>cd04158 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor domain protein 1) is an unusual member of the Arf family. In addition to the C-terminal Arf domain, ARD1 has an additional 46-kDa N-terminal domain that contains a RING finger domain, two predicted B-Boxes, and a coiled-coil protein interaction motif. This domain belongs to the TRIM (tripartite motif) or RBCC (RING, B-Box, coiled-coil) family. Like most Arfs, the ARD1 Arf domain lacks detectable GTPase activity. However, unlike most Arfs, the full-length ARD1 protein has significant GTPase activity due to the GAP (GTPase-activating protein) activity exhibited by the 46-kDa N-terminal domain. The GAP domain of ARD1 is specific for its own Arf domain and does not bind other Arfs. The rate of GDP dissociation from the ARD1 Arf domain is slowed by the adjacent 15 amino acids, which act as a GDI (GDP-dissociation inhibitor) domain. ARD1 is ubiquitously expressed in cells and localizes to the Golgi and to the lysosomal membra

Probab=90.85 E-value=1 Score=24.11 Aligned_cols=94 Identities=18% Similarity=0.236 Sum_probs=50.2 Q ss_pred EEEEECCCCCCHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHH Q ss_conf 03752667889999999987407898389931246522388999986427755328984157788034444445677788 Q gi|254780684|r 163 RIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIA 242 (438) Q Consensus 163 R~gIfg~~GvGKt~Ll~~i~~~~~~dv~V~alIGeR~rev~efi~~~~~~~l~~tvvv~~t~d~~~~~r~~a~~~a~~iA 242 (438) T Consensus 1 KIlilGl~~sGKTtil~~l~~~~~~~~--~pT~G~~~~~-------i~~~~--~~l~iwD~gG~---~~~r~~-----w~ 61 (169) T cd04158 1 RVVTLGLDGAGKTTILFKLKQDEFMQP--IPTIGFNVET-------VEYKN--LKFTIWDVGGK---HKLRPL-----WK 61 (169) T ss_pred CEEEECCCCCCHHHHHHHHHCCCCCCC--CCCCCCCEEE-------EEECC--EEEEEEECCCC---CCCCHH-----HH T ss_conf 999999899988999999957996897--7868816699-------99898--89999989997---244636-----78 Q ss_pred HHHHHCCCCEEEEEECH--HHHHHHHHHHHHHCCCC Q ss_conf 88642679889997098--99999987665404778 Q gi|254780684|r 243 EYFSSKGDNVLLILDSI--TRFAHSIREIATNSGEL 276 (438) Q Consensus 243 Eyfr~~G~~Vll~~Ds~--tr~a~A~reis~~~ge~ 276 (438) T Consensus 62 ~Yy~~-~~~iIfVvDssd~~~~~ea~~~l~~ll~~~ 96 (169) T cd04158 62 HYYLN-TQAVVFVVDSSHRDRVSEAHSELAKLLTEK 96 (169) T ss_pred HHCCC-CCEEEEEEECCHHHHHHHHHHHHHHHHHHH T ss_conf 75557-627999998630677999999999997127

HHsearch alignment for GI: 254780684 and conserved domain: cd04158