RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780684|ref|YP_003065097.1| flagellum-specific ATP synthase [Candidatus Liberibacter asiaticus str. psy62] (438 letters) >gnl|CDD|31351 COG1157, FliI, Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion]. Length = 441 Score = 479 bits (1234), Expect = e-136 Identities = 194/444 (43%), Positives = 262/444 (59%), Gaps = 11/444 (2%) Query: 1 MQKNLETLAQLAEDYSKNL-VVQGGYISSITSVYYTVTCLSQYVCLGDF--VVHQGKNSD 57 + ++L L L + G ++ +T + +G+ + + Sbjct: 2 LSRDLTHLDSLELALRNTDPYKRRGRLTRVTGLLLEAVGPQ--ARIGELCKIERSRGSEK 59 Query: 58 NLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGR-FRISPSACWCGRVINALGKPIDGD 116 L +V+ N + V + P E +S G V GR + GRV++ LG+P+DG Sbjct: 60 VLAEVVGFNEERVLLMPFEPVEGVSPGAEVVPTGRPLSVPVGDALLGRVLDGLGRPLDGG 119 Query: 117 DSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKST 176 L G + + P + R+ +E+ TG+R ID GQRIG+FAGSG+GKST Sbjct: 120 -GLPDGTERRPLDAPPPNPLKRRPIEEPLDTGVRAIDGLLTCGKGQRIGIFAGSGVGKST 178 Query: 177 LLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKSVVVVATSDESPILRKMAP 235 LL M AR+ D +I+L+GERGREVREFIE LG+ LK+SVVVVATSDES ++R A Sbjct: 179 LLGMIARNTEADVNVIALIGERGREVREFIEKDLGEEGLKRSVVVVATSDESALMRLKAA 238 Query: 236 LTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLE 295 TA TIAEYF +G VLLI+DS+TRFA + REI +GE P +GYP SVFSELPRLLE Sbjct: 239 FTATTIAEYFRDQGKRVLLIMDSLTRFAMAQREIGLAAGEPPATKGYPPSVFSELPRLLE 298 Query: 296 RIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLA 355 R G +K G+ITA +VLV+GD+ NDPIAD VRSILDGHIVL+R+LAE G YP +D LA Sbjct: 299 RAGNGDK--GSITAFYTVLVEGDDMNDPIADEVRSILDGHIVLSRALAEAGHYPAIDVLA 356 Query: 356 SVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGVDLILDKAVHQVPIIYD 415 S+SR+ + S + +K L L+ R+EE D+ IG Y+ G D LDKA+ P I Sbjct: 357 SISRVMPQIVSEEHRKAARRLRQLLSRYEENEDLIRIGAYQKGSDPELDKAIKLYPKIEQ 416 Query: 416 FLKQSPSDLSS-EDVFQEITKKLQ 438 FLKQ + SS E+ +++ L Sbjct: 417 FLKQGIDEKSSFEETLEQLEAILS 440 >gnl|CDD|30002 cd01136, ATPase_flagellum-secretory_path_III, Flagellum-specific ATPase/type III secretory pathway virulence-related protein. This group of ATPases are responsible for the export of flagellum and virulence-related proteins. The bacterial flagellar motor is similar to the F0F1-ATPase, in that they both are proton driven rotary molecular devices. However, the main function of the bacterial flagellar motor is to rotate the flagellar filament for cell motility. Intracellular pathogens such as Salmonella and Chlamydia also have proteins which are similar to the flagellar-specific ATPase, but function in the secretion of virulence-related proteins via the type III secretory pathway.. Length = 326 Score = 376 bits (968), Expect = e-105 Identities = 164/320 (51%), Positives = 221/320 (69%), Gaps = 4/320 (1%) Query: 101 WCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCH 160 GRV++A G+P+DG LGK ++ ++ P + R+ +++ TG+R ID + Sbjct: 10 LLGRVLDAFGEPLDGKGPLGK-EVRYPLLRTPPNPLKRRPIDEVLPTGVRAIDGLLTVGK 68 Query: 161 GQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLG-DNLKKSVV 219 GQR+G+FAGSG+GKSTLL M AR D +I+L+GERGREVREFIE LG + LK+SVV Sbjct: 69 GQRLGIFAGSGVGKSTLLGMIARGTTADVNVIALIGERGREVREFIEKDLGEEGLKRSVV 128 Query: 220 VVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVA 279 VVATSDESP+LR A TA IAEYF +G +VLL++DS+TRFA + REI +GE P Sbjct: 129 VVATSDESPLLRVKAAYTATAIAEYFRDQGKDVLLLMDSLTRFAMAQREIGLAAGEPPTT 188 Query: 280 RGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLN 339 +GYP SVF+ LPRLLER G S+K G+ITA +VLV+GD+ N+PIAD+VRSILDGHIVL+ Sbjct: 189 KGYPPSVFALLPRLLERAGNSDK--GSITAFYTVLVEGDDLNEPIADAVRSILDGHIVLS 246 Query: 340 RSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSLTHLIHRFEETRDIRLIGGYRPGV 399 R+LA G YP +D L S+SRL + + + K+ L L+ ++E D+ IG Y+ G Sbjct: 247 RALAAAGHYPAIDVLKSISRLMNAVVTPEHKEAARKLRELLSAYQEVEDLIRIGAYKKGS 306 Query: 400 DLILDKAVHQVPIIYDFLKQ 419 D +D+A+ +P I FLKQ Sbjct: 307 DPEVDEAIKLLPKIEAFLKQ 326 >gnl|CDD|143799 pfam00006, ATP-synt_ab, ATP synthase alpha/beta family, nucleotide-binding domain. This family includes the ATP synthase alpha and beta subunits, the ATP synthase associated with flagella and the termination factor Rho. Length = 213 Score = 292 bits (750), Expect = 1e-79 Identities = 123/214 (57%), Positives = 151/214 (70%), Gaps = 3/214 (1%) Query: 147 TGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKV-IISLVGERGREVREF 205 TGIR ID+ P+ GQRIG+F GSG GK+ LL M AR+ D V + L+GERGREV EF Sbjct: 1 TGIRAIDLLLPIGKGQRIGIFGGSGTGKTVLLGMIARNAKADVVEVYVLIGERGREVAEF 60 Query: 206 IEDYLG-DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAH 264 IE+ LG LK++VVV ATSDE P R +AP TA+TIAEYF +G +VLL+LDS+TRFA Sbjct: 61 IEELLGEGALKRTVVVAATSDEPPAERYLAPYTALTIAEYFRDQGKDVLLLLDSLTRFAR 120 Query: 265 SIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPI 324 ++REI+ GE P GYP S+FS+L RLLER G E G+ITA+ +VLV G + DPI Sbjct: 121 ALREISLLLGEPPGREGYPGSLFSDLARLLERAGKVE-GGGSITALPTVLVPGGDITDPI 179 Query: 325 ADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358 D+ SI DG IVL+R LAE G YP +D L SVS Sbjct: 180 PDNTISITDGQIVLSRELAERGIYPAIDILLSVS 213 >gnl|CDD|30404 COG0055, AtpD, F0F1-type ATP synthase, beta subunit [Energy production and conversion]. Length = 468 Score = 175 bits (445), Expect = 3e-44 Identities = 99/299 (33%), Positives = 157/299 (52%), Gaps = 9/299 (3%) Query: 103 GRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKG-FKTGIRVIDIFTPLCHG 161 GR+ N LG+PID + D + + P+ + +TGI+VID+ P G Sbjct: 88 GRIFNVLGEPIDEKGPIKAEDFEKWPIHRKAPSFEELSTKTEILETGIKVIDLLAPYAKG 147 Query: 162 QRIGVFAGSGIGKSTLLSMFARSDCFDKVIISL---VGERGREVREFIEDYLGDN-LKKS 217 +IG+F G+G+GK+ L+ + + S+ VGER RE + + L K+ Sbjct: 148 GKIGLFGGAGVGKTVLIQELINNIAKEHGGYSVFAGVGERTREGNDLYHEMKESGVLDKT 207 Query: 218 VVVVATSDESPILRKMAPLTAVTIAEYF-SSKGDNVLLILDSITRFAHSIREIATNSGEL 276 +V +E P R LT +T+AEYF +G +VLL +D+I RF + E++ G + Sbjct: 208 ALVFGQMNEPPGARMRVALTGLTMAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRM 267 Query: 277 PVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHI 336 P A GY ++ +E+ +L ERI + +KG+IT+V +V V D+ DP + + LD Sbjct: 268 PSAVGYQPTLATEMGQLQERI--TSTKKGSITSVQAVYVPADDLTDPAPATTFAHLDATT 325 Query: 337 VLNRSLAEEGRYPPVDPLASVSRLADKAWSADEK-KLVSSLTHLIHRFEETRDIRLIGG 394 VL+R +A G YP VDPL S SR D +E ++ + ++ R++E +DI I G Sbjct: 326 VLSRQIAALGIYPAVDPLDSTSRALDPKIVGEEHYEVAREVQSILQRYKELQDIIAILG 384 >gnl|CDD|29999 cd01133, F1-ATPase_beta, F1 ATP synthase beta subunit, nucleotide-binding domain. The F-ATPase is found in bacterial plasma membranes, mitochondrial inner membranes and in chloroplast thylakoid membranes. It has also been found in the archaea Methanosarcina barkeri. It uses a proton gradient to drive ATP synthesis and hydrolyzes ATP to build the proton gradient. The extrinisic membrane domain, F1, is composed of alpha, beta, gamma, delta and epsilon subunits with a stoichiometry of 3:3:1:1:1. The beta subunit of ATP synthase is catalytic.. Length = 274 Score = 174 bits (442), Expect = 6e-44 Identities = 95/266 (35%), Positives = 146/266 (54%), Gaps = 10/266 (3%) Query: 103 GRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQ 162 GR+ N LG+PID + K + I + P + + + +TGI+VID+ P G Sbjct: 12 GRIFNVLGEPIDERGPI-KTKKTWPIHREAPEFVEQSTKTEILETGIKVIDLLAPYAKGG 70 Query: 163 RIGVFAGSGIGKSTLL----SMFARSDCFDKVIISLVGERGREVREFIEDYLGDN-LKKS 217 +IG+F G+G+GK+ L+ + A++ V VGER RE + + L K+ Sbjct: 71 KIGLFGGAGVGKTVLIMELINNIAKAHGGYSVFAG-VGERTREGNDLYHEMKESGVLSKT 129 Query: 218 VVVVATSDESPILRKMAPLTAVTIAEYF-SSKGDNVLLILDSITRFAHSIREIATNSGEL 276 +V +E P R LT +T+AEYF +G +VLL +D+I RF + E++ G + Sbjct: 130 ALVYGQMNEPPGARARVALTGLTMAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRM 189 Query: 277 PVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHI 336 P A GY ++ +E+ L ERI + +KG+IT+V +V V D+ DP + + LD Sbjct: 190 PSAVGYQPTLATEMGALQERI--TSTKKGSITSVQAVYVPADDLTDPAPATTFAHLDATT 247 Query: 337 VLNRSLAEEGRYPPVDPLASVSRLAD 362 VL+R++AE G YP VDPL S SR+ D Sbjct: 248 VLSRAIAELGIYPAVDPLDSTSRILD 273 >gnl|CDD|31350 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion]. Length = 463 Score = 168 bits (426), Expect = 3e-42 Identities = 99/357 (27%), Positives = 167/357 (46%), Gaps = 22/357 (6%) Query: 56 SDNLGQVIRINLDIVYICPVGIGEEISLGD-LVFHWGR-FRISPSACWCGRVINALGKPI 113 GQV+ + D + + V G +I S GR+ N GKPI Sbjct: 40 EVRRGQVLEVRGDKAVVQVFEGTSGLDTKGTTVRFTGETLKIPVSEDLLGRIFNGSGKPI 99 Query: 114 DGDDSLGKGDLSMEIMSKVPPAMN---RQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGS 170 DG + D ++I +N R E+ +TGI ID L GQ++ +F+GS Sbjct: 100 DGGPEIVPEDR-LDING---APINPYARIYPEEFIQTGISAIDGMNTLVRGQKLPIFSGS 155 Query: 171 GIGKSTLLSMFAR------SDCFDKVIISLVGERGREVREFIEDY-LGDNLKKSVVVVAT 223 G+ + L + AR + V+ + +G E F++++ L ++V+ + Sbjct: 156 GLPHNELAAQIARQATVDGEEEEFAVVFAAMGITHEEALFFMDEFEETGALDRAVLFLNL 215 Query: 224 SDESPILRKMAPLTAVTIAEYFS-SKGDNVLLILDSITRFAHSIREIATNSGELPVARGY 282 +D+ + R + P A+T+AEY + K +VL+IL +T + ++REI+ E+P RGY Sbjct: 216 ADDPAVERIITPRMALTVAEYLAFEKDMHVLVILTDMTNYCEALREISAAREEVPGRRGY 275 Query: 283 PTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSL 342 P ++++L + ER G KG+IT + + + GD+ PI D I +G IVL+R L Sbjct: 276 PGYMYTDLATIYERAGRIRGRKGSITQIPILTMPGDDITHPIPDLTGYITEGQIVLSRDL 335 Query: 343 AEEGRYPPVDPLASVSRLADKAWS-----ADEKKLVSSLTHLIHRFEETRDIRLIGG 394 +G YPP++ L S+SRL D + + L + R++ + G Sbjct: 336 HRKGIYPPINVLPSLSRLMKDGIGEGKTREDHGDVSNQLYAAYAEGRDLRELVAVVG 392 >gnl|CDD|30001 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non-catalytic) subunit B. These ATPases couple ATP hydrolysis to the build up of a H+ gradient, but V-type ATPases do not catalyze the reverse reaction. The Vacuolar (V-type) ATPase is found in the membranes of vacuoles, the golgi apparatus and in other coated vesicles in eukaryotes. Archaea have a protein which is similar in sequence to V-ATPases, but functions like an F-ATPase (called A-ATPase). A similar protein is also found in a few bacteria. This subfamily consists of the non-catalytic beta subunit.. Length = 276 Score = 159 bits (404), Expect = 1e-39 Identities = 90/269 (33%), Positives = 144/269 (53%), Gaps = 15/269 (5%) Query: 103 GRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMN---RQRVEKGFKTGIRVIDIFTPLC 159 GR+ N GKPIDG + + ++I P +N R E+ +TGI ID L Sbjct: 12 GRIFNGSGKPIDGGPEILAEEY-LDING---PPINPVARIYPEEMIQTGISAIDGMNTLV 67 Query: 160 HGQRIGVFAGSGIGKSTLLSMFAR------SDCFDKVIISLVGERGREVREFIEDY-LGD 212 GQ+I +F+GSG+ + L + AR + V+ + +G + R F +D+ Sbjct: 68 RGQKIPIFSGSGLPHNELAAQIARQAGVVGEEENFAVVFAAMGITMEDARFFKDDFEETG 127 Query: 213 NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFS-SKGDNVLLILDSITRFAHSIREIAT 271 L++ V+ + +++ I R + P A+T AEY + KG +VL+IL +T +A ++REI+ Sbjct: 128 ALERVVLFLNLANDPTIERIITPRMALTTAEYLAYEKGKHVLVILTDMTNYAEALREISA 187 Query: 272 NSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRSI 331 E+P RGYP ++++L + ER G E G+IT + + + D+ PI D I Sbjct: 188 AREEVPGRRGYPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDDITHPIPDLTGYI 247 Query: 332 LDGHIVLNRSLAEEGRYPPVDPLASVSRL 360 +G IVL+R L G YPP++ L S+SRL Sbjct: 248 TEGQIVLDRQLHNRGIYPPINVLPSLSRL 276 >gnl|CDD|30405 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [Energy production and conversion]. Length = 504 Score = 152 bits (385), Expect = 2e-37 Identities = 96/332 (28%), Positives = 152/332 (45%), Gaps = 7/332 (2%) Query: 60 GQVIRINLDIVYICPVGIGEEISLGDLVFHWGRFRISP-SACWCGRVINALGKPIDGDDS 118 G + + D V +G +I GD V GR P GRV++ALG PIDG Sbjct: 61 GMALNLEEDSVGAVILGDYSDIKEGDEVKRTGRILEVPVGEELLGRVVDALGNPIDGKGP 120 Query: 119 LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLL 178 + + + K P M+R+ V + +TGI+ ID P+ GQR + GK+ + Sbjct: 121 I-DATKTRPVEKKAPGVMDRKSVNEPLQTGIKAIDALIPIGRGQRELIIGDRQTGKTAIA 179 Query: 179 --SMFARSDCFDKVIISLVGERGREVREFIEDYL-GDNLKKSVVVVATSDESPILRKMAP 235 ++ + K I +G++ V + + ++VV A++ +S L+ +AP Sbjct: 180 IDTIINQKGSGVKCIYVAIGQKRSTVANVVRTLEEHGAMDYTIVVAASASDSAPLQYLAP 239 Query: 236 LTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLE 295 +AEYF G +VL++ D +++ A + REI+ P YP VF RLLE Sbjct: 240 YAGCAMAEYFRDNGKDVLIVYDDLSKHAVAYREISLLLRRPPGREAYPGDVFYLHSRLLE 299 Query: 296 RIGP--SEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDP 353 R E G+ITA+ + + + I +V SI DG I L L G P ++ Sbjct: 300 RAAKLSDELGGGSITALPIIETQAGDVSAYIPTNVISITDGQIFLETDLFNAGIRPAINV 359 Query: 354 LASVSRLADKAWSADEKKLVSSLTHLIHRFEE 385 SVSR+ A KK+ SL ++ ++ E Sbjct: 360 GLSVSRVGSAAQIKAMKKVAGSLRLILAQYRE 391 >gnl|CDD|36564 KOG1350, KOG1350, KOG1350, F0F1-type ATP synthase, beta subunit [Energy production and conversion]. Length = 521 Score = 151 bits (383), Expect = 3e-37 Identities = 99/305 (32%), Positives = 157/305 (51%), Gaps = 17/305 (5%) Query: 103 GRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQ 162 GR++N +G+PID + K I ++ P + ++ TGI+V+D+ P G Sbjct: 134 GRIMNVIGEPIDERGPI-KSKKYSPIHAEAPEFVEMSVEQEILVTGIKVVDLLAPYAKGG 192 Query: 163 RIGVFAGSGIGKST----LLSMFARSDCFDKVIISLVGERGRE----VREFIED---YLG 211 +IG+F G+G+GK+ L++ A++ V VGER RE E IE L Sbjct: 193 KIGLFGGAGVGKTVLIMELINNIAKAHGGYSVFAG-VGERTREGNDLYHEMIESGVINLE 251 Query: 212 DNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSS-KGDNVLLILDSITRFAHSIREIA 270 K +V +E P R LT +T+AEYF +G +VLL +D+I RF + E++ Sbjct: 252 GETSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVS 311 Query: 271 TNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDPIADSVRS 330 G +P A GY ++ +++ + ERI + +KG+IT+V +V V D+ DP + + Sbjct: 312 ALLGRIPSAVGYQPTLATDMGTMQERI--TTTKKGSITSVQAVYVPADDLTDPAPATTFA 369 Query: 331 ILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEK-KLVSSLTHLIHRFEETRDI 389 LD VL+R +AE G YP VDPL S SR+ D +E + + + ++ +DI Sbjct: 370 HLDATTVLSRGIAELGIYPAVDPLDSTSRIMDPNIVGEEHYNVARGVQKTLQDYKSLQDI 429 Query: 390 RLIGG 394 I G Sbjct: 430 IAILG 434 >gnl|CDD|177000 CHL00060, atpB, ATP synthase CF1 beta subunit. Length = 494 Score = 126 bits (319), Expect = 9e-30 Identities = 101/288 (35%), Positives = 145/288 (50%), Gaps = 55/288 (19%) Query: 103 GRVINALGKPIDGDDSLGKGDLSMEIMS---KVPPAMNRQRVEKG--FKTGIRVIDIFTP 157 GR+ N LG+P+D G + S + PA Q K F+TGI+V+D+ P Sbjct: 104 GRIFNVLGEPVDN-----LGPVDTRTTSPIHRSAPAF-IQLDTKLSIFETGIKVVDLLAP 157 Query: 158 LCHGQRIGVFAGSGIGKSTLL--------------SMFARSDCFDKVIISLVGERGRE-- 201 G +IG+F G+G+GK+ L+ S+F VGER RE Sbjct: 158 YRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGG-----------VGERTREGN 206 Query: 202 -----VRE--FIEDYLGDNLKKSVV--VVATSDESPILRKMAPLTAVTIAEYF--SSKGD 250 ++E I + N+ +S V V +E P R LTA+T+AEYF +K D Sbjct: 207 DLYMEMKESGVINE---QNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNKQD 263 Query: 251 NVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAV 310 VLL +D+I RF + E++ G +P A GY ++ +E+ L ERI S KE G+IT++ Sbjct: 264 -VLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERI-TSTKE-GSITSI 320 Query: 311 ISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVS 358 +V V D+ DP + + LD VL+R LA +G YP VDPL S S Sbjct: 321 QAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTS 368 >gnl|CDD|29998 cd01132, F1_ATPase_alpha, F1 ATP synthase alpha, central domain. The F-ATPase is found in bacterial plasma membranes, mitochondrial inner membranes and in chloroplast thylakoid membranes. It has also been found in the archaea Methanosarcina barkeri. It uses a proton gradient to drive ATP synthesis and hydrolyzes ATP to build the proton gradient. The extrinisic membrane domain, F1, is composed of alpha, beta, gamma, delta and epsilon subunits with a stoichiometry of 3:3:1:1:1. The alpha subunit of the F1 ATP synthase can bind nucleotides, but is non-catalytic.. Length = 274 Score = 117 bits (296), Expect = 4e-27 Identities = 77/265 (29%), Positives = 129/265 (48%), Gaps = 10/265 (3%) Query: 103 GRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQ 162 GRV++ALG PIDG + + I SK P + R+ V + +TGI+ ID P+ GQ Sbjct: 12 GRVVDALGNPIDGKGPI-ETKERRPIESKAPGIIPRKSVNEPLQTGIKAIDAMIPIGRGQ 70 Query: 163 RIGVFAGSGIGKSTLL--SMFARSDCFDKVIISLVGERGREVREFI---EDYLGDNLKKS 217 R + GK+ + ++ + I +G++ V + + E++ ++ + Sbjct: 71 RELIIGDRQTGKTAIAIDTIINQKGKKVYCIYVAIGQKASTVAQVVKTLEEH--GAMEYT 128 Query: 218 VVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELP 277 +VV AT+ + L+ +AP T + EYF G + L+I D +++ A + R+++ P Sbjct: 129 IVVAATASDPAPLQYLAPYTGCAMGEYFMDNGKHALIIYDDLSKQAVAYRQMSLLLRRPP 188 Query: 278 VARGYPTSVFSELPRLLERIGPSEKEK--GNITAVISVLVDGDNHNDPIADSVRSILDGH 335 YP VF RLLER E G++TA+ + + + I +V SI DG Sbjct: 189 GREAYPGDVFYLHSRLLERAAKLNDELGGGSLTALPIIETQAGDVSAYIPTNVISITDGQ 248 Query: 336 IVLNRSLAEEGRYPPVDPLASVSRL 360 I L L +G P ++ SVSR+ Sbjct: 249 IFLETDLFNKGIRPAINVGLSVSRV 273 >gnl|CDD|31349 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion]. Length = 588 Score = 116 bits (293), Expect = 8e-27 Identities = 92/344 (26%), Positives = 156/344 (45%), Gaps = 33/344 (9%) Query: 121 KGDLSMEIMSKVP-----PAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKS 175 G++ +++M+ P P + E TG RVID P+ G V G GK+ Sbjct: 179 GGEVDVQMMTTWPVRKARPVKRKLPPEIPLVTGQRVIDTLFPVAKGGTAAVPGPFGSGKT 238 Query: 176 TLLSMFARSDCFDKVIISLVGERGREVREFIEDYL-------GDNLKKSVVVVATSDESP 228 ++ D VI GERG E+ E ++++ G L V++A + P Sbjct: 239 VSQHTLSKLADGDIVIYVGCGERGNEMTEVLQEFPELKDPNTGQPLMDRTVLIANTSNMP 298 Query: 229 ILRKMAPL-TAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVF 287 + + A + T +TIAEY+ G +V L+ DS +R+A ++REI+ E+P GYP + Sbjct: 299 VAAREASIYTGITIAEYYRDMGYDVALMADSTSRWAEALREISGRLEEMPGEEGYPAYLG 358 Query: 288 SELPRLLERIG-----PSEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSL 342 S L ER G E+ G+IT + +V G + ++P+ + ++ L+ +L Sbjct: 359 SRLAEFYERAGRVRLVSPEERFGSITVIGAVSPPGGDFSEPVTQNTLRVVRVFWALDAAL 418 Query: 343 AEEGRYPPVDPLASVSRLAD--KAW-----SADEKKLVSSLTHLIHRFEETRDI-RLIG- 393 A +P ++ L S S + ++W S + L ++ R E ++I +L+G Sbjct: 419 ANRRHFPSINWLNSYSLYTEDLRSWYDENVSPEWGALRDQAMEILQRESELQEIVQLVGY 478 Query: 394 -GYRPGVDLILDKAVHQVPIIYDFLKQSPSDLSSEDVFQEITKK 436 ILD A I DFL+Q+ D D + + K+ Sbjct: 479 DALPEKEKSILDVARI---IREDFLQQNAFD--EIDAYCSLRKQ 517 >gnl|CDD|30000 cd01134, V_A-ATPase_A, V/A-type ATP synthase catalytic subunit A. These ATPases couple ATP hydrolysis to the build up of a H+ gradient, but V-type ATPases do not catalyze the reverse reaction. The Vacuolar (V-type) ATPase is found in the membranes of vacuoles, the golgi apparatus and in other coated vesicles in eukaryotes. Archaea have a protein which is similar in sequence to V-ATPases, but functions like an F-ATPase (called A-ATPase). A similar protein is also found in a few bacteria.. Length = 369 Score = 115 bits (290), Expect = 2e-26 Identities = 73/242 (30%), Positives = 120/242 (49%), Gaps = 19/242 (7%) Query: 134 PAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL---LSMFARSDCFDKV 190 P + + TG RV+D P+ G + G GK+ + LS ++ SD V Sbjct: 130 PVKEKLPPNEPLLTGQRVLDTLFPVVKGGTAAIPGPFGCGKTVIQQSLSKYSNSDI---V 186 Query: 191 IISLVGERGREVREFIEDYL-------GDNLKKSVVVVATSDESPILRKMAPL-TAVTIA 242 I GERG E+ E +E++ G+ L K V++A + P+ + A + T +TIA Sbjct: 187 IYVGCGERGNEMTEVLEEFPELTDPVTGEPLMKRTVLIANTSNMPVAAREASIYTGITIA 246 Query: 243 EYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGP--- 299 EYF G NV L+ DS +R+A ++REI+ E+P GYP + + L ER G Sbjct: 247 EYFRDMGYNVALMADSTSRWAEALREISGRLEEMPGEEGYPAYLGARLASFYERAGRVKC 306 Query: 300 --SEKEKGNITAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASV 357 S +G++T V +V G + ++P+ + I+ L++ LA+ +P ++ L S Sbjct: 307 LGSPGREGSVTIVGAVSPPGGDFSEPVTQATLRIVQVFWGLDKKLAQRRHFPSINWLISY 366 Query: 358 SR 359 S+ Sbjct: 367 SK 368 >gnl|CDD|36565 KOG1351, KOG1351, KOG1351, Vacuolar H+-ATPase V1 sector, subunit B [Energy production and conversion]. Length = 489 Score = 113 bits (283), Expect = 1e-25 Identities = 76/289 (26%), Positives = 140/289 (48%), Gaps = 18/289 (6%) Query: 93 FRISPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVI 152 R S GR+ N GKPID + D ++I + R E+ +TGI I Sbjct: 96 LRTPVSEDMLGRIFNGSGKPIDKGPPVLAEDY-LDINGQPINPYARIYPEEMIQTGISAI 154 Query: 153 DIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDK---------------VIISLVGE 197 D+ + GQ+I +F+ +G+ + + + R K ++ + +G Sbjct: 155 DVMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKRPEKDVHDGHEDNFAIVFAAMGV 214 Query: 198 RGREVREFIEDYLGD-NLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSK-GDNVLLI 255 R F +D+ + ++++ + + +++ I R + P A+T AE+ + + +VL+I Sbjct: 215 NMETARFFKQDFEENGSMERVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVI 274 Query: 256 LDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLV 315 L ++ +A ++RE++ E+P RGYP ++++L + ER G E G+IT + + + Sbjct: 275 LTDMSSYADALREVSAAREEVPGRRGYPGYMYTDLATIYERAGRVEGRNGSITQIPILTM 334 Query: 316 DGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKA 364 D+ PI D I +G I ++R L YPP++ L S+SRL A Sbjct: 335 PNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSA 383 >gnl|CDD|36566 KOG1352, KOG1352, KOG1352, Vacuolar H+-ATPase V1 sector, subunit A [Energy production and conversion]. Length = 618 Score = 98.9 bits (246), Expect = 2e-21 Identities = 67/232 (28%), Positives = 115/232 (49%), Gaps = 23/232 (9%) Query: 147 TGIRVIDIFTPLCHGQRIGVFAGSGIGKSTL---LSMFARSDCFDKVIISL-VGERGREV 202 TG RV+D P G + G GK+ + LS ++ SD II + GERG E+ Sbjct: 231 TGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSD----AIIYVGCGERGNEM 286 Query: 203 REFIEDY---------LGDNLKKSVVVVATSDESPILRKMAPL-TAVTIAEYFSSKGDNV 252 E + D+ +++ K +VA + P+ + A + T +T++EYF G NV Sbjct: 287 SEVLMDFPELTMEVDGKTESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYNV 346 Query: 253 LLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGP-----SEKEKGNI 307 ++ DS +R+A ++REI+ E+P GYP + + L ER G S +G++ Sbjct: 347 SMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGSPDREGSV 406 Query: 308 TAVISVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSR 359 + V +V G + +DP+ + I+ L++ LA+ +P ++ L S S+ Sbjct: 407 SIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSINWLISYSK 458 >gnl|CDD|176999 CHL00059, atpA, ATP synthase CF1 alpha subunit. Length = 485 Score = 93.9 bits (234), Expect = 8e-20 Identities = 98/338 (28%), Positives = 158/338 (46%), Gaps = 40/338 (11%) Query: 56 SDNLGQVIRINLDIVYICPVGIGEEISLGDLVFHWGRF-RISPSACWCGRVINALGKPID 114 S+N+G V+ +G G I G V G+ +I S + GRV+NAL KPID Sbjct: 47 SNNVGVVL-----------MGDGLMIQEGSSVKATGKIAQIPVSEAYLGRVVNALAKPID 95 Query: 115 GDDSLGKGDLSME----IMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGS 170 G KG++S I S P ++R+ V + +TG+ ID P+ GQR + Sbjct: 96 G-----KGEISASESRLIESPAPGIISRRSVYEPLQTGLIAIDSMIPIGRGQRELIIGDR 150 Query: 171 GIGKS-----TLLSMFARSDCFDKVIISLV--GERG---REVREFIEDYLGDNLKKSVVV 220 GK+ T+L+ + VI V G++ +V +++ ++ ++VV Sbjct: 151 QTGKTAVATDTILNQKGQ-----NVICVYVAIGQKASSVAQVVTTLQE--RGAMEYTIVV 203 Query: 221 VATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVAR 280 T+D L+ +AP T +AEYF +G + L+I D +++ A + R+++ P Sbjct: 204 AETADSPATLQYLAPYTGAALAEYFMYRGRHTLIIYDDLSKQAQAYRQMSLLLRRPPGRE 263 Query: 281 GYPTSVFSELPRLLERIGPSEKE--KGNITAVISVLVDGDNHNDPIADSVRSILDGHIVL 338 YP VF RLLER + +G++TA+ V + + I +V SI DG I L Sbjct: 264 AYPGDVFYLHSRLLERAAKLSSQLGEGSMTALPIVETQAGDVSAYIPTNVISITDGQIFL 323 Query: 339 NRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSL 376 + L G P ++ SVSR+ A K++ L Sbjct: 324 SADLFNAGIRPAINVGISVSRVGSAAQIKAMKQVAGKL 361 >gnl|CDD|29994 cd01128, rho_factor, Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase. It is a homohexamer. Each monomer consists of an N-terminal domain of the OB fold, which is responsible for binding to cysteine rich nucleotides. This alignment is of the C-terminal ATP binding domain.. Length = 249 Score = 76.4 bits (188), Expect = 1e-14 Identities = 66/256 (25%), Positives = 114/256 (44%), Gaps = 29/256 (11%) Query: 150 RVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARS------DCFDKVIISLVGERGREVR 203 RV+D+F P+ GQR + A GK+TLL A + + + +I+ L+ ER EV Sbjct: 5 RVVDLFAPIGKGQRGLIVAPPKAGKTTLLQSIANAITKNHPEVY--LIVLLIDERPEEVT 62 Query: 204 EFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFA 263 + G+ V+ +T DE P + A+ G +V+++LDSITR A Sbjct: 63 DMQRSVKGE------VIASTFDEPPERHVQVAEMVLEKAKRLVEHGKDVVILLDSITRLA 116 Query: 264 HSIREIATNSGEL------PVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVD- 316 + + SG++ A P F R +E E G++T + + LVD Sbjct: 117 RAYNTVVPPSGKILSGGVDANALHKPKRFFGA-ARNIE-------EGGSLTIIATALVDT 168 Query: 317 GDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSL 376 G +D I + + + +VL+R LAE +P +D L S +R + +E + + L Sbjct: 169 GSRMDDVIFEEFKGTGNMELVLDRRLAERRIFPAIDILKSGTRKEELLLDPEELQRMWLL 228 Query: 377 THLIHRFEETRDIRLI 392 ++ + + + Sbjct: 229 RRVLSDMDPIEAMEFL 244 >gnl|CDD|29986 cd01120, RecA-like_NTPases, RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.. Length = 165 Score = 73.2 bits (179), Expect = 1e-13 Identities = 56/185 (30%), Positives = 84/185 (45%), Gaps = 27/185 (14%) Query: 163 RIGVFAGSGIGKSTLLSMFAR--SDCFDKVIISLVGERGREVREF-IEDYLGDNLKKSVV 219 I VF +G GK+TL A + KV+ + E E+ E I + L L ++ Sbjct: 1 LILVFGPTGSGKTTLALQLALNIATKGGKVVYVDIEEEIEELTERLIGESLKGALDNLII 60 Query: 220 VVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREIATNSGELPVA 279 V AT+D+ R + + AE +G + L+ILD +TR ++REI Sbjct: 61 VFATADDPAAARLL------SKAERLRERGGDDLIILDELTRLVRALREI---------R 105 Query: 280 RGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVDGDNHNDP----IADSVRSILDGH 335 GYP + EL LLER KG +T + ++ V + DP A ++ I D Sbjct: 106 EGYPGELDEELRELLERAR-----KGGVTVIFTLQVPSGDKGDPRLTRGAQNLEDIADTV 160 Query: 336 IVLNR 340 IVL+R Sbjct: 161 IVLSR 165 >gnl|CDD|31352 COG1158, Rho, Transcription termination factor [Transcription]. Length = 422 Score = 72.6 bits (178), Expect = 2e-13 Identities = 69/256 (26%), Positives = 116/256 (45%), Gaps = 29/256 (11%) Query: 150 RVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARS------DCFDKVIISLVGERGREVR 203 RVID+ +P+ GQR + A GK+TLL A + +C ++I+ L+ ER EV Sbjct: 162 RVIDLISPIGKGQRGLIVAPPKAGKTTLLQNIANAITTNHPEC--ELIVLLIDERPEEVT 219 Query: 204 EFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFA 263 + G+ VV +T DE P + A+ G +V+++LDSITR A Sbjct: 220 DMQRSVKGE------VVASTFDEPPSRHVQVAEMVIEKAKRLVEHGKDVVILLDSITRLA 273 Query: 264 HSIREIATNSGEL------PVARGYPTSVFSELPRLLERIGPSEKEKGNITAVISVLVD- 316 + + +SG++ A P F R +E E G++T + + LVD Sbjct: 274 RAYNTVVPSSGKVLSGGVDANALHRPKRFFGA-ARNIE-------EGGSLTIIATALVDT 325 Query: 317 GDNHNDPIADSVRSILDGHIVLNRSLAEEGRYPPVDPLASVSRLADKAWSADEKKLVSSL 376 G ++ I + + + + L+R LAE +P +D S +R + S DE + + L Sbjct: 326 GSRMDEVIFEEFKGTGNMELHLDRKLAERRIFPAIDINKSGTRKEELLLSPDELQKMWVL 385 Query: 377 THLIHRFEETRDIRLI 392 ++ +E I + Sbjct: 386 RRILSPMDEIDAIEFL 401 >gnl|CDD|36567 KOG1353, KOG1353, KOG1353, F0F1-type ATP synthase, alpha subunit [Energy production and conversion]. Length = 340 Score = 45.7 bits (108), Expect = 2e-05 Identities = 46/194 (23%), Positives = 84/194 (43%), Gaps = 21/194 (10%) Query: 60 GQVIRINLDIVYICPVGIGEEISLGDLVFHWGRF-RISPSACWCGRVINALGKPIDGDDS 118 G + + + V + G I GD V + P GRV ALG+PID Sbjct: 54 GMALNLEGENVGVVVFGEDSLIKEGDTVKRTAAISDVPPLKALLGRVGCALGEPID---- 109 Query: 119 LGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKS--- 175 G G +S + +P R V++ +TG++ +D P+ GQR + GK+ Sbjct: 110 -GNGKISAKERRIIP----RASVDEPMQTGLKAVDSLVPIGRGQRELIIGDRQTGKTSLA 164 Query: 176 --TLLSMFARSDCFD-----KVIISLVGERGREVREFIEDYL-GDNLKKSVVVVATSDES 227 T+L+ ++C D + +G++ V + ++ D ++ S+VV AT+ ++ Sbjct: 165 IDTILNQKRGNECLDEKKKIYCVYVAIGQKRSTVAQLVQRLEEADAMEYSIVVAATASQA 224 Query: 228 PILRKMAPLTAVTI 241 + P ++I Sbjct: 225 GDVSAYIPTNVISI 238 >gnl|CDD|146027 pfam03193, DUF258, Protein of unknown function, DUF258. Length = 161 Score = 32.9 bits (76), Expect = 0.18 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Query: 152 IDIFTPLCHGQRIGVFAG-SGIGKSTLL 178 I+ PL G + V AG SG+GKSTLL Sbjct: 26 IEELKPLLKG-KTSVLAGQSGVGKSTLL 52 >gnl|CDD|111391 pfam02487, CLN3, CLN3 protein. This is a family of proteins from the CLN3 gene. A missense mutation of glutamic acid (E) to lysine (K) at position 295 in the human protein has been implicated in Juvenile neuronal ceroid lipofuscinosis (Batten disease). Length = 409 Score = 32.1 bits (73), Expect = 0.28 Identities = 16/42 (38%), Positives = 23/42 (54%) Query: 228 PILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHSIREI 269 P+L M PL V +AEY ++G LL+ D F+ S+R Sbjct: 246 PLLFYMVPLATVYLAEYMINQGLTELLLFDCSHGFSLSLRSQ 287 >gnl|CDD|73048 cd03289, ABCC_CFTR2, The CFTR subfamily domain 2. The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia. Use of the term assembly of a functional ion channel implies the coming together of subunits or at least smaller not-yet functional components of the active whole. In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells. CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.. Length = 275 Score = 31.5 bits (71), Expect = 0.49 Identities = 14/23 (60%), Positives = 17/23 (73%) Query: 161 GQRIGVFAGSGIGKSTLLSMFAR 183 GQR+G+ +G GKSTLLS F R Sbjct: 30 GQRVGLLGRTGSGKSTLLSAFLR 52 >gnl|CDD|35278 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]. Length = 1228 Score = 31.0 bits (70), Expect = 0.61 Identities = 17/63 (26%), Positives = 27/63 (42%), Gaps = 9/63 (14%) Query: 121 KGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSM 180 KG++ + P+ ++ KG I GQ + + SG GKSTL+ + Sbjct: 348 KGEIEFRNVCFSYPSRPDVKILKGVSLKIP---------SGQTVALVGPSGSGKSTLIQL 398 Query: 181 FAR 183 AR Sbjct: 399 LAR 401 >gnl|CDD|30815 COG0467, RAD55, RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]. Length = 260 Score = 31.2 bits (70), Expect = 0.63 Identities = 37/217 (17%), Positives = 69/217 (31%), Gaps = 29/217 (13%) Query: 143 KGFKTGIRVIDIFTP--LCHGQRIGVFAGSGIGKSTLLSMFARSDC--FDKVIISLVGER 198 + TGI +D L G + + G GK+ F + V+ E Sbjct: 3 ERIPTGIPGLDEILGGGLPRGSVVLITGPPGTGKTIFALQFLYEGAREGEPVLYVSTEES 62 Query: 199 GREVRE-------FIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDN 251 E+ E +E Y+ K ++ A E ++ + + Sbjct: 63 PEELLENARSFGWDLEVYIEKG--KLAILDAFLSEKGLVSIVVGDPLDL---------EE 111 Query: 252 VLLILDSITRFAHSIREIATNSGELPVARGYPTSVFSELPRLLERIGPSEKEKGNITAVI 311 +L + I + R + + EL + P V L L + +K +T+++ Sbjct: 112 LLDRIREIVEKEGADRVVIDSITELTLYLNDPALVRRILLLLKRFL-----KKLGVTSLL 166 Query: 312 SVLVDGDNHNDPIADSVRSILDGHIVLNRSLAEEGRY 348 + + I+DG I L+ E G Sbjct: 167 --TTEAPVEERGESGVEEYIVDGVIRLDLKEIEGGGD 201 >gnl|CDD|30834 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]. Length = 530 Score = 31.0 bits (70), Expect = 0.64 Identities = 14/56 (25%), Positives = 26/56 (46%) Query: 139 QRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISL 194 + + + + ++ L G+RIG+ +G GKSTLL + A D ++ Sbjct: 7 ENLSLAYGDRPLLENVSLTLNPGERIGLVGRNGAGKSTLLKILAGELEPDSGEVTR 62 Score = 29.5 bits (66), Expect = 2.1 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Query: 141 VEKGFKTGIRVIDIFT-PLCHGQRIGVFAGSGIGKSTLLSMFA 182 V KG+ G ++ + + G RI + +G GKSTLL + A Sbjct: 327 VSKGYDGGRLLLKDLSFRIDRGDRIAIVGPNGAGKSTLLKLLA 369 >gnl|CDD|32455 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]. Length = 709 Score = 30.6 bits (69), Expect = 0.80 Identities = 9/23 (39%), Positives = 14/23 (60%) Query: 161 GQRIGVFAGSGIGKSTLLSMFAR 183 G+++ + SG GKSTLL + Sbjct: 499 GEKVAIVGRSGSGKSTLLKLLLG 521 >gnl|CDD|30653 COG0305, DnaB, Replicative DNA helicase [DNA replication, recombination, and repair]. Length = 435 Score = 30.6 bits (69), Expect = 0.90 Identities = 23/78 (29%), Positives = 30/78 (38%), Gaps = 6/78 (7%) Query: 122 GDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIFT-PLCHGQRIGVFAGSGIGKSTLLSM 180 GDL E M ++ + G TG +D T G I V A G+GK+ L Sbjct: 157 GDLLKETMDEIEARFENGGL-IGVPTGFTDLDEITSGFRPGDLIIVAARPGMGKTALALN 215 Query: 181 FARSDCFDK----VIISL 194 A + D I SL Sbjct: 216 IALNAAADGRKPVAIFSL 233 >gnl|CDD|33919 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]. Length = 228 Score = 30.7 bits (69), Expect = 0.95 Identities = 13/37 (35%), Positives = 21/37 (56%) Query: 161 GQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGE 197 G+ + + SG GKSTLL++ A D + L+G+ Sbjct: 36 GETVAIVGPSGSGKSTLLAVLAGLDDPSSGEVRLLGQ 72 >gnl|CDD|35285 KOG0062, KOG0062, KOG0062, ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism, Translation, ribosomal structure and biogenesis]. Length = 582 Score = 30.3 bits (68), Expect = 1.1 Identities = 13/29 (44%), Positives = 16/29 (55%) Query: 158 LCHGQRIGVFAGSGIGKSTLLSMFARSDC 186 L G+R G+ +GIGKSTLL A Sbjct: 103 LSRGRRYGLVGRNGIGKSTLLRAIANGQV 131 >gnl|CDD|72987 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export. They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins. The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities. The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 171 Score = 30.4 bits (69), Expect = 1.1 Identities = 10/24 (41%), Positives = 15/24 (62%) Query: 160 HGQRIGVFAGSGIGKSTLLSMFAR 183 G+++ + SG GKSTLL + R Sbjct: 27 PGEKVAIVGPSGSGKSTLLKLLLR 50 >gnl|CDD|73015 cd03256, ABC_PhnC_transporter, ABC-type phosphate/phosphonate transport system. Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond. Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond. Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 241 Score = 30.1 bits (68), Expect = 1.2 Identities = 12/46 (26%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Query: 139 QRVEKGFKTGIRVI-DIFTPLCHGQRIGVFAGSGIGKSTLLSMFAR 183 + + K + G + + D+ + G+ + + SG GKSTLL Sbjct: 4 ENLSKTYPNGKKALKDVSLSINPGEFVALIGPSGAGKSTLLRCLNG 49 >gnl|CDD|72980 cd03221, ABCF_EF-3, ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth. EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site. The reaction requires ATP hydrolysis. EF-3 contains two ATP nucleotide binding sequence (NBS) motifs. NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.. Length = 144 Score = 30.0 bits (68), Expect = 1.3 Identities = 15/44 (34%), Positives = 24/44 (54%) Query: 139 QRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFA 182 + + K + + + DI + G RIG+ +G GKSTLL + A Sbjct: 4 ENLSKTYGGKLLLKDISLTINPGDRIGLVGRNGAGKSTLLKLIA 47 >gnl|CDD|72971 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 157 Score = 29.9 bits (67), Expect = 1.5 Identities = 10/45 (22%), Positives = 20/45 (44%) Query: 139 QRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFAR 183 + + + + ++ L G+ + + +G GKSTLL A Sbjct: 3 ENLSFRYGGRTALDNVSLTLKAGEIVALVGPNGSGKSTLLRAIAG 47 >gnl|CDD|34592 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]. Length = 573 Score = 29.8 bits (67), Expect = 1.6 Identities = 14/44 (31%), Positives = 23/44 (52%) Query: 161 GQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVRE 204 G+++ + SG GKSTLL + A + + I+L G + E Sbjct: 364 GEKVAILGRSGSGKSTLLQLLAGAWDPQQGSITLNGVEIASLDE 407 >gnl|CDD|39383 KOG4181, KOG4181, KOG4181, Uncharacterized conserved protein [Function unknown]. Length = 491 Score = 29.7 bits (66), Expect = 1.6 Identities = 23/98 (23%), Positives = 34/98 (34%), Gaps = 13/98 (13%) Query: 96 SPSACWCGRVINALGKPIDGDDSLGKGDLSMEIMSKVPPAMNRQRVEKGFKTGIRVIDIF 155 +PS+ ++++ +P D G S P ++ K +I Sbjct: 114 APSSSVKAALVSS--RPTSRDKGSCSGGAGTAATSAGAPNALQELQPPRMKRSTPLIVDN 171 Query: 156 TPLCHGQR-----------IGVFAGSGIGKSTLLSMFA 182 R IGV G G GKSTLLS+ A Sbjct: 172 GIFNDNARKLLHKTTDFTVIGVLGGQGSGKSTLLSLLA 209 >gnl|CDD|33436 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 258 Score = 29.4 bits (66), Expect = 1.8 Identities = 12/44 (27%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Query: 141 VEKGFKTGIRVI-DIFTPLCHGQRIGVFAGSGIGKSTLLSMFAR 183 + K + G + + D+ + G+ + + SG GKSTLL Sbjct: 9 LSKTYPGGHQALKDVNLEINQGEMVAIIGPSGAGKSTLLRSLNG 52 >gnl|CDD|37944 KOG2733, KOG2733, KOG2733, Uncharacterized membrane protein [Function unknown]. Length = 423 Score = 29.5 bits (66), Expect = 1.9 Identities = 18/79 (22%), Positives = 38/79 (48%), Gaps = 3/79 (3%) Query: 166 VFAGSGIGKSTLLSMFARSDCFDKVIISLVG---ERGREVREFIEDYLGDNLKKSVVVVA 222 ++ SG ++ S F+ + +++ G ++ +EV E + + G +L SV+++A Sbjct: 10 IYGASGFTGKYIVEEAVSSQVFEGLSLAVAGRNEKKLQEVLEKVGEKTGTDLSSSVILIA 69 Query: 223 TSDESPILRKMAPLTAVTI 241 S L +MA V + Sbjct: 70 DSANEASLDEMAKQARVIV 88 >gnl|CDD|31297 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only]. Length = 219 Score = 29.2 bits (64), Expect = 2.1 Identities = 19/85 (22%), Positives = 31/85 (36%), Gaps = 4/85 (4%) Query: 163 RIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGREVREFIEDYLGDNLKKSVVVVA 222 +I V G+GK+TLL+ + F + +G + N+K + A Sbjct: 7 KIVVLGDGGVGKTTLLNRLVGDE-FPEGYPPTIGN---LDPAKTIEPYRRNIKLQLWDTA 62 Query: 223 TSDESPILRKMAPLTAVTIAEYFSS 247 +E LR A I + S Sbjct: 63 GQEEYRSLRPEYYRGANGILIVYDS 87 >gnl|CDD|73018 cd03259, ABC_Carb_Solutes_like, ABC Carbohydrate and Solute Transporters-like subgroup. This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 213 Score = 29.3 bits (66), Expect = 2.2 Identities = 11/44 (25%), Positives = 23/44 (52%) Query: 139 QRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFA 182 + + K + + + D+ + G+ + + SG GK+TLL + A Sbjct: 4 KGLSKTYGSVRALDDLSLTVEPGEFLALLGPSGCGKTTLLRLIA 47 >gnl|CDD|31356 COG1162, COG1162, Predicted GTPases [General function prediction only]. Length = 301 Score = 29.1 bits (65), Expect = 2.4 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Query: 163 RIGVFAG-SGIGKSTLLSMFARSDCFDKVIISLVGERGR 200 +I V G SG+GKSTL++ IS RGR Sbjct: 165 KITVLLGQSGVGKSTLINALLPELNQKTGEISEKLGRGR 203 >gnl|CDD|31330 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 339 Score = 29.1 bits (65), Expect = 2.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Query: 160 HGQRIGVFAGSGIGKSTLLSMFAR 183 G+ G+ SG GKSTLL + Sbjct: 31 KGEIFGIIGYSGAGKSTLLRLINL 54 >gnl|CDD|57925 cd01854, YjeQ_engC, YjeQ/EngC. YjeQ (YloQ in Bacillus subtilis) represents a protein family whose members are broadly conserved in bacteria and have been shown to be essential to the growth of E. coli and B. subtilis. Proteins of the YjeQ family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. All YjeQ family proteins display a unique domain architecture, which includes an N-terminal OB-fold RNA-binding domain, the central permuted GTPase domain, and a zinc knuckle-like C-terminal cysteine domain. This domain architecture suggests a role for YjeQ as a regulator of translation.. Length = 287 Score = 29.0 bits (65), Expect = 2.4 Identities = 16/50 (32%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Query: 152 IDIFTPLCHGQRIGVFAG-SGIGKSTLLSMFARSDCFDKVIISLVGERGR 200 +D G + V G SG+GKSTL++ IS RGR Sbjct: 152 LDELREYLKG-KTSVLVGQSGVGKSTLINALLPDLDLATGEISEKLGRGR 200 >gnl|CDD|73056 cd03297, ABC_ModC_molybdenum_transporter, ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 214 Score = 29.0 bits (65), Expect = 2.4 Identities = 15/38 (39%), Positives = 19/38 (50%) Query: 159 CHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVG 196 + + G+F SG GKSTLL A + D I L G Sbjct: 21 LNEEVTGIFGASGAGKSTLLRCIAGLEKPDGGTIVLNG 58 >gnl|CDD|31321 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]. Length = 252 Score = 29.0 bits (65), Expect = 2.6 Identities = 10/25 (40%), Positives = 15/25 (60%) Query: 158 LCHGQRIGVFAGSGIGKSTLLSMFA 182 + G+ +G+ SG GKSTL + A Sbjct: 30 IERGETLGIVGESGSGKSTLARLLA 54 >gnl|CDD|29988 cd01122, GP4d_helicase, GP4d_helicase is a homohexameric 5'-3' helicases. Helicases couple NTP hydrolysis to the unwinding of nucleic acid duplexes into their component strands.. Length = 271 Score = 28.7 bits (64), Expect = 3.2 Identities = 10/26 (38%), Positives = 16/26 (61%) Query: 161 GQRIGVFAGSGIGKSTLLSMFARSDC 186 G+ I + AG+G+GK+T L +A Sbjct: 30 GELIILTAGTGVGKTTFLREYALDLI 55 >gnl|CDD|72995 cd03236, ABC_RNaseL_inhibitor_domain1, The ATPase domain 1 of RNase L inhibitor. The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI s are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLIs have an N-terminal Fe-S domain and two nucleotide binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.. Length = 255 Score = 28.3 bits (63), Expect = 3.9 Identities = 18/69 (26%), Positives = 31/69 (44%), Gaps = 14/69 (20%) Query: 161 GQRIGVFAGSGIGKSTLLSMFA-----------RSDCFDKVIISLVGERGREVREFIEDY 209 GQ +G+ +GIGKST L + A +D+++ RG E++ + Sbjct: 26 GQVLGLVGPNGIGKSTALKILAGKLKPNLGKFDDPPDWDEILDEF---RGSELQNYFTKL 82 Query: 210 LGDNLKKSV 218 L ++K V Sbjct: 83 LEGDVKVIV 91 >gnl|CDD|33632 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]. Length = 231 Score = 28.3 bits (63), Expect = 3.9 Identities = 10/22 (45%), Positives = 15/22 (68%) Query: 161 GQRIGVFAGSGIGKSTLLSMFA 182 G+ + + SG GKSTLL++ A Sbjct: 25 GEIVAILGPSGAGKSTLLNLIA 46 >gnl|CDD|31313 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 248 Score = 28.2 bits (63), Expect = 4.3 Identities = 12/41 (29%), Positives = 18/41 (43%) Query: 161 GQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGERGRE 201 G+ + + SG GKSTLL + A + + L G Sbjct: 29 GEFVAILGPSGCGKSTLLRLIAGLEKPTSGEVLLDGRPVTG 69 >gnl|CDD|34593 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]. Length = 559 Score = 28.2 bits (63), Expect = 4.5 Identities = 10/22 (45%), Positives = 13/22 (59%) Query: 161 GQRIGVFAGSGIGKSTLLSMFA 182 GQ + SG GKSTLL++ Sbjct: 347 GQLTALVGASGAGKSTLLNLLL 368 >gnl|CDD|36760 KOG1547, KOG1547, KOG1547, Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning, Signal transduction mechanisms, Cytoskeleton]. Length = 336 Score = 28.0 bits (62), Expect = 4.8 Identities = 19/93 (20%), Positives = 31/93 (33%), Gaps = 27/93 (29%) Query: 124 LSMEIMSKVPPA------------MNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSG 171 + M+ MS M ++ ++ GF I V+ SG Sbjct: 12 VPMKPMSINSNLLGYVGIDTIIEQMRKKTMKTGFDFNIMVV---------------GQSG 56 Query: 172 IGKSTLLSMFARSDCFDKVIISLVGERGREVRE 204 +GKSTL++ +S D E + E Sbjct: 57 LGKSTLINTLFKSHVSDSSSSDNSAEPIPKTTE 89 >gnl|CDD|145639 pfam02600, DsbB, Disulfide bond formation protein DsbB. This family consists of disulfide bond formation protein DsbB from bacteria. The DsbB protein oxidizes the periplasmic protein DsbA which in turn oxidizes cysteines in other periplasmic proteins in order to make disulfide bonds. DsbB acts as a redox potential transducer across the cytoplasmic membrane and is an integral membrane protein. DsbB posses six cysteines four of which are necessary for it proper function in vivo. Length = 159 Score = 28.0 bits (63), Expect = 4.8 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Query: 157 PLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVG 196 PLC QRI + A + IG LL++ A ++ + L Sbjct: 38 PLCIYQRIAMLALALIG---LLALLAGRRGRRRLALLLAL 74 >gnl|CDD|72979 cd03220, ABC_KpsT_Wzt, ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export. Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2.. Length = 224 Score = 28.2 bits (63), Expect = 5.0 Identities = 12/23 (52%), Positives = 16/23 (69%) Query: 161 GQRIGVFAGSGIGKSTLLSMFAR 183 G+RIG+ +G GKSTLL + A Sbjct: 48 GERIGLIGRNGAGKSTLLRLLAG 70 >gnl|CDD|31315 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]. Length = 345 Score = 28.0 bits (62), Expect = 5.6 Identities = 15/44 (34%), Positives = 22/44 (50%) Query: 139 QRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFA 182 V+K F + DI + G+ + + SG GKSTLL + A Sbjct: 6 NNVKKRFGAFGALDDISLDIKSGELVALLGPSGAGKSTLLRIIA 49 >gnl|CDD|35310 KOG0087, KOG0087, KOG0087, GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]. Length = 222 Score = 28.0 bits (62), Expect = 5.7 Identities = 10/21 (47%), Positives = 13/21 (61%) Query: 163 RIGVFAGSGIGKSTLLSMFAR 183 +I + S +GKS LLS F R Sbjct: 16 KIVLIGDSAVGKSNLLSRFTR 36 >gnl|CDD|33633 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]. Length = 352 Score = 28.0 bits (62), Expect = 6.1 Identities = 18/50 (36%), Positives = 25/50 (50%) Query: 133 PPAMNRQRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFA 182 PA+ + V K F V DI + G+ + + SG GK+TLL M A Sbjct: 3 KPALEIRNVSKSFGDFTAVDDISLDIKKGEFVTLLGPSGCGKTTLLRMIA 52 >gnl|CDD|133266 cd01863, Rab18, Rab18 subfamily. Mammalian Rab18 is implicated in endocytic transport and is expressed most highly in polarized epithelial cells. However, trypanosomal Rab, TbRAB18, is upregulated in the BSF (Blood Stream Form) stage and localized predominantly to elements of the Golgi complex. In human and mouse cells, Rab18 has been identified in lipid droplets, organelles that store neutral lipids. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation. Length = 161 Score = 27.6 bits (62), Expect = 6.2 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Query: 170 SGIGKSTLLSMFARSDCFDKVIISLVG 196 SG+GKS+LL F D FD + + +G Sbjct: 9 SGVGKSSLLLRFT-DDTFDPDLAATIG 34 >gnl|CDD|73006 cd03247, ABCC_cytochrome_bd, The CYD subfamily implicated in cytochrome bd biogenesis. The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes. CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space. In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.. Length = 178 Score = 27.9 bits (62), Expect = 6.3 Identities = 10/23 (43%), Positives = 14/23 (60%) Query: 161 GQRIGVFAGSGIGKSTLLSMFAR 183 G++I + SG GKSTLL + Sbjct: 28 GEKIALLGRSGSGKSTLLQLLTG 50 >gnl|CDD|73047 cd03288, ABCC_SUR2, The SUR domain 2. The sulfonylurea receptor SUR is an ATP binding cassette (ABC) protein of the ABCC/MRP family. Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel. Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism. It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.. Length = 257 Score = 27.7 bits (61), Expect = 6.4 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 161 GQRIGVFAGSGIGKSTL-LSMFARSDCFDKVII 192 GQ++G+ +G GKS+L L+ F D FD I+ Sbjct: 47 GQKVGICGRTGSGKSSLSLAFFRMVDIFDGKIV 79 >gnl|CDD|39083 KOG3880, KOG3880, KOG3880, Predicted small molecule transporter involved in cellular pH homeostasis (Batten disease protein in human) [General function prediction only]. Length = 409 Score = 27.6 bits (61), Expect = 7.0 Identities = 15/38 (39%), Positives = 21/38 (55%) Query: 228 PILRKMAPLTAVTIAEYFSSKGDNVLLILDSITRFAHS 265 P+L+ M PL V AEYF ++G LL+ F+ S Sbjct: 248 PLLKYMVPLALVYFAEYFINQGLAELLLFPCSHGFSLS 285 >gnl|CDD|34224 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only]. Length = 325 Score = 27.5 bits (61), Expect = 7.3 Identities = 12/30 (40%), Positives = 16/30 (53%) Query: 151 VIDIFTPLCHGQRIGVFAGSGIGKSTLLSM 180 V DI + G+ +G +G GKST L M Sbjct: 40 VQDISFEIPKGEIVGFLGANGAGKSTTLKM 69 >gnl|CDD|73057 cd03298, ABC_ThiQ_thiamine_transporter, ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP. Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 211 Score = 27.6 bits (61), Expect = 7.6 Identities = 11/36 (30%), Positives = 18/36 (50%) Query: 161 GQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVG 196 G+ + SG GKSTLL++ A + + + G Sbjct: 24 GEITAIVGPSGSGKSTLLNLIAGFETPQSGRVLING 59 >gnl|CDD|72984 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.. Length = 211 Score = 27.4 bits (61), Expect = 7.9 Identities = 8/22 (36%), Positives = 13/22 (59%) Query: 161 GQRIGVFAGSGIGKSTLLSMFA 182 G+ + + +G GKSTLL + Sbjct: 27 GEFVLIVGPNGSGKSTLLRLLN 48 >gnl|CDD|37784 KOG2573, KOG2573, KOG2573, Ribosome biogenesis protein - Nop56p/Sik1p [RNA processing and modification, Translation, ribosomal structure and biogenesis]. Length = 498 Score = 27.2 bits (60), Expect = 7.9 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 8/53 (15%) Query: 179 SMFARSDCFDKVIISLVGERGREVREFIEDYL-----GDNLKKSVVVVATSDE 226 S+ +R DCF + S+ GE ++RE +E+ L G+ +K+ V+ + E Sbjct: 379 SIASRIDCFSEDPTSVFGE---KLREQVEERLEFYETGEAPRKNSDVMKEAME 428 >gnl|CDD|73052 cd03293, ABC_NrtD_SsuB_transporters, NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 220 Score = 27.4 bits (61), Expect = 8.0 Identities = 10/22 (45%), Positives = 14/22 (63%) Query: 161 GQRIGVFAGSGIGKSTLLSMFA 182 G+ + + SG GKSTLL + A Sbjct: 30 GEFVALVGPSGCGKSTLLRIIA 51 >gnl|CDD|34235 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 252 Score = 27.5 bits (61), Expect = 8.4 Identities = 21/76 (27%), Positives = 33/76 (43%), Gaps = 3/76 (3%) Query: 139 QRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFARSDCFDKVIISLVGER 198 + V K + T + + D+ + G + +G GKSTLLSM +R D I++ Sbjct: 5 ENVSKSYGTKVVLDDVSLDIPKGGITSIIGPNGAGKSTLLSMMSRLLKKDSGEITI---D 61 Query: 199 GREVREFIEDYLGDNL 214 G E+ L L Sbjct: 62 GLELTSTPSKELAKKL 77 >gnl|CDD|72988 cd03229, ABC_Class3, This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 178 Score = 27.4 bits (61), Expect = 8.8 Identities = 13/45 (28%), Positives = 21/45 (46%) Query: 139 QRVEKGFKTGIRVIDIFTPLCHGQRIGVFAGSGIGKSTLLSMFAR 183 + V K + + D+ + G+ + + SG GKSTLL A Sbjct: 4 KNVSKRYGQKTVLNDVSLNIEAGEIVALLGPSGSGKSTLLRCIAG 48 >gnl|CDD|73022 cd03263, ABC_subfamily_A, The ABCA subfamily mediates the transport of a variety of lipid compounds. Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders. The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis. The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle. The ABCA genes are not present in yeast. However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.. Length = 220 Score = 27.4 bits (61), Expect = 8.9 Identities = 12/44 (27%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Query: 139 QRVEKGFKTGIRVI--DIFTPLCHGQRIGVFAGSGIGKSTLLSM 180 + + K +K G + D+ + G+ G+ +G GK+T L M Sbjct: 4 RNLTKTYKKGTKPAVDDLSLNVYKGEIFGLLGHNGAGKTTTLKM 47 >gnl|CDD|133340 cd04140, ARHI_like, ARHI subfamily. ARHI (A Ras homolog member I) is a member of the Ras family with several unique structural and functional properties. ARHI is expressed in normal human ovarian and breast tissue, but its expression is decreased or eliminated in breast and ovarian cancer. ARHI contains an N-terminal extension of 34 residues (human) that is required to retain its tumor suppressive activity. Unlike most other Ras family members, ARHI is maintained in the constitutively active (GTP-bound) state in resting cells and has modest GTPase activity. ARHI inhibits STAT3 (signal transducers and activators of transcription 3), a latent transcription factor whose abnormal activation plays a critical role in oncogenesis. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Ras proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation. Length = 165 Score = 27.1 bits (60), Expect = 9.1 Identities = 9/21 (42%), Positives = 14/21 (66%) Query: 163 RIGVFAGSGIGKSTLLSMFAR 183 R+ VF G+GKS+L+ F + Sbjct: 3 RVVVFGAGGVGKSSLVLRFVK 23 >gnl|CDD|146905 pfam04497, Pox_E2, Poxvirus E2 protein. This family of proteins is restricted to Poxviridae. It contains the proteins E2 and O1 which are uncharacterized. Length = 726 Score = 27.4 bits (61), Expect = 9.4 Identities = 20/90 (22%), Positives = 32/90 (35%), Gaps = 2/90 (2%) Query: 183 RSDCF-DKVIISLVGERGREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTI 241 S+ F + VI +VG + + DYL D + ++ S I P A Sbjct: 231 SSEEFKEFVIELIVGGNLPDYLPYANDYLSDRVPDDSLIREYGIYSNIFFDDRPDLAEYT 290 Query: 242 AEYFSSKGDNVLLILDSITRFAHSIREIAT 271 +K + + I I R+ R A Sbjct: 291 DFDTLTK-EELSFICKYIDRYDAKARIFAN 319 >gnl|CDD|145096 pfam01761, DHQ_synthase, 3-dehydroquinate synthase. The 3-dehydroquinate synthase EC:4.6.1.3 domain is present in isolation in various bacterial 3-dehydroquinate synthases and also present as a domain in the pentafunctional AROM polypeptide. 3-dehydroquinate (DHQ) synthase catalyses the formation of dehydroquinate (DHQ) and orthophosphate from 3-deoxy-D-arabino heptulosonic 7 phosphate. This reaction is part of the shikimate pathway which is involved in the biosynthesis of aromatic amino acids. Length = 310 Score = 27.2 bits (61), Expect = 9.4 Identities = 13/57 (22%), Positives = 25/57 (43%), Gaps = 6/57 (10%) Query: 199 GREVREFIEDYLGDNLKKSVVVVATSDESPILRKMAPLTAVTIAEYFSSKGDNVLLI 255 G + + + + L + LK +VV +DE+ A L + E + G V ++ Sbjct: 2 GEGLLDDLGELLSELLKGRRLVV-VTDENV-----AKLYGEKLEELLKAAGFEVEVV 52 >gnl|CDD|73003 cd03244, ABCC_MRP_domain2, Domain 2 of the ABC subfamily C. This family is also known as MRP (mulrtidrug resisitance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.. Length = 221 Score = 27.0 bits (60), Expect = 10.0 Identities = 9/23 (39%), Positives = 15/23 (65%) Query: 161 GQRIGVFAGSGIGKSTLLSMFAR 183 G+++G+ +G GKS+LL R Sbjct: 30 GEKVGIVGRTGSGKSSLLLALFR 52 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.320 0.138 0.401 Gapped Lambda K H 0.267 0.0690 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 5,215,729 Number of extensions: 284694 Number of successful extensions: 1036 Number of sequences better than 10.0: 1 Number of HSP's gapped: 977 Number of HSP's successfully gapped: 101 Length of query: 438 Length of database: 6,263,737 Length adjustment: 97 Effective length of query: 341 Effective length of database: 4,167,664 Effective search space: 1421173424 Effective search space used: 1421173424 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 59 (26.6 bits)