RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780683|ref|YP_003065096.1| lipoprotein [Candidatus Liberibacter asiaticus str. psy62] (84 letters) >gnl|CDD|183257 PRK11649, PRK11649, putative peptidase; Provisional. Length = 439 Score = 61.6 bits (150), Expect = 5e-11 Identities = 29/72 (40%), Positives = 40/72 (55%), Gaps = 3/72 (4%) Query: 13 GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72 GN + IRH T Y H+ V+ GQKV RG I LSG +G + P +H+E+ N A Sbjct: 344 GNYVAIRHGRQYTTRYMHLRKLLVKPGQKVKRGDRIALSGNTGRSTGPHLHYEVWINQQA 403 Query: 73 MDPIKFLEEKIP 84 ++P L K+P Sbjct: 404 VNP---LTAKLP 412 >gnl|CDD|182796 PRK10871, nlpD, lipoprotein NlpD; Provisional. Length = 319 Score = 59.5 bits (144), Expect = 2e-10 Identities = 28/81 (34%), Positives = 51/81 (62%), Gaps = 1/81 (1%) Query: 2 VIYVGNDLVELGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQ 61 V+Y GN L GN I+I+H+D ++ Y+H DT V++ Q+V G I G +G + + Sbjct: 240 VVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSS-TR 298 Query: 62 VHFELRKNAIAMDPIKFLEEK 82 +HFE+R +++P+++L ++ Sbjct: 299 LHFEIRYKGKSVNPLRYLPQR 319 >gnl|CDD|183249 PRK11637, PRK11637, AmiB activator; Provisional. Length = 428 Score = 37.4 bits (87), Expect = 7e-04 Identities = 19/67 (28%), Positives = 35/67 (52%) Query: 13 GNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIA 72 G +++ H +++Y + + V G +V G I L G SG P ++FE+R+ A Sbjct: 360 GLVVVVEHGKGDMSLYGYNQSALVSVGAQVRAGQPIALVGSSGGQGRPSLYFEIRRQGQA 419 Query: 73 MDPIKFL 79 ++P +L Sbjct: 420 VNPQPWL 426 >gnl|CDD|163347 TIGR03599, YloV, DAK2 domain fusion protein YloV. This model describes a protein family that contains an N-terminal DAK2 domain (pfam02734), so named because of similarity to the dihydroxyacetone kinase family family. The GTP-binding protein CgtA (a member of the obg family) is a bacterial GTPase associated with ribosome biogenesis, and it has a characteristic extension (TIGR03595) in certain lineages. This protein family described here was found, by the method of partial phylognetic profiling, to have a phylogenetic distribution strongly correlated to that of TIGR03595. This correlation implies some form of functional coupling. Length = 530 Score = 31.4 bits (72), Expect = 0.056 Identities = 13/44 (29%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Query: 7 NDLVELGNTILIRHDDSIVTVYSHIDTPY--VQKGQKVSRGHTI 48 +L +LG+++++ DD +V V+ H + P ++ GQK I Sbjct: 244 KELEKLGDSLVVVGDDDLVKVHVHTNDPGLVLEYGQKYGELIKI 287 >gnl|CDD|180005 PRK05305, PRK05305, phosphatidylserine decarboxylase; Provisional. Length = 206 Score = 24.8 bits (55), Expect = 5.1 Identities = 8/17 (47%), Positives = 11/17 (64%) Query: 34 PYVQKGQKVSRGHTIGL 50 YV++G +V RG GL Sbjct: 154 CYVKEGDEVERGERFGL 170 >gnl|CDD|180811 PRK07051, PRK07051, hypothetical protein; Validated. Length = 80 Score = 24.6 bits (54), Expect = 5.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Query: 34 PYVQKGQKVSRGHTIGL 50 PYV+ G V+ G +GL Sbjct: 24 PYVEVGDAVAAGDVVGL 40 >gnl|CDD|177920 PLN02281, PLN02281, chlorophyllide a oxygenase. Length = 536 Score = 24.3 bits (52), Expect = 7.8 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 4/69 (5%) Query: 15 TILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFELRKNAIAMD 74 TI+I HD +V V + + Y G + GL + A H QVH + + A+D Sbjct: 101 TIMILHD-KVVDVLNPLAREYKSIG--TVKKELAGLQEELSKA-HQQVHISEARVSTALD 156 Query: 75 PIKFLEEKI 83 + +EE + Sbjct: 157 KLAHMEELV 165 >gnl|CDD|148644 pfam07154, DUF1392, Protein of unknown function (DUF1392). This family consists of several hypothetical cyanobacterial proteins of around 150 residues in length which seem to be specific to Anabaena species. The function of this family is unknown. Length = 150 Score = 24.0 bits (52), Expect = 8.9 Identities = 10/48 (20%), Positives = 17/48 (35%), Gaps = 8/48 (16%) Query: 20 HDDS-IVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQVHFEL 66 +DD ++ S + Y K Q ++ G + P F L Sbjct: 50 YDDCWNYSIESDNEIIYATKHQIIATGQF-----QPTTLSKP--AFAL 90 >gnl|CDD|129268 TIGR00164, PS_decarb_rel, phosphatidylserine decarboxylase precursor-related protein. It is unclear whether this protein is a form of phosphatidylserine decarboxylase or is a related enzyme. It is found in Neisseria gonorrhoeae, Mycobacterium tuberculosis, and several archaeal species, all of which lack known phosphatidylserine decarboxylase. Length = 189 Score = 24.0 bits (52), Expect = 9.1 Identities = 10/16 (62%), Positives = 14/16 (87%) Query: 35 YVQKGQKVSRGHTIGL 50 YV++G+KVSRG IG+ Sbjct: 135 YVKEGEKVSRGQRIGM 150 >gnl|CDD|178340 PLN02739, PLN02739, serine acetyltransferase. Length = 355 Score = 23.8 bits (51), Expect = 9.5 Identities = 13/51 (25%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Query: 12 LGNTILIRHDDSIVTVYSHIDTPYVQKGQKVSRGHTIGLSGKSGNAQHPQV 62 +G IL+ H +V +T + + G T+G +GK +HP++ Sbjct: 214 IGKGILLDHGTGVVIG----ETAVIGDRVSILHGVTLGGTGKETGDRHPKI 260 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.319 0.138 0.398 Gapped Lambda K H 0.267 0.0799 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,350,257 Number of extensions: 68551 Number of successful extensions: 130 Number of sequences better than 10.0: 1 Number of HSP's gapped: 129 Number of HSP's successfully gapped: 17 Length of query: 84 Length of database: 5,994,473 Length adjustment: 53 Effective length of query: 31 Effective length of database: 4,849,249 Effective search space: 150326719 Effective search space used: 150326719 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (22.9 bits)