RPSBLAST alignment for GI: 254780680 and conserved domain: COG0172

>gnl|CDD|30521 COG0172, SerS, Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 429
 Score =  530 bits (1367), Expect = e-151
 Identities = 225/430 (52%), Positives = 298/430 (69%), Gaps = 6/430 (1%)

Query: 1   MLDIQWIRQNPEHLDIALKKRH-LEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIG 59
           MLD++ IR+NP+ +   LKKR       + +L LDE+ R L++++E+++A RN  S +IG
Sbjct: 1   MLDLKLIRENPDAVREKLKKRGGDALDVDKLLELDEERRKLLRELEELQAERNELSKEIG 60

Query: 60  QAIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSA 119
           +A+  G     + L  E   LKE+L  LE    E+ + L  L+  IPN+P E VP+G   
Sbjct: 61  RALKRGE-DDAEELIAEVKELKEKLKELEAALDELEAELDTLLLTIPNIPHESVPVGKDE 119

Query: 120 NENILIRSVGKKPSAI--HLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERA 177
           ++N+ +R  G+ P  +     ++H E+GE LGL+DF+RA K+SG+RF    G  A LERA
Sbjct: 120 DDNVEVRRWGEPPVFVFDFEPKDHVELGEKLGLLDFERAAKVSGSRFYFYKGKGARLERA 179

Query: 178 LGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMF-CTTDGRWLIPTSEVSL 236
           L QFM+DLHT +HG+TEV  P LV  E+M+GTGQ+PKF +D++       +LIPT+EV L
Sbjct: 180 LIQFMLDLHT-KHGFTEVLPPYLVNLESMFGTGQLPKFEEDLYKVEDPDLYLIPTAEVPL 238

Query: 237 TNLYSHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSF 296
           TNL+  EI++ + LP+++T  +P FRSEAGSAG+DTRG++R HQF K ELV IT+ E+S 
Sbjct: 239 TNLHRDEILDEEDLPIKYTAYSPCFRSEAGSAGKDTRGLIRVHQFDKVELVVITKPEESE 298

Query: 297 TEHERMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
            E E ML  AEE+L+ L+L YRVV+LCTGDLGFSA K YDLEVWL GQN YREISSCS C
Sbjct: 299 EELEEMLGNAEEVLQELELPYRVVNLCTGDLGFSAAKKYDLEVWLPGQNKYREISSCSNC 358

Query: 357 GNFQSRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPY 416
            +FQ+RR+N RYRD      +F HTLNGSG+AVGR L+AILENY   DGSV IP VLRPY
Sbjct: 359 TDFQARRLNIRYRDKEEGKREFVHTLNGSGLAVGRTLVAILENYQQEDGSVKIPEVLRPY 418

Query: 417 MNNLAVIKKE 426
           M  L +I K 
Sbjct: 419 MGGLEIIPKP 428