RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780683|ref|YP_003065096.1| lipoprotein [Candidatus Liberibacter asiaticus str. psy62] (84 letters) >gnl|CDD|144954 pfam01551, Peptidase_M23, Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins, for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown. Length = 96 Score = 82.2 bits (204), Expect = 2e-17 Identities = 27/74 (36%), Positives = 42/74 (56%), Gaps = 1/74 (1%) Query: 2 VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61 V++ G GN ++I H + T+Y+H+ V+ GQ+V G IG G +G + P Sbjct: 24 VVFAGYLGG-YGNLVIIDHGNGYETLYAHLSKILVKVGQRVKAGQVIGTVGSTGRSTGPH 82 Query: 62 VHFELRKNAIAMDP 75 +HFE+RKN +DP Sbjct: 83 LHFEIRKNGKPVDP 96 >gnl|CDD|31082 COG0739, NlpD, Membrane proteins related to metalloendopeptidases [Cell envelope biogenesis, outer membrane]. Length = 277 Score = 76.7 bits (187), Expect = 1e-15 Identities = 31/79 (39%), Positives = 48/79 (60%) Query: 1 MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60 +V++ GN GN ++I+H D VTVY+H+ + V++GQKV G IG G +G + P Sbjct: 183 VVVFAGNGGWGYGNLVIIKHGDGYVTVYAHLSSILVKEGQKVKAGQVIGYVGSTGRSTGP 242 Query: 61 QVHFELRKNAIAMDPIKFL 79 +HFE+RKN + P+ Sbjct: 243 HLHFEVRKNGKLVPPVNPA 261 >gnl|CDD|34550 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning]. Length = 420 Score = 60.7 bits (147), Expect = 8e-11 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 1/81 (1%) Query: 1 MVIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHP 60 V+Y L G +++ H ++Y + V GQ V G I L G SG P Sbjct: 341 RVVYAD-WLRGYGLVVILDHGGGYHSLYGGNQSILVNPGQFVKAGEPIALVGSSGGQGRP 399 Query: 61 QVHFELRKNAIAMDPIKFLEE 81 ++FE+R+ ++P +L Sbjct: 400 ALYFEIRRQGQPVNPQPWLRR 420 >gnl|CDD|110005 pfam00972, Flavi_NS5, Flavivirus RNA-directed RNA polymerase. Flaviviruses produce a polyprotein from the ssRNA genome. This protein is also known as NS5. This RNA-directed RNA polymerase possesses a number of short regions and motifs homologous to other RNA-directed RNA polymerases. Length = 649 Score = 25.5 bits (56), Expect = 3.2 Identities = 15/56 (26%), Positives = 28/56 (50%), Gaps = 5/56 (8%) Query: 8 DLVELGNTILIRHDDSIVT----VYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQH 59 D++E+ N + I D+ + + S D PY+ K Q + G IG ++ A++ Sbjct: 561 DMLEVWNRVWI-QDNPWMQDKTPIESWRDVPYLGKRQDIWCGSLIGTKSRATWAKN 615 >gnl|CDD|176485 cd08664, APC10-HERC2, APC10-like DOC1 domain present in HERC2 (HECT domain and RLD2). This model represents the APC10/DOC1 domain present in HERC2 (HECT domain and RLD2), a large multi-domain protein with three RCC1-like domains (RLDs), additional internal domains including a zinc finger ZZ-type and Cyt-b5 (Cytochrome b5-like Heme/Steroid binding) domains, and a C-terminal HECT (Homologous to the E6-AP Carboxyl Terminus) domain. The APC10/DOC1 domain of HERC2 is a homolog of the APC10 subunit and the DOC1 domain present in E3 ubiquitin ligases which mediate substrate ubiquitination (or ubiquitylation), a component of the ubiquitin-26S proteasome pathway for selective proteolytic degradation. As suggested by structural relationships between HERC2 and other proteins such as HERC1, the proposed role for HERC2 in protein trafficking and degradation pathways is consistent with observations that mutations in HERC2 lead to neuromuscular secretory vesicle and sperm acrosome defects, other developmental abnormalities, and juvenile lethality of jdf2 mice. Recent studies have shown that the protein complex, HERC2-RNF8, coordinates ubiquitin-dependent assembly of DNA repair factors on damaged chromosomes. Length = 152 Score = 25.4 bits (56), Expect = 3.7 Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 4/37 (10%) Query: 2 VIYVG---NDLVELGNTILIRHDDSIVTVYSHIDTPY 35 V+ G N L EL TI + D++VT+ + Y Sbjct: 92 VVSGGDSLNSLKEL-KTINVNATDTLVTLLQDVKEYY 127 >gnl|CDD|34387 COG4774, Fiu, Outer membrane receptor for monomeric catechols [Inorganic ion transport and metabolism]. Length = 750 Score = 25.3 bits (55), Expect = 3.9 Identities = 9/23 (39%), Positives = 12/23 (52%) Query: 31 IDTPYVQKGQKVSRGHTIGLSGK 53 D Y Q G+K RG + +SG Sbjct: 590 DDGTYSQYGEKRVRGVELSVSGN 612 >gnl|CDD|35270 KOG0047, KOG0047, KOG0047, Catalase [Inorganic ion transport and metabolism]. Length = 505 Score = 24.5 bits (53), Expect = 6.0 Identities = 10/38 (26%), Positives = 16/38 (42%) Query: 27 VYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHF 64 ++S TP + HT + K G A + + HF Sbjct: 196 LFSDRGTPDGYRHMNGYGSHTYKMVNKEGKAHYVKFHF 233 >gnl|CDD|38220 KOG3010, KOG3010, KOG3010, Methyltransferase [General function prediction only]. Length = 261 Score = 24.1 bits (52), Expect = 9.6 Identities = 14/56 (25%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 33 TPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMDP----IKFLEEKIP 84 T + +K + GH + +GN Q + E K IA D +K ++ P Sbjct: 21 TDWFKKIASRTEGHRLAWDVGTGNGQAARGIAEHYKEVIATDVSEAMLKVAKKHPP 76 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.138 0.398 Gapped Lambda K H 0.267 0.0779 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 986,014 Number of extensions: 40377 Number of successful extensions: 105 Number of sequences better than 10.0: 1 Number of HSP's gapped: 105 Number of HSP's successfully gapped: 14 Length of query: 84 Length of database: 6,263,737 Length adjustment: 54 Effective length of query: 30 Effective length of database: 5,096,851 Effective search space: 152905530 Effective search space used: 152905530 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (22.9 bits)