RPSBLAST alignment for GI: 254780680 and conserved domain: PLN02320

>gnl|CDD|177954 PLN02320, PLN02320, seryl-tRNA synthetase. Length = 502
 Score =  261 bits (668), Expect = 3e-70
 Identities = 149/442 (33%), Positives = 237/442 (53%), Gaps = 23/442 (5%)

Query: 2   LDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQA 61
           +D +WIR N E + I ++ R+     E +L L E    L K++E +RA RN+ + ++   
Sbjct: 67  IDFKWIRDNKEAVAINIRNRNSNANLELVLELYENMLALQKEVERLRAERNAVANKM--- 123

Query: 62  IAEGNL--SLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
             +G L  S   AL  E   LKE L  LE++  ++   L+     IPN+   +VP+G   
Sbjct: 124 --KGKLEPSERQALVEEGKNLKEGLVTLEEDLVKLTDELQLEAQSIPNMTHPDVPVGGE- 180

Query: 120 NENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALG 179
           + + + + VG         ++H ++G+ L L DFD A ++SG++F  L      LE AL 
Sbjct: 181 DSSAVRKEVGSPREFSFPIKDHLQLGKELDLFDFDAAAEVSGSKFYYLKNEAVLLEMALV 240

Query: 180 QFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDG--RWLIPTSEVSLT 237
            + +     + G+T ++ P +VR   +   G  P+  +    + DG  + LI T+E+ + 
Sbjct: 241 NWTLS-EVMKKGFTPLTTPEIVRSSVVEKCGFQPRGDNTQVYSIDGSDQCLIGTAEIPVG 299

Query: 238 NLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFT 297
            ++   I+   +LPL++   +  FR+EAG+AG  TRG+ R HQF K E+  I R E+S +
Sbjct: 300 GIHMDSILLESALPLKYVAFSHCFRTEAGAAGAATRGLYRVHQFSKVEMFVICRPEESES 359

Query: 298 EHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCG 357
            HE ++   E++   L LH++ + + T DLG  A + +D+E W+ G   Y EISS S C 
Sbjct: 360 FHEELIQIEEDLFTSLGLHFKTLDMATADLGAPAYRKFDIEAWMPGLGRYGEISSASNCT 419

Query: 358 NFQSRRMNSRYR--DP----------NSKSLKFTHTLNGSGVAVGRCLIAILENYLNADG 405
           ++QSRR+  RYR  +P          +    KF HTLN +  AV R ++ +LENY   DG
Sbjct: 420 DYQSRRLGIRYRPSEPPQTNPKKGKGSLGPTKFVHTLNATACAVPRMIVCLLENYQQEDG 479

Query: 406 SVTIPTVLRPYMNNLAVIKKEH 427
           SV IP  LRP+M  L +IK + 
Sbjct: 480 SVVIPEPLRPFMGGLELIKPKS 501