RPSBLAST alignment for GI: 254780680 and conserved domain: cd00771

>gnl|CDD|29816 cd00771, ThrRS_core, Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain. ThrRS is a homodimer. It is responsible for the attachment of threonine to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP-dependent formation of the enzyme bound aminoacyl-adenylate. Class II assignment is based upon its structure and the presence of three characteristic sequence motifs in the core domain.. Length = 298
 Score = 48.6 bits (116), Expect = 3e-06
 Identities = 45/213 (21%), Positives = 72/213 (33%), Gaps = 14/213 (6%)

Query: 141 HFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAPLL 200
           H  +G  L L  F       G  F +  G  A +   L  F+ +L   + GY EV  P++
Sbjct: 2   HRRLGGELELFFFFDEAG-PGLPFWLPKG--AIIRNELEDFLRELQ-RKRGYQEVETPII 57

Query: 201 VRDEAMYGTGQIPKFADDMFCTTDGR---WLIPTSEVSLTNLYSHEIIESKSLPLRFTTL 257
              E    +G    + ++MF   +      L P +      ++  +    + LPLR    
Sbjct: 58  YNKELWETSGHWDHYRENMFPFEEEDEEYGLKPMNCPGHCLIFKSKPRSYRDLPLRLAEF 117

Query: 258 APSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDLHY 317
               R E   A     G+ R   F + +       +    E + +L   +E+        
Sbjct: 118 GTVHRYEQSGA---LHGLTRVRGFTQDDAHIFCTPDQIKEEIKGVLDLIKEVYSDFGFFD 174

Query: 318 RVVSLCTGDLGFSACKTYDLEVWLAGQNLYREI 350
             V L T    F        EVW   +   RE 
Sbjct: 175 YKVELSTRPEKFIG----SDEVWEKAEAALREA 203