RPSBLAST alignment for GI: 254780680 and conserved domain: PRK05431

>gnl|CDD|180077 PRK05431, PRK05431, seryl-tRNA synthetase; Provisional. Length = 425
 Score =  692 bits (1789), Expect = 0.0
 Identities = 234/427 (54%), Positives = 304/427 (71%), Gaps = 3/427 (0%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDI+ IR+NPE +  AL KR      + +L LDE+ R L  ++E+++A RN+ S +IGQ
Sbjct: 1   MLDIKLIRENPEAVKEALAKRGFPLDVDELLELDEERRELQTELEELQAERNALSKEIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           A  +G     +AL  E   LKE++  LE E  E+ + L++L+  IPN+P + VP+G   +
Sbjct: 61  AKRKGED--AEALIAEVKELKEEIKALEAELDELEAELEELLLRIPNLPHDSVPVGKDED 118

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           +N+ +R  G+        ++H+E+GE LG++DF+RA K+SG+RF VL G  A LERAL Q
Sbjct: 119 DNVEVRRWGEPREFDFEPKDHWELGEKLGILDFERAAKVSGSRFYVLKGDGARLERALIQ 178

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGRWLIPTSEVSLTNL 239
           FM+DLHT EHGYTEV  P LV +E+MYGTGQ+PKF +D++    D  +LIPT+EV LTNL
Sbjct: 179 FMLDLHTEEHGYTEVIPPYLVNEESMYGTGQLPKFEEDLYKIEDDDLYLIPTAEVPLTNL 238

Query: 240 YSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEH 299
           +  EI++ + LPL++T  +P FRSEAGSAGRDTRG++R HQF K ELV  T+ EDS+ E 
Sbjct: 239 HRDEILDEEELPLKYTAYSPCFRSEAGSAGRDTRGLIRVHQFDKVELVKFTKPEDSYAEL 298

Query: 300 ERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNF 359
           E + + AEEIL++L+L YRVV LCTGDLGFSA KTYDLEVWL  QN YREISSCS C +F
Sbjct: 299 EELTANAEEILQKLELPYRVVLLCTGDLGFSAAKTYDLEVWLPSQNTYREISSCSNCTDF 358

Query: 360 QSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNN 419
           Q+RR N RYRD      +  HTLNGSG+AVGR L+AILENY  ADGSVTIP VLRPYM  
Sbjct: 359 QARRANIRYRDEGDGKPELVHTLNGSGLAVGRTLVAILENYQQADGSVTIPEVLRPYMGG 418

Query: 420 LAVIKKE 426
           L VI  +
Sbjct: 419 LEVIPPK 425