BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780680|ref|YP_003065093.1| seryl-tRNA synthetase
[Candidatus Liberibacter asiaticus str. psy62]
         (430 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780680|ref|YP_003065093.1| seryl-tRNA synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 430

 Score =  889 bits (2297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/430 (100%), Positives = 430/430 (100%)

Query: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60
           MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ
Sbjct: 1   MLDIQWIRQNPEHLDIALKKRHLEPQSEYILSLDEKNRILIKKIEDIRARRNSNSAQIGQ 60

Query: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120
           AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN
Sbjct: 61  AIAEGNLSLVDALKNETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSAN 120

Query: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180
           ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ
Sbjct: 121 ENILIRSVGKKPSAIHLSREHFEIGEALGLMDFDRATKLSGARFSVLTGHLAHLERALGQ 180

Query: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240
           FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY
Sbjct: 181 FMIDLHTSEHGYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTDGRWLIPTSEVSLTNLY 240

Query: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300
           SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE
Sbjct: 241 SHEIIESKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSITREEDSFTEHE 300

Query: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360
           RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ
Sbjct: 301 RMLSCAEEILKRLDLHYRVVSLCTGDLGFSACKTYDLEVWLAGQNLYREISSCSTCGNFQ 360

Query: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420
           SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL
Sbjct: 361 SRRMNSRYRDPNSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNL 420

Query: 421 AVIKKEHILE 430
           AVIKKEHILE
Sbjct: 421 AVIKKEHILE 430


>gi|254780870|ref|YP_003065283.1| prolyl-tRNA synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 449

 Score = 33.9 bits (76), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 58/143 (40%), Gaps = 9/143 (6%)

Query: 191 GYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--GRWLI--PTSEVSLTNLYSHEIIE 246
           G  E+S P L   +    +G+   +  +M    D   + +I  PT E  +T+++   I  
Sbjct: 65  GAIEMSVPTLQSADLWVESGRYDSYGKEMLRLADRNDKAMIYGPTHEEVMTDIFRSHIKS 124

Query: 247 SKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT-REEDSFTEHERMLSC 305
            ++LP  F  +   FR E     R   G++R  +F   +  S     E S   + +M   
Sbjct: 125 YRNLPFTFYQIQLKFRDEL----RPRFGVMRSREFLMKDAYSFDLTPEGSKHSYNKMFVS 180

Query: 306 AEEILKRLDLHYRVVSLCTGDLG 328
              I  RL L    +   +G +G
Sbjct: 181 YLRIFHRLGLKSIPMRAESGPIG 203


>gi|254780747|ref|YP_003065160.1| putative protease IV transmembrane protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 293

 Score = 29.3 bits (64), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 56/114 (49%), Gaps = 16/114 (14%)

Query: 22  HLEPQSEYILSLDEKNRI-----LIKKIEDIRARRNSNSAQIGQAIAEGNLSLV-DALKN 75
           H+E  S ++  +  + +I     LI++IE I +R +S +A I    + G  +   +A+  
Sbjct: 30  HVEDNSPHVARIAIRGQIEDSQELIERIERI-SRDDSATALIVSLSSPGGSAYAGEAIFR 88

Query: 76  ETSTLKEQLPILEKEEHEVCSSLKKLISCIPNVPLEEVPIGTSANENILIRSVG 129
               +K + P++  E HE+ +S   LISC  N+ +        A E  L+ S+G
Sbjct: 89  AIQKVKNRKPVI-TEVHEMAASAGYLISCASNIIV--------AAETSLVGSIG 133


>gi|254780806|ref|YP_003065219.1| chromosome partitioning protein A [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 265

 Score = 26.2 bits (56), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 128 VGKKPSAIHLSREHFEIGEALGLMDFD 154
           VGK  +AI+LS     IGE + L+D D
Sbjct: 18  VGKTTTAINLSTALAAIGENVLLIDLD 44


>gi|254780762|ref|YP_003065175.1| recombination protein RecR [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 201

 Score = 25.0 bits (53), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 8/20 (40%), Positives = 12/20 (60%)

Query: 342 AGQNLYREISSCSTCGNFQS 361
           A  N+Y ++  CS CGN  +
Sbjct: 49  AMANIYNKVCLCSICGNVDT 68


>gi|254780970|ref|YP_003065383.1| phosphoribosylformylglycinamidine synthase II [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 737

 Score = 24.6 bits (52), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 8/21 (38%), Positives = 14/21 (66%)

Query: 306 AEEILKRLDLHYRVVSLCTGD 326
           A+EIL +  LH+ ++ + T D
Sbjct: 327 AQEILNKWGLHFSIIGITTND 347


>gi|254780814|ref|YP_003065227.1| DNA gyrase subunit B [Candidatus Liberibacter asiaticus str. psy62]
          Length = 803

 Score = 23.9 bits (50), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 28/52 (53%)

Query: 372 NSKSLKFTHTLNGSGVAVGRCLIAILENYLNADGSVTIPTVLRPYMNNLAVI 423
           N KS K +  L+G GV+V   L + L+  +  +G++   + +   ++N  V+
Sbjct: 110 NQKSYKVSGGLHGVGVSVVNALSSWLKLRIKREGNIYEMSFINGILDNPLVV 161


>gi|254780727|ref|YP_003065140.1| putative pilus assembly protein [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 474

 Score = 23.9 bits (50), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 15/25 (60%)

Query: 65  GNLSLVDALKNETSTLKEQLPILEK 89
           G + L   LK++   LKE +P+L K
Sbjct: 366 GTIVLAGLLKDDIQQLKEGIPLLSK 390


>gi|254780228|ref|YP_003064641.1| hypothetical protein CLIBASIA_00565 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 346

 Score = 23.1 bits (48), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 22/32 (68%), Gaps = 1/32 (3%)

Query: 377 KFTHTLNGSGVAVGRCLI-AILENYLNADGSV 407
           +FTHTL+G+   V  C+I A++E  L+ + ++
Sbjct: 34  QFTHTLSGTISTVYICIILAVVEISLSFENAI 65


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.318    0.134    0.390 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 274,765
Number of Sequences: 1233
Number of extensions: 10836
Number of successful extensions: 39
Number of sequences better than 100.0: 11
Number of HSP's better than 100.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 32
Number of HSP's gapped (non-prelim): 12
length of query: 430
length of database: 328,796
effective HSP length: 76
effective length of query: 354
effective length of database: 235,088
effective search space: 83221152
effective search space used: 83221152
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 40 (20.0 bits)