RPSBLAST alignment of GI: 254780680 and protein with PDBid: 1wle

>1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} Length = 501
 Score =  369 bits (949), Expect = e-103
 Identities = 124/444 (27%), Positives = 213/444 (47%), Gaps = 20/444 (4%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEY---ILSLDEKNRILIKKIEDIRARRNSNSAQ 57
           +LD++ +   PE    AL  R  E +S+    I+S  ++ R L ++I  +   + + +  
Sbjct: 40  LLDMESLCAYPEDAARALDLRKGELRSKDLPGIISTWQELRQLREQIRSLEEEKEAVTEA 99

Query: 58  IGQAIAEGNLS------LVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLE 111
           +   +   + S         +L+     +++QL +L  +E ++          +PN    
Sbjct: 100 VRALVVNQDNSQVQQDPQYQSLRARGREIRKQLTLLYPKEAQLEEQFYLRALRLPNQTHP 159

Query: 112 EVPIGTSANENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHL 171
           +VP+G   ++  ++  VG KP+     R H EI E L ++   R + +SG R   L G  
Sbjct: 160 DVPVGDE-SQARVLHVVGDKPAFSFQPRGHLEIAEKLDIIRQKRLSHVSGHRSYYLRGAG 218

Query: 172 AHLERALGQFMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTT-----DGR 226
           A L+  L  F ++       +T ++ P L+R     G G  P