RPSBLAST alignment of GI: 254780680 and protein with PDBid: 1qf6

>1qf6_A THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, zinc, mRNA, aminoacylation, translational regulation, protein/RNA, ligase/RNA complex; HET: H2U AET G7M 5MU PSU AMP; 2.90A {Escherichia coli} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 Length = 642
 Score = 64.7 bits (157), Expect = 3e-11
 Identities = 38/221 (17%), Positives = 65/221 (29%), Gaps = 15/221 (6%)

Query: 139 REHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQFMIDLHTSEHGYTEVSAP 198
           R+H +IG+ L L                       + R L  F+      E+ Y EV  P
Sbjct: 242 RDHRKIGKQLDLYHMQE----EAPGMVFWHNDGWTIFRELEVFVRSKL-KEYQYQEVKGP 296

Query: 199 LLVRDEAMYGTGQIPKFADDMFCTTDGR---WLIPTSEVSLTNLYSHEIIESKSLPLRFT 255
            ++       TG    + D MF T+       + P +      +++  +   + LPLR  
Sbjct: 297 FMMDRVLWEKTGHWDNYKDAMFTTSSENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMA 356

Query: 256 TLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHERMLSCAEEILKRLDL 315
                 R           G++R   F + +      EE    E    +    ++      
Sbjct: 357 EFGSCHR---NEPSGSLHGLMRVRGFTQDDAHIFCTEEQIRDEVNGCIRLVYDMYSTFGF 413

Query: 316 HYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTC 356
              VV L T             E+W   +         +  
Sbjct: 414 EKIVVKLSTRPEKRIG----SDEMWDRAEADLAVALEENNI 450