RPSBLAST alignment for GI: 254780680 and conserved domain: cd00670

>gnl|CDD|29810 cd00670, Gly_His_Pro_Ser_Thr_tRS_core, Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain. This domain is the core catalytic domain of tRNA synthetases of the subgroup containing glycyl, histidyl, prolyl, seryl and threonyl tRNA synthetases. It is primarily responsible for ATP-dependent formation of the enzyme bound aminoacyl-adenylate. These enzymes belong to class II aminoacyl-tRNA synthetases (aaRS) based upon their structure and the presence of three characteristic sequence motifs in the core domain. This domain is also found at the C-terminus of eukaryotic GCN2 protein kinase and at the N-terminus of the ATP phosphoribosyltransferase accessory subunit, HisZ and the accessory subunit of mitochondrial polymerase gamma (Pol gamma b) . Most class II tRNA synthetases are dimers, with this subgroup consisting of mostly homodimers. These enzymes attach a specific amino acid to the 3' OH group of ribose of the appropriate tRNA.. Length = 235
 Score = 93.8 bits (233), Expect = 8e-20
 Identities = 58/240 (24%), Positives = 94/240 (39%), Gaps = 24/240 (10%)

Query: 174 LERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD-GRW----- 227
           L RAL +F+ D    E+GY E+  P L      +  G +  +  +M+   D GR      
Sbjct: 4   LWRALERFLDDRMA-EYGYQEILFPFLAPTVLFFKGGHLDGYRKEMYTFEDKGRELRDTD 62

Query: 228 --LIPTSEVSLTNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCE 285
             L P +   +  ++S EI+  ++LPLR   + P FR E        RG++R  +F + E
Sbjct: 63  LVLRPAACEPIYQIFSGEILSYRALPLRLDQIGPCFRHEPSGR----RGLMRVREFRQVE 118

Query: 286 LVSITREEDSFTEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSAC--------KTYDL 337
            V     E++  E    L  AEEI + L L  RVV       G               + 
Sbjct: 119 YVVFGEPEEAEEERREWLELAEEIARELGLPVRVVVADDPFFGRGGKRGLDAGRETVVEF 178

Query: 338 EVWLAGQNLYREISSCSTCGNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAIL 397
           E+ L      +E +  S   +      +   +       +      G+G    R ++A+L
Sbjct: 179 ELLLPLPGRAKETAVGSANVHLDHFGASF--KIDEDGGGRAHTGCGGAG-GEERLVLALL 235