RPSBLAST alignment for GI: 254780680 and conserved domain: pfam02403

>gnl|CDD|145510 pfam02403, Seryl_tRNA_N, Seryl-tRNA synthetase N-terminal domain. This domain is found associated with the Pfam tRNA synthetase class II domain (pfam00587) and represents the N-terminal domain of seryl-tRNA synthetase. Length = 108
 Score =   99 bits (250), Expect = 1e-21
 Identities = 43/110 (39%), Positives = 66/110 (60%), Gaps = 3/110 (2%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHL-EPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLDI+ IR+NPE +   L+KR +     + +L LDE+ R L  ++E+++A RN  S +IG
Sbjct: 1   MLDIKLIRENPEAVKEKLRKRGVDVLDVDELLELDEERRELQVELEELQAERNELSKEIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVP 109
           +A  +      +AL  E   LK++L  LE E  E+ + L KL+  IPN+P
Sbjct: 61  KAKKKK--EDAEALIAEVKELKDELKALEAELRELEAELDKLLLSIPNIP 108