RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780682|ref|YP_003065095.1| hypothetical protein CLIBASIA_02845 [Candidatus Liberibacter asiaticus str. psy62] (199 letters) >1hqm_D DNA-directed RNA polymerase; transferase, transcription, 3D- structure; 3.30A {Thermus aquaticus} (D:135-193) Length = 59 Score = 27.0 bits (59), Expect = 1.7 Identities = 9/22 (40%), Positives = 13/22 (59%), Gaps = 3/22 (13%) Query: 108 PKNANNNILDHIALLKERLRTD 129 PK A +LD + + K +L TD Sbjct: 3 PKGA---VLDGVPVEKRQLLTD 21 >2o3o_A YYCI protein; two-component system, signaling protein; 2.89A {Bacillus subtilis} (A:) Length = 254 Score = 26.1 bits (57), Expect = 3.9 Identities = 7/45 (15%), Positives = 14/45 (31%), Gaps = 6/45 (13%) Query: 143 PLPNNLKPNVCVKEKKLIPPRKNINNLKDTNHRLKIKNNQEIKNI 187 K +++ LI + L N +K +K+ Sbjct: 161 TTLETFKQI---QKESLITEXDAVELLYYQNQ---LKEYSTVKSC 199 >1w7c_A Lysyl oxidase; AMNE oxidase, copper, oxidoreductase, quinoprotein, topaquinone enzyme, TPQ; HET: BMA NAG TPQ IMD; 1.23A {Pichia pastoris} (A:268-737) Length = 470 Score = 25.7 bits (56), Expect = 4.1 Identities = 9/89 (10%), Positives = 23/89 (25%), Gaps = 10/89 (11%) Query: 118 HIALLKERLRTDI----NTFDNTNLETKIPLPNNLKPNV-----CVKEKKLIPPRKNINN 168 H +L ++ D+ N ++ + P + + N N Sbjct: 218 HDHVLNYKVDLDVGGTKNRASQYVMKDV-DVEYPWAPGTVYNTKQIAREVFENEDFNGIN 276 Query: 169 LKDTNHRLKIKNNQEIKNIHHKKNKPRLH 197 + + + + E N + Sbjct: 277 WPENGQGILLIESAEETNSFGNPRAYNIM 305 >2p2v_A Alpha-2,3-sialyltransferase; mixed alpha-beta; HET: CSF; 1.85A {Campylobacter jejuni} PDB: 2p56_A (A:) Length = 288 Score = 25.6 bits (56), Expect = 4.6 Identities = 16/84 (19%), Positives = 30/84 (35%), Gaps = 10/84 (11%) Query: 90 HNLQYSLINIPSQNKQESPKNANNNILDHIALLKERLRTDINTF---DNTNLETKIPLPN 146 + ++ I K P N ++ D AL + +N + D++ L PL Sbjct: 183 EAMSTNIKTIFPGIKDFKPSNCHSKEYDIEALKLLKSIYKVNIYALCDDSILANHFPLSI 242 Query: 147 NLKPNVCVKEKK-------LIPPR 163 N+ N ++ K L+ Sbjct: 243 NINNNFTLENKHNNSINDILLTDN 266 >1wpn_A Manganese-dependent inorganic pyrophosphatase; metal binding, hydrolase; 1.30A {Bacillus subtilis} (A:) Length = 188 Score = 25.1 bits (54), Expect = 6.5 Identities = 17/96 (17%), Positives = 38/96 (39%) Query: 6 LFLIKHKLKLHKNIMSKGKINESFWYIRTLFPYLSHQIHKALMSISSGIILILSPTDCTA 65 +K+KL + + G++N Y F S ++ + + +G+IL+ + Sbjct: 23 YADLKNKLGFNAEPVRLGQVNGETQYALDYFKQESPRLVETAANEVNGVILVDHNERQQS 82 Query: 66 NTANILIPSRKIIDYHRLLEQKKNHNLQYSLINIPS 101 + ++ID+HR+ + L Y + Sbjct: 83 IKDIEEVQVLEVIDHHRIANFETAEPLYYRAEPVGC 118 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.318 0.134 0.390 Gapped Lambda K H 0.267 0.0716 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,407,236 Number of extensions: 58826 Number of successful extensions: 138 Number of sequences better than 10.0: 1 Number of HSP's gapped: 137 Number of HSP's successfully gapped: 17 Length of query: 199 Length of database: 4,956,049 Length adjustment: 84 Effective length of query: 115 Effective length of database: 2,116,429 Effective search space: 243389335 Effective search space used: 243389335 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (23.8 bits)