREISSCS 358

Query: 355 TCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR 414
              +FQ+RRM +RYR          HTLNGSG+AVGR L+AILENY NADGS+TIP VLR
Sbjct: 359 NMKDFQARRMQARYRVKADNKPALLHTLNGSGLAVGRTLVAILENYQNADGSITIPEVLR 418

Query: 415 PYMNNLAVI 423
           PYM  L  I
Sbjct: 419 PYMGGLTQI 427


>gi|53720210|ref|YP_109196.1| seryl-tRNA synthetase [Burkholderia pseudomallei K96243]
 gi|53725981|ref|YP_103689.1| seryl-tRNA synthetase [Burkholderia mallei ATCC 23344]
 gi|67643953|ref|ZP_00442696.1| serine--tRNA ligase [Burkholderia mallei GB8 horse 4]
 gi|76811815|ref|YP_334445.1| seryl-tRNA synthetase [Burkholderia pseudomallei 1710b]
 gi|121599178|ref|YP_992139.1| seryl-tRNA synthetase [Burkholderia mallei SAVP1]
 gi|124384403|ref|YP_001028583.1| seryl-tRNA synthetase [Burkholderia mallei NCTC 10229]
 gi|126450411|ref|YP_001081518.1| seryl-tRNA synthetase [Burkholderia mallei NCTC 10247]
 gi|126454758|ref|YP_001067277.1| seryl-tRNA synthetase [Burkholderia pseudomallei 1106a]
 gi|134280315|ref|ZP_01767026.1| seryl-tRNA synthetase [Burkholderia pseudomallei 305]
 gi|166998315|ref|ZP_02264175.1| serine--tRNA ligase [Burkholderia mallei PRL-20]
 gi|167739749|ref|ZP_02412523.1| seryl-tRNA synthetase [Burkholderia pseudomallei 14]
 gi|167816969|ref|ZP_02448649.1| seryl-tRNA synthetase [Burkholderia pseudomallei 91]
 gi|167851461|ref|ZP_02476969.1| seryl-tRNA synthetase [Burkholderia pseudomallei B7210]
 gi|167912098|ref|ZP_02499189.1| seryl-tRNA synthetase [Burkholderia pseudomallei 112]
 gi|217420921|ref|ZP_03452426.1| serine--tRNA ligase [Burkholderia pseudomallei 576]
 gi|237813402|ref|YP_002897853.1| serine--tRNA ligase [Burkholderia pseudomallei MSHR346]
 gi|242317656|ref|ZP_04816672.1| serine--tRNA ligase [Burkholderia pseudomallei 1106b]
 gi|254175570|ref|ZP_04882230.1| seryl-tRNA synthetase [Burkholderia mallei ATCC 10399]
 gi|254181010|ref|ZP_04887608.1| seryl-tRNA synthetase [Burkholderia pseudomallei 1655]
 gi|254191854|ref|ZP_04898357.1| seryl-tRNA synthetase [Burkholderia pseudomallei Pasteur 52237]
 gi|254196127|ref|ZP_04902552.1| seryl-tRNA synthetase [Burkholderia pseudomallei S13]
 gi|254202385|ref|ZP_04908748.1| seryl-tRNA synthetase [Burkholderia mallei FMH]
 gi|254207717|ref|ZP_04914067.1| seryl-tRNA synthetase [Burkholderia mallei JHU]
 gi|254260671|ref|ZP_04951725.1| serine--tRNA ligase [Burkholderia pseudomallei 1710a]
 gi|254356383|ref|ZP_04972659.1| seryl-tRNA synthetase [Burkholderia mallei 2002721280]
 gi|67461699|sp|Q62HY1|SYS_BURMA RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|67461707|sp|Q63RS1|SYS_BURPS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|123598315|sp|Q3JPQ8|SYS_BURP1 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|166200607|sp|A3MMN2|SYS_BURM7 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|166201237|sp|A2S9G4|SYS_BURM9 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|166201238|sp|A1V1N6|SYS_BURMS RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|166201239|sp|A3NY56|SYS_BURP0 RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|52210624|emb|CAH36608.1| seryl-tRNA synthetase [Burkholderia pseudomallei K96243]
 gi|52429404|gb|AAU49997.1| seryl-tRNA synthetase [Burkholderia mallei ATCC 23344]
 gi|76581268|gb|ABA50743.1| seryl-tRNA synthetase [Burkholderia pseudomallei 1710b]
 gi|121227988|gb|ABM50506.1| seryl-tRNA synthetase [Burkholderia mallei SAVP1]
 gi|124292423|gb|ABN01692.1| serine--tRNA ligase [Burkholderia mallei NCTC 10229]
 gi|126228400|gb|ABN91940.1| seryl-tRNA synthetase [Burkholderia pseudomallei 1106a]
 gi|126243281|gb|ABO06374.1| serine--tRNA ligase [Burkholderia mallei NCTC 10247]
 gi|134248322|gb|EBA48405.1| seryl-tRNA synthetase [Burkholderia pseudomallei 305]
 gi|147746632|gb|EDK53709.1| seryl-tRNA synthetase [Burkholderia mallei FMH]
 gi|147751611|gb|EDK58678.1| seryl-tRNA synthetase [Burkholderia mallei JHU]
 gi|148025380|gb|EDK83534.1| seryl-tRNA synthetase [Burkholderia mallei 2002721280]
 gi|157939525|gb|EDO95195.1| seryl-tRNA synthetase [Burkholderia pseudomallei Pasteur 52237]
 gi|160696614|gb|EDP86584.1| seryl-tRNA synthetase [Burkholderia mallei ATCC 10399]
 gi|169652871|gb|EDS85564.1| seryl-tRNA synthetase [Burkholderia pseudomallei S13]
 gi|184211549|gb|EDU08592.1| seryl-tRNA synthetase [Burkholderia pseudomallei 1655]
 gi|217396333|gb|EEC36350.1| serine--tRNA ligase [Burkholderia pseudomallei 576]
 gi|237505314|gb|ACQ97632.1| serine--tRNA ligase [Burkholderia pseudomallei MSHR346]
 gi|238525426|gb|EEP88854.1| serine--tRNA ligase [Burkholderia mallei GB8 horse 4]
 gi|242140895|gb|EES27297.1| serine--tRNA ligase [Burkholderia pseudomallei 1106b]
 gi|243065387|gb|EES47573.1| serine--tRNA ligase [Burkholderia mallei PRL-20]
 gi|254219360|gb|EET08744.1| serine--tRNA ligase [Burkholderia pseudomallei 1710a]
          Length = 433

 Score =  432 bits (1110), Expect = e-119,   Method: Composition-based stats.
 Identities = 200/430 (46%), Positives = 274/430 (63%), Gaps = 11/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQ +R++ + +   L  R          +L+ + R +  + E+++ARRNS S QIG 
Sbjct: 1   MLDIQLLRKDLDGVAKRLADRGYPLDVAAFSALEAERRAIQTRTEELQARRNSLSKQIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G      A+  E   + +++     +  E+ + L +L+  +PNVP E VP+G    
Sbjct: 61  MKGRG--EDTSAVMAEVGGIGDEMKASAVKLDEIQARLSELMLEMPNVPHESVPVGRDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G         ++H ++G  LG +DF+   KLSGARF+VL G +A L RAL Q
Sbjct: 119 ENVEVRRWGAPRQFDFDVKDHVDVGTPLG-LDFETGAKLSGARFTVLRGPIARLHRALAQ 177

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-------GRWLIPTSE 233
           FM+D HT +HGY+E   P +V  + +YGTGQ+PKFA+DMF            ++LI TSE
Sbjct: 178 FMLDTHTQQHGYSETYTPYIVNPDVLYGTGQLPKFAEDMFRVEKGGAENTVTQYLISTSE 237

Query: 234 VSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREE 293
           +SLTN     I+E+ +LP++ T  +P FRSEAGS GRDTRGM+RQHQF K E+V I   E
Sbjct: 238 ISLTNTVRDSIVEASALPIKLTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQIVAPE 297

Query: 294 DSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSC 353
            S+   + M+  AE IL++L+L YRVV+LCTGD+GFSA KT+DLEVWL  QN YREISSC
Sbjct: 298 ASYAALDEMVGHAEAILQKLELPYRVVALCTGDMGFSAAKTFDLEVWLPAQNTYREISSC 357

Query: 354 STCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVL 413
           S   +FQ+RRM +R+R+   K  +  HTLNGSG+AVGR L+A+LENY NADGSVT+P  L
Sbjct: 358 SNTESFQARRMQARFRNAQGK-PELVHTLNGSGLAVGRTLVAVLENYQNADGSVTVPVAL 416

Query: 414 RPYMNNLAVI 423
           RPYM  +  I
Sbjct: 417 RPYMGGVERI 426


>gi|330889681|gb|EGH22342.1| seryl-tRNA synthetase [Pseudomonas syringae pv. mori str. 301020]
          Length = 426

 Score =  432 bits (1110), Expect = e-119,   Method: Composition-based stats.
 Identities = 198/427 (46%), Positives = 272/427 (63%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R        I SL+ + +++  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRTQLQDVADRLASRGFTLDVARIESLEAQRKVVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G    +  L  +   +  +L   + E   + + L  L+  IPN+P E VP+G    
Sbjct: 61  AKQRG--EDIAPLMADVERMGNELSEGKVELDGIQAELDALVLSIPNLPHESVPVGADEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G   +     ++H  +GE  G +DF+ A KLSGARF++L G +A L RAL Q
Sbjct: 119 GNVEVRRWGTPTAFDFEVKDHVALGEKFGWLDFETAAKLSGARFALLRGPIARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD----GRWLIPTSEVSL 236
           FMI+LH +EHGY E   P LV+  A+ GTGQ+PKF +D+F  T       +LIPT+EVSL
Sbjct: 179 FMINLHINEHGYEETYTPYLVQAPALQGTGQLPKFEEDLFKITREGEADLYLIPTAEVSL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+ S EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I   EDS 
Sbjct: 239 TNIVSGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVAPEDSM 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
              E +   AE +L+ L+  YR ++LCTGD+GFSA KTYDLEVW+  Q+ YREISSCS C
Sbjct: 299 AALESLTGNAERVLQLLEPPYRTLALCTGDMGFSAVKTYDLEVWIPSQDKYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P VL+PY
Sbjct: 359 GDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPEVLKPY 418

Query: 417 MNNLAVI 423
           M  L VI
Sbjct: 419 MGGLEVI 425


>gi|157962050|ref|YP_001502084.1| seryl-tRNA synthetase [Shewanella pealeana ATCC 700345]
 gi|189083587|sp|A8H4R2|SYS_SHEPA RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|157847050|gb|ABV87549.1| seryl-tRNA synthetase [Shewanella pealeana ATCC 700345]
          Length = 428

 Score =  432 bits (1110), Expect = e-119,   Method: Composition-based stats.
 Identities = 194/429 (45%), Positives = 265/429 (61%), Gaps = 8/429 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD +++R   E     L  R      E +  L+E  + L    E+++A RN+ S  IGQ
Sbjct: 1   MLDPKFLRSELEMTAERLATRGFILDVERLSKLEETRKSLQVATEELQASRNAISKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A+G    V  +  +  +L E+L   + E   +   L  +   +PN+P E VP G   +
Sbjct: 61  AKAKG--EDVAPIMAQVGSLGEELDAKKTELAALLEELNAIAMSVPNLPDESVPTGADES 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +R  G         ++H E+GE +G +DF  A K++G+RF V+ G +A + RAL Q
Sbjct: 119 ENVEVRRWGTPKEFDFAVKDHVELGENIGGLDFKNAVKITGSRFIVMKGQIARMHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG------RWLIPTSEV 234
           FM+DLHT+EHGYTE   PLLV ++++ GTGQ+PKF +D+F T           LIPT+EV
Sbjct: 179 FMLDLHTTEHGYTEAYVPLLVNEDSLLGTGQLPKFGEDLFHTKPATEEGQGLSLIPTAEV 238

Query: 235 SLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREED 294
            LTNL    I+E  +LP++ T   P FRSEAGS GRDTRG++RQHQF K E+V + + ED
Sbjct: 239 PLTNLVRDTIVEEDNLPIKLTAHTPCFRSEAGSYGRDTRGLIRQHQFDKVEMVQLVKPED 298

Query: 295 SFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCS 354
           S    E +   AE +L++L L YR + LCTGD+GF + KTYD+EVWL  Q+ YREISSCS
Sbjct: 299 SMQALEDLTGHAEVVLQKLGLPYRTMVLCTGDMGFGSAKTYDIEVWLPAQDTYREISSCS 358

Query: 355 TCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLR 414
              +FQ+RRM +RY+    K     HTLNGSG+AVGR L+A+LENY NADGS+T+P  LR
Sbjct: 359 NMQDFQARRMQARYKGKTDKKPSLLHTLNGSGLAVGRTLVAVLENYQNADGSITVPEALR 418

Query: 415 PYMNNLAVI 423
            YM  L  I
Sbjct: 419 GYMGGLKKI 427


>gi|323705874|ref|ZP_08117446.1| seryl-tRNA synthetase [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534870|gb|EGB24649.1| seryl-tRNA synthetase [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 423

 Score =  432 bits (1110), Expect = e-119,   Method: Composition-based stats.
 Identities = 198/426 (46%), Positives = 271/426 (63%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+ IR NP+ +  A++ +      +  L +DEK R ++K++E ++  RN  S  I +
Sbjct: 1   MLDIKRIRNNPDEVKKAIELKKENSNIDEFLEIDEKRREILKELESLKNTRNKESENIAK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
              EG     D L  E   + +++  +E E  +    L++L+  IPN+P E VP+G S  
Sbjct: 61  LKKEGK--DADELIKEMKEISDKIKAMESEVKQYDEKLEELLWTIPNIPHESVPVGDSDA 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ IR  G         + H++IG  LGL+DF+ A++++G+RF+   G    LERAL  
Sbjct: 119 DNVEIRRWGDVREFDFEVKPHWDIGVELGLLDFEAASRVTGSRFTFYKGLGCRLERALIN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTNL 239
           FM+DLHT +HGYTEV  P +V   +M+GTGQ+PKF +D F      +  IPT+EV +TN+
Sbjct: 179 FMMDLHTEKHGYTEVFPPFMVHRRSMFGTGQLPKFEEDAFKVAGTDYFLIPTAEVPVTNM 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           Y   II+S+ LP+     +  FR EAGSAGRDTRG++RQHQF K ELV IT  E S+ E 
Sbjct: 239 YRETIIDSEKLPIYNCAYSACFRQEAGSAGRDTRGLIRQHQFNKVELVKITEPEKSYEEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E+M+S AE++LK L + YRVVS+CTGDLGF+A K YDLEVW+     Y EISSCS C +F
Sbjct: 299 EKMVSDAEDVLKTLGIPYRVVSICTGDLGFTAAKKYDLEVWMPSYGRYVEISSCSNCEDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N +YR  +    ++ HTLNGSGVAVGR   AILENY   DGSV +P  LRPYM  
Sbjct: 359 QARRANIKYRPKDGGKAQYVHTLNGSGVAVGRTFAAILENYQQKDGSVVVPEALRPYMR- 417

Query: 420 LAVIKK 425
             VI+K
Sbjct: 418 CDVIRK 423


>gi|56418548|ref|YP_145866.1| seryl-tRNA synthetase [Geobacillus kaustophilus HTA426]
 gi|67461631|sp|Q5L3Y0|SYS_GEOKA RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|56378390|dbj|BAD74298.1| seryl-tRNA synthetase [Geobacillus kaustophilus HTA426]
          Length = 424

 Score =  432 bits (1110), Expect = e-119,   Method: Composition-based stats.
 Identities = 193/426 (45%), Positives = 267/426 (62%), Gaps = 4/426 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEP-QSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ +R   E +   L +R  +    +    LD+  R LI ++E+++++RN  S QI 
Sbjct: 1   MLDVKILRTQFEEVKEKLMQRGGDLTNIDRFEQLDKDRRRLIAEVEELKSKRNDVSQQIA 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
               E      + L  +   + +++  ++++  ++ + L  L+  IPNVP E VPIG S 
Sbjct: 61  VLKREKK--DAEPLIAQMREVGDRIKRMDEQIRQLEAELDDLLLSIPNVPHESVPIGQSE 118

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
            +N+ +R  G+  S     + H+EI + LGL+DF+RA K++G+RF    G  A LERAL 
Sbjct: 119 EDNVEVRRWGEPRSFSFEPKPHWEIADRLGLLDFERAAKVAGSRFVFYKGLGARLERALI 178

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWL-IPTSEVSLTN 238
            FM+D+H  E GY EV  P LV   +M GTGQ+PKFA+D F      +  IPT+EV +TN
Sbjct: 179 NFMLDIHLDEFGYEEVLPPYLVNRASMIGTGQLPKFAEDAFHLDSEDYFLIPTAEVPVTN 238

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
           L+  EI+ +  LP+ +   +  FR+EAGSAGRDTRG++RQHQF K ELV   + EDS+ E
Sbjct: 239 LHRDEILAADDLPIYYAAYSACFRAEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYDE 298

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E++   AE IL+RL L YRVV+LCTGDLGFSA KTYD+EVWL     YREISSCS    
Sbjct: 299 LEKLTRQAETILQRLGLPYRVVALCTGDLGFSAAKTYDIEVWLPSYGTYREISSCSNFEA 358

Query: 359 FQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMN 418
           FQ+RR N R+R       ++ HTLNGSG+A+GR + AILENY   DGSV +P  LRPYM 
Sbjct: 359 FQARRANIRFRRDPKAKPEYVHTLNGSGLAIGRTVAAILENYQQEDGSVIVPEALRPYMG 418

Query: 419 NLAVIK 424
           N  VI+
Sbjct: 419 NRDVIR 424


>gi|269216691|ref|ZP_06160545.1| serine--tRNA ligase [Slackia exigua ATCC 700122]
 gi|269129925|gb|EEZ61008.1| serine--tRNA ligase [Slackia exigua ATCC 700122]
          Length = 426

 Score =  432 bits (1110), Expect = e-119,   Method: Composition-based stats.
 Identities = 194/427 (45%), Positives = 271/427 (63%), Gaps = 2/427 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+++R++ + +  A+K R+    S+    LDE  R  I + E ++ARRN+ S +IG+
Sbjct: 1   MLDIKFVREHQDVVAQAMKNRNGSWDSDAFNELDESRRSFISEEEGLQARRNAASKEIGR 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
            + EG     +A K     + E++     +  E   +L +L+S +PN+P +  P+G    
Sbjct: 61  LMREGKNEEAEAAKESVRVINEKIAEASAKRDEAERALTELLSHVPNLPSDTTPVGKDET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN  IR  G         + H+++G  LG++DF+R  KL+G RF +L G  A LERAL  
Sbjct: 121 ENPEIRRWGTPTEFDFERKAHWDLGPELGILDFERGVKLAGTRFVLLGGLGARLERALIN 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMID H    GY E   P +     ++GTGQ+PKF DD+F T +G +LIPT+EV LTN++
Sbjct: 181 FMIDTHI-SRGYKEWWPPAMANATTLFGTGQLPKFEDDLFKTREGMYLIPTAEVQLTNIH 239

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + E++++  LPL++    P FR EAGSAGRDTRG++R HQF K E+V     ED F + E
Sbjct: 240 AQEVLDASDLPLKYCAFTPCFREEAGSAGRDTRGLIRVHQFDKVEMVKFATPEDGFNQLE 299

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
            M + AE ILK L L +RV+SLCTGDLGFSA KTYDLEVWL   + Y+EISSCS C +FQ
Sbjct: 300 LMTADAENILKLLGLPHRVISLCTGDLGFSAAKTYDLEVWLPSYDGYKEISSCSCCTDFQ 359

Query: 361 SRRMNSRYRDPNS-KSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           +RR + +YRD  S K  ++ +TLNGSG+AVGR + A++ENY   DGSV +P VL PYM  
Sbjct: 360 ARRADIKYRDAASFKGTRYAYTLNGSGLAVGRTMAAVIENYQQPDGSVKVPDVLVPYMGG 419

Query: 420 LAVIKKE 426
           +  IK E
Sbjct: 420 VECIKPE 426


>gi|254491288|ref|ZP_05104469.1| seryl-tRNA synthetase [Methylophaga thiooxidans DMS010]
 gi|224463801|gb|EEF80069.1| seryl-tRNA synthetase [Methylophaga thiooxydans DMS010]
          Length = 424

 Score =  432 bits (1110), Expect = e-119,   Method: Composition-based stats.
 Identities = 190/424 (44%), Positives = 264/424 (62%), Gaps = 3/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   E +   L +R  +   + +  L+++ +      ++++  RNS S  IG+
Sbjct: 1   MLDPKLLRNEAETVAKELARRGFQLDIQQLAQLEQERKKAQLNAQELQTERNSRSKNIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    +  L  E   L ++    E + + V   +  +   IPN+P  +VP G    
Sbjct: 61  AKAAG--EDIAPLLKEIEDLGDRHKAAEVQLNAVLEKINDIAMGIPNLPQADVPAGKDET 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N  +   G+        ++H ++G +L  MDF+ A K+S ARF  L+G LA L+RAL Q
Sbjct: 119 DNREVTRWGEPRQFDFEPKDHVDLGASLNGMDFETAAKISAARFVTLSGPLAKLQRALTQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-GRWLIPTSEVSLTNL 239
           FM+D H+ +HGYTE   P LV  +++ GTGQ+PKF +D+F   D   +LIPT+EV +TN+
Sbjct: 179 FMLDTHSEQHGYTETYVPYLVNADSLRGTGQLPKFEEDLFKVDDGQFYLIPTAEVPVTNI 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
               I E+  LPLRF    P FRSEAGS GRD RG++RQHQF K ELV I R +DS   H
Sbjct: 239 VRDTISENTELPLRFVAHTPCFRSEAGSHGRDVRGLIRQHQFEKVELVQIVRPQDSAAAH 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E + + AE+IL+ L+L YR V+LCTGDLGFS+ KTYDLEVWL  QN YREISSCS  G+F
Sbjct: 299 EELTAHAEKILQLLELPYRKVNLCTGDLGFSSTKTYDLEVWLPSQNTYREISSCSNFGDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR+ +R+R+P +   +  HTLNGSG+AVGR L+A+LEN+  ADGSV IP  L+PYM  
Sbjct: 359 QARRLQARWRNPETGKPELVHTLNGSGLAVGRTLLAVLENHQQADGSVVIPEALQPYMGG 418

Query: 420 LAVI 423
              I
Sbjct: 419 QEKI 422


>gi|300716073|ref|YP_003740876.1| Seryl-tRNA synthetase [Erwinia billingiae Eb661]
 gi|299061909|emb|CAX59025.1| Seryl-tRNA synthetase [Erwinia billingiae Eb661]
          Length = 430

 Score =  432 bits (1110), Expect = e-119,   Method: Composition-based stats.
 Identities = 199/430 (46%), Positives = 275/430 (63%), Gaps = 10/430 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD   +R  P+ +   L +R  +   + + S +E+ ++L  + E ++A RNS S  IGQ
Sbjct: 1   MLDPNLLRNEPDAVAEKLARRGYKLDVDTLRSQEERRKVLQVETETLQAERNSRSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G    ++ L+ E + L E L   + E  E+ ++++++ S IPN+P++EVP+G   +
Sbjct: 61  AKARG--EDIEPLRQEVNALGESLDAAKAELDELLNAIREMASAIPNIPVDEVPLGKDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN+ +   G         R+H E+GE    +DF    KL+G+RF V+ G +A + RAL Q
Sbjct: 119 ENLEVSRWGTPREFDFAVRDHVELGEMASGLDFAMGAKLTGSRFVVMQGQIALMHRALSQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--------GRWLIPTS 232
           FM+DLHT +HGY E   P LV   +++GTGQ+PKF +D+F T             LIPTS
Sbjct: 179 FMLDLHTEQHGYLETYVPYLVNHASLHGTGQLPKFGEDLFHTRPLEEEASSSDYALIPTS 238

Query: 233 EVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITRE 292
           EV LTN+   EI+E +SLPL+FT   P FRSEAG+ GRDTRG++R HQF K E+V ITR 
Sbjct: 239 EVPLTNMVRDEILEEESLPLKFTAHTPCFRSEAGAYGRDTRGLIRMHQFDKVEMVHITRP 298

Query: 293 EDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISS 352
           EDS    E ++  AE++L+ L+L YR V LCTGD+GF +CKTYDLEVWL  Q+ YREISS
Sbjct: 299 EDSMDALEELVGHAEKVLQLLELPYRKVLLCTGDMGFGSCKTYDLEVWLPAQDTYREISS 358

Query: 353 CSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTV 412
           CS  G+FQ+RRM +R R    K  +  HTLNGSG+AVGR L+A+LENY  ADG + +P V
Sbjct: 359 CSNMGDFQARRMQARCRPKTEKKTRLVHTLNGSGLAVGRTLVAVLENYQQADGRIAVPEV 418

Query: 413 LRPYMNNLAV 422
           L+PYM  L  
Sbjct: 419 LKPYMKGLEF 428


>gi|300022787|ref|YP_003755398.1| seryl-tRNA synthetase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299524608|gb|ADJ23077.1| seryl-tRNA synthetase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 462

 Score =  431 bits (1109), Expect = e-119,   Method: Composition-based stats.
 Identities = 227/458 (49%), Positives = 294/458 (64%), Gaps = 34/458 (7%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+WIR N +  D +L++R L PQ+  +++LD+K R  +  ++D ++RRN+ S +IG+
Sbjct: 1   MFDIKWIRDNADAFDASLQRRGLAPQAAALVALDDKRRATLTALQDAQSRRNAASKEIGK 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A    + +    L  E + LK+ +   E +E ++ + +K  +  IPN+P  +VP G    
Sbjct: 61  AKGAKDEATAARLMAEVADLKDTIARGEDDERKLDAEIKAALEVIPNLPRADVPDGADET 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R VG         ++HFEIGEALGLMDF+ A K+SGARF VL G LA LERAL  
Sbjct: 121 GNVEVRRVGTPARLDFTPKQHFEIGEALGLMDFEAAQKISGARFVVLKGALARLERALAS 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCT------------------ 222
           FM+DLHTSE GYTEV+ P+LVR EAM+GT Q+PKF  D F                    
Sbjct: 181 FMLDLHTSEFGYTEVNPPILVRREAMFGTAQLPKFEIDQFWALSGIQFFDMGEIEKRSAS 240

Query: 223 ----------------TDGRWLIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAG 266
                              + LIPT+EV LTNL   +II+   LP+R T   P FRSEAG
Sbjct: 241 KTDPQIAFQIAREAALEAAKGLIPTAEVPLTNLVREQIIDEAQLPMRVTAWTPCFRSEAG 300

Query: 267 SAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGD 326
           +AG+DTRGM+RQHQF K ELVSIT  + S  EHERM SCAEE+LKRL L +R + LCTGD
Sbjct: 301 AAGKDTRGMIRQHQFSKVELVSITTPDASLDEHERMTSCAEEVLKRLGLPFRTIVLCTGD 360

Query: 327 LGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSG 386
           +GF++ KTYD+EVWL GQN YREISSCS CG+FQ+RRM++R+R  +     + HTLNGSG
Sbjct: 361 MGFASQKTYDIEVWLPGQNAYREISSCSVCGDFQARRMDARFRPKDGGKPVYVHTLNGSG 420

Query: 387 VAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVIK 424
           +AVGR LIA+LENY  ADGSV IP  LRPYM  L  I 
Sbjct: 421 LAVGRTLIAVLENYQQADGSVIIPDALRPYMGGLTKIT 458


>gi|188583939|ref|YP_001927384.1| seryl-tRNA synthetase [Methylobacterium populi BJ001]
 gi|238692895|sp|B1ZJ12|SYS_METPB RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|179347437|gb|ACB82849.1| seryl-tRNA synthetase [Methylobacterium populi BJ001]
          Length = 428

 Score =  431 bits (1109), Expect = e-119,   Method: Composition-based stats.
 Identities = 236/424 (55%), Positives = 298/424 (70%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR+NPE  D  L++R L P S  +++LD+  +  +   +  + RRN+ S +IG 
Sbjct: 1   MHDIRAIRENPEAFDRDLERRGLSPLSAELIALDDARKGAVSAAQAAQERRNALSKEIGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A    + +    L  E + LKE+ P L+  + +    L + ++ IPN P  +VP+G   +
Sbjct: 61  AKKAKDEARAAELMAEVARLKEEAPGLDAAQAQAAKVLDERLAAIPNQPKADVPLGADEH 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+  R      + +   R+HFE+GEA GLMDF+ A KLSG+RF VL G LA LERALGQ
Sbjct: 121 GNVEYRRFDSSRARLAEGRQHFELGEATGLMDFEAAAKLSGSRFVVLKGPLARLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLHT EHGYTEV  P+LVRDEAM+GT Q+PKF DD F   DG WLIPT+EV LTNL 
Sbjct: 181 FMLDLHTGEHGYTEVVPPVLVRDEAMFGTAQLPKFRDDQFAAGDGFWLIPTAEVPLTNLV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
              I+    LPLRFT L P FR+EAG+AGRDTRGMLRQHQF K ELVSIT  E S  EHE
Sbjct: 241 RENILAEDELPLRFTALTPCFRAEAGAAGRDTRGMLRQHQFNKVELVSITAPEKSAEEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RML+CAE +L++LDL YRV++LCTGD+GF++ KTYD+EVW+ GQ  YREISSCS CG FQ
Sbjct: 301 RMLACAEAVLQKLDLTYRVMTLCTGDMGFASQKTYDIEVWVPGQQTYREISSCSVCGEFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+RYR    + + F HTLNGSGVAVGR LIA++ENY N DGSVTIP+VL+PYM  L
Sbjct: 361 ARRMNARYRAKEGRGVGFVHTLNGSGVAVGRALIAVMENYQNPDGSVTIPSVLQPYMGGL 420

Query: 421 AVIK 424
             I+
Sbjct: 421 NRIE 424


>gi|84517344|ref|ZP_01004698.1| seryl-tRNA synthetase [Loktanella vestfoldensis SKA53]
 gi|84508824|gb|EAQ05287.1| seryl-tRNA synthetase [Loktanella vestfoldensis SKA53]
          Length = 430

 Score =  431 bits (1109), Expect = e-119,   Method: Composition-based stats.
 Identities = 205/430 (47%), Positives = 269/430 (62%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M DI+ IR  P+  D AL +R L P +  IL LDE  R LI   E  +A  N  S  +G 
Sbjct: 1   MHDIRSIRDTPDAFDTALSRRGLAPVAATILDLDEARRKLILAAETAQAEANKASKDVGA 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A A G+ +  D L+   +  K ++  +  E      +L  L++ +PN+P   +P G    
Sbjct: 61  AKARGDDAEFDRLRGLIADSKSRIAAMNDEAKAKDQALSDLLATLPNLPDPSIPDGKDEA 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ IR  G          EH++I      MDF+ A KLSG+RF +L+G +A L RAL Q
Sbjct: 121 DNVEIRRHGTPRIFSFAPVEHYDIAGIKQGMDFETAAKLSGSRFVLLSGAVARLHRALAQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FM+DLH  EHG TE   P++VR++ MYGTGQ+PKF +D + TT+G WLIPT+EV+LTN+ 
Sbjct: 181 FMLDLHVEEHGLTETITPVMVREDMMYGTGQLPKFGEDSYQTTNGWWLIPTAEVTLTNIV 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           + E ++  +LP R       FRSEAGSAGRDT GMLRQHQF K E+VSIT    S  EH+
Sbjct: 241 NGETVDESTLPRRHVAHTLCFRSEAGSAGRDTSGMLRQHQFEKVEMVSITTPNQSAAEHD 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RM  CA+ +L+RL L YR V LC GD+G  A KT+D+EVWL GQN YREISS S CG++Q
Sbjct: 301 RMTQCAQTVLERLGLPYRTVVLCAGDMGAGATKTHDIEVWLPGQNTYREISSVSVCGDYQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           +RRMN+R+R       +F HTLNGSG+AVGR LIA++EN    DGSV +P  L PY+   
Sbjct: 361 ARRMNARFRPAGGGKPEFVHTLNGSGLAVGRTLIAVVENGQQEDGSVDLPAALHPYLGGK 420

Query: 421 AVIKKEHILE 430
             I  E +LE
Sbjct: 421 TRITAEGMLE 430


>gi|28870509|ref|NP_793128.1| seryl-tRNA synthetase [Pseudomonas syringae pv. tomato str. DC3000]
 gi|38258311|sp|Q87ZS9|SYS_PSESM RecName: Full=Seryl-tRNA synthetase; AltName: Full=Serine--tRNA
           ligase; Short=SerRS; AltName: Full=Seryl-tRNA(Ser/Sec)
           synthetase
 gi|28853757|gb|AAO56823.1| seryl-tRNA synthetase [Pseudomonas syringae pv. tomato str. DC3000]
          Length = 426

 Score =  431 bits (1109), Expect = e-119,   Method: Composition-based stats.
 Identities = 197/427 (46%), Positives = 273/427 (63%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R        I SL+ + +++  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRTQLQDVADRLASRGFTLDVARIESLEAQRKVVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G    +  L  +   +  +L   + E   + + L  L+  IPN+P E VP+G    
Sbjct: 61  AKQRG--EDIAPLMADVERMGNELSEGKVELDAIQAELDALVLNIPNLPHESVPVGADEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G   +     ++H  +GE  G +DF+ A KLSGARF++L G +A L RAL Q
Sbjct: 119 GNVEVRRWGTPTAFGFEVKDHVALGEKFGWLDFETAAKLSGARFALLRGPIARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD----GRWLIPTSEVSL 236
           FMI+LH +EHGY E   P LV+  A+ GTGQ+PKF +D+F  +       +LIPT+EVSL
Sbjct: 179 FMINLHINEHGYEETYTPYLVQAPALQGTGQLPKFEEDLFKISREGEADLYLIPTAEVSL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+ S EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I   +DS 
Sbjct: 239 TNIVSGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVAPDDSM 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
              E +   AE +L+ L+L YR ++LCTGD+GFSA KTYDLEVW+  Q+ YREISSCS C
Sbjct: 299 AALESLTGNAERVLQLLELPYRTLALCTGDMGFSAVKTYDLEVWIPSQDKYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P VL+PY
Sbjct: 359 GDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPEVLKPY 418

Query: 417 MNNLAVI 423
           M  L VI
Sbjct: 419 MGGLEVI 425


>gi|330958183|gb|EGH58443.1| seryl-tRNA synthetase [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 426

 Score =  431 bits (1109), Expect = e-119,   Method: Composition-based stats.
 Identities = 195/427 (45%), Positives = 272/427 (63%), Gaps = 6/427 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD + +R   + +   L  R        I +L+ + +++  + E ++A RN+ S  IGQ
Sbjct: 1   MLDSKLLRTQLQDVADRLASRGFTLDVARIEALEAQRKVVQTRTEQLQAERNARSKSIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A   G    +  L  +   +  +L   + E   + + L  L+  IPN+P E VP+G    
Sbjct: 61  AKQRG--EDIAPLMADVERMGNELSEGKVELDAIQAELDALVLNIPNLPHESVPVGADEE 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
            N+ +R  G         ++H  +GE  G +DF+ A KLSGARF++L G +A L RAL Q
Sbjct: 119 GNVEVRRWGTPTVFDFEVKDHVALGEKFGWLDFETAAKLSGARFALLRGPIARLHRALAQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD----GRWLIPTSEVSL 236
           FMI+LH +EHGY E   P LV+  A+ GTGQ+PKF +D+F  +       +LIPT+EVSL
Sbjct: 179 FMINLHINEHGYEETYTPYLVQAPALQGTGQLPKFEEDLFKISREGEADLYLIPTAEVSL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TN+ S EI+++K LPL+F    P FRSEAG++GRDTRGM+RQHQF K E+V I   ++S 
Sbjct: 239 TNIVSGEILDAKQLPLKFVAHTPCFRSEAGASGRDTRGMIRQHQFDKVEMVQIVAPDESM 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
              E +   AE +L+ L+L YR ++LCTGD+GFSA KTYDLEVW+  Q+ YREISSCS C
Sbjct: 299 AALESLTGNAERVLQLLELPYRTLALCTGDMGFSAVKTYDLEVWIPSQDKYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
           G+FQ+RRM +R+R+P +   +  HTLNGSG+AVGR L+A+LENY  ADGS+ +P VL+PY
Sbjct: 359 GDFQARRMQARWRNPETGKPELVHTLNGSGLAVGRTLVAVLENYQQADGSIRVPDVLKPY 418

Query: 417 MNNLAVI 423
           M  L VI
Sbjct: 419 MGGLEVI 425


>gi|313891838|ref|ZP_07825443.1| serine--tRNA ligase [Dialister microaerophilus UPII 345-E]
 gi|313119832|gb|EFR43019.1| serine--tRNA ligase [Dialister microaerophilus UPII 345-E]
          Length = 434

 Score =  431 bits (1109), Expect = e-119,   Method: Composition-based stats.
 Identities = 195/424 (45%), Positives = 275/424 (64%), Gaps = 3/424 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLD+++IR+N + +   L  R+       +L LD K R L+++ E +++RRN  S  I  
Sbjct: 1   MLDLKFIRENFDLVKENLINRNNNFDLNKVLELDRKRRELLQETEKLKSRRNIESKNIAI 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A  +G      A   E   +  Q+  ++ + +++   L  L+  IPN+  E VP+G   +
Sbjct: 61  AKKKG--EDASAAIAEMRKVGNQISAIDIDLNKIEKELHNLLLHIPNIVDESVPVGKDDS 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           EN  IR  G         + H+E+GE+L ++DF+RA K+SGARF+     +A LERA+  
Sbjct: 119 ENPEIRRWGVPRKFDFPIKAHYELGESLKMLDFERAGKVSGARFTFYIDAIAKLERAVYN 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT-DGRWLIPTSEVSLTNL 239
           FM+DLHT E  +TEV  P ++ + +M GTGQ+PKFA+DM+    +  ++ PT+EV LTN 
Sbjct: 179 FMLDLHTVEGTFTEVIPPYIINESSMQGTGQLPKFAEDMYKVEGETMYMTPTAEVPLTNY 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           ++ EI++   LP+ FT L P FR EAGSAG+DTRG++RQHQF K E+V   + EDS  E 
Sbjct: 239 FAGEILDESILPVHFTALTPCFRKEAGSAGKDTRGLIRQHQFQKVEMVKYCKPEDSKDEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E + + AE++L+ L+L YRVV LCTGD+GFSA KTYD+EVW+  QN YREISSCS C +F
Sbjct: 299 ESLTNEAEKVLQELNLPYRVVCLCTGDIGFSASKTYDVEVWMPAQNKYREISSCSNCLDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N R+R       +F HTLNGSG+AVGR + AI+ENY N DGS+T+P  LRPYM N
Sbjct: 359 QARRANIRFRRCKGAKPEFVHTLNGSGLAVGRTVAAIMENYQNEDGSITVPEKLRPYMKN 418

Query: 420 LAVI 423
           + VI
Sbjct: 419 IKVI 422


>gi|262281252|ref|ZP_06059034.1| seryl-tRNA synthetase [Acinetobacter calcoaceticus RUH2202]
 gi|262257483|gb|EEY76219.1| seryl-tRNA synthetase [Acinetobacter calcoaceticus RUH2202]
          Length = 425

 Score =  431 bits (1109), Expect = e-119,   Method: Composition-based stats.
 Identities = 189/425 (44%), Positives = 269/425 (63%), Gaps = 5/425 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           M+D + +R N E ++ AL KR ++   +   SL+ + + L  K E ++A RN+ + Q+GQ
Sbjct: 3   MIDPKLLRNNIEAVNAALAKRGVQLDVQEWASLETRRKDLQSKTEKLQAERNAGAKQVGQ 62

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
               G       +      + +++   E    E+ + +++    IPN+P E VP G + +
Sbjct: 63  IKKSGG--DASEIMARMQAIGDEIKAAEVALSELQNEIEQKALSIPNLPDESVPAGKNED 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ I   G         ++H ++GE +G ++F+ ATKL+G+RFSVL G LA L+RAL Q
Sbjct: 121 DNVEISKWGTPRQFDFEIKDHTDLGEWMGGLEFETATKLTGSRFSVLKGSLARLQRALTQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT--DGRWLIPTSEVSLTN 238
           FM+D HT ++GYTE   P LV  +++ GTGQ+PKF +D+F        +LIPT+EV +TN
Sbjct: 181 FMLDTHTLKNGYTEAYVPYLVNADSLRGTGQLPKFEEDLFKLQGEKEYYLIPTAEVPVTN 240

Query: 239 LYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTE 298
               EII+++ LPL++    P FRSEAGS GRDTRG++RQHQF K E+V I + E S   
Sbjct: 241 FVRDEIIDTERLPLKYAAHTPCFRSEAGSYGRDTRGLIRQHQFDKVEMVQIVKPETSMQA 300

Query: 299 HERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGN 358
            E + + AE IL+ L L YR + LC GD+GF A KTYDLEVW