HHsearch alignment for GI: 254780685 and conserved domain: PRK06803

>PRK06803 flgE flagellar hook protein FlgE; Validated.
Probab=100.00  E-value=0  Score=379.07  Aligned_cols=231  Identities=23%  Similarity=0.338  Sum_probs=188.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCEEEE
Q ss_conf             6999999999999987999775431777113346787999974204676555532111100002245-554455640213
Q gi|254780685|r    4 SFNIGLAAQLALEQRLSTVADNMSNTDTVGFRTIKVKFSEVVGAIKNDIDQKISFVASGKEYLSKEV-GSFISTGTELDF   82 (243)
Q Consensus         4 ~~y~a~sg~~a~~~~ldvisNNlAN~~T~GfK~~~~~F~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-G~l~~Tg~~lD~   82 (243)
T Consensus         2 S~~~gvSGl~a~~~~ldvIsNNIANvnT~GfK~s~~~F~dl~~~~~------~gGv~~~~~~~~~~~~G~l~~T~~~~Dl   75 (398)
T PRK06803          2 SFNIALSGLNATTQQLNTISNNIANSSTKGFKGSRTEFASIYNGGQ------AGGVEVSSVSQNFSKGGSLTYTGRGLDL   75 (398)
T ss_pred             CHHHHHHHHHHHHHCCHHHHHHHHHCCCHHCCCCCCCHHHHHCCCC------CCCEEEEEEEEEEECCCCEEECCCCEEE
T ss_conf             6899999999988564366357775785310756205467547667------7854876777776068875666980269


Q ss_pred             EECCCCEEEECCCCC-EEEEECCCCEECCCCCEECCCCCCCCCCC----CC-------CCCCCCCC--------------
Q ss_conf             432750244136763-12321122015656845414688535664----54-------42100000--------------
Q gi|254780685|r   83 ALEGDAWFALESPRG-IILTRDGRFKVTDDGSLVSASGKYPVLDM----AS-------VPIQIPQK--------------  136 (243)
Q Consensus        83 Ai~G~GfF~V~~~~g-~~yTR~G~F~~d~~G~Lvt~~G~~~vl~~----~g-------~pI~ip~~--------------  136 (243)
T Consensus        76 AI~G~GFF~V~~~~g~~~YTRaG~F~~D~~G~Lv~~~G~-~l~G~~~d~~g~~~~~~~~~i~i~~~~~~~~aTt~~~~~~  154 (398)
T PRK06803         76 AISGGGFFVLKGSDGDTAYTRAGMFRSDVDGYLTDPQGM-KLQGYPVDAAGNIQTGNVSDLQVQTASLPAKATDQLDFVA  154 (398)
T ss_pred             EECCCCEEEEECCCCCEEEECCCEEEEEECCEEEECCCC-EEECEEECCCCCCCCCCCCCEEECCCCCCCCCCCEEEEEE
T ss_conf             981686799976998566752741899337879908998-6745360688851026632034015766864322067886


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q gi|254780685|r  137 --------------------------------------------------------------------------------  136 (243)
Q Consensus       137 --------------------------------------------------------------------------------  136 (243)
                                                                                                      
T Consensus       155 nl~a~~~~~~~~~~~~~~~~~~~~~~~~~vyDs~G~~~~v~~~f~kt~~n~w~~~~~~~~~~~~~~~~l~F~~~G~l~~~  234 (398)
T PRK06803        155 NLDASVTDPSVSPFDPTDEKSYNSSTTSTVYDSLGNEHAVTQYFVKTATNEWAVHYTVDGGDVTPPLTLQFDDTGALIPG  234 (398)
T ss_pred             ECCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCEEEEEEEEECCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCC
T ss_conf             24776666765656888776300111289984689725789999965897168999757875577447898788846457


Q ss_pred             -------------------------------------------------CCCCCCCCCCCCC---CCC--CCCCCCCCCC
Q ss_conf             -------------------------------------------------0000000245422---343--2112334545
Q gi|254780685|r  137 -------------------------------------------------DEIFNVGEKGEIS---QKG--KVIATMGLYS  162 (243)
Q Consensus       137 -------------------------------------------------~~~~~i~~dG~i~---~~g--~~v~~l~l~~  162 (243)
T Consensus       235 ~~~~~~~~~~~~~~g~~~~~i~l~~~~~tq~~~~~~~~~~~qdG~~~G~l~~~~I~~dG~I~~~ysNG~~~~lgqIala~  314 (398)
T PRK06803        235 KGSTINLHDTFNPAGASDYDIDIDYTGSTQYAADFNNSRNKSDGYTSGELNGVRIEDNGMVYATYTNGQEQLQGQVVLAN  314 (398)
T ss_pred             CCCCEECCCCCCCCCCCCEEEEECCCCCEEECCCCCCEECCCCCEEEEEEEEEEECCCCEEEEEECCCCEEEEEEEEEEE
T ss_conf             76420014445778766435886477635743665410014687554323237988898699995487436776898997


Q ss_pred             CCCHHHHHHHCCCCCCCCCCCC-CCCC----CCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             5761344320256534566656-5434----5664156242221402399999999999999999999999999999999
Q gi|254780685|r  163 VDMSQGFVRRENSGISPNIPPT-PLED----LSGVTVKRGFLEDSNANSMYEMGQMIHLTQKFNSITTLIDENEKSMLEA  237 (243)
Q Consensus       163 ~~~~~~l~~~~~~~~~~~~~~~-~~~~----~~~~~v~qG~LE~SNVn~~~EMv~lI~~qRafe~~~k~i~~~de~~~~~  237 (243)
T Consensus       315 F~Np~gL~~~G~n~f~~T~~SG~~~~g~~g~~g~G~i~~gaLE~SNVDla~Eft~mI~tQR~yqANskvItT~Demlqel  394 (398)
T PRK06803        315 FANPNGLVTVSNTAWSASNKSGQAILGTPGTGTLGSLTSGALEGSNVDITAELVGLMTAQRNYQANAKVISTNDTMQQAL  394 (398)
T ss_pred             ECCHHHCCCCCCCEEECCCCCCCCEECCCCCCCCCEEEECCEEHHHCHHHHHHHHHHHHHHHHHHHCEEEEEHHHHHHHH
T ss_conf             33836550047945864346788676579988851283274631314099999999999876356424887489999999


Q ss_pred             HHHH
Q ss_conf             9985
Q gi|254780685|r  238 IRNI  241 (243)
Q Consensus       238 in~l  241 (243)
T Consensus       395 vN~v  398 (398)
T PRK06803        395 FNAI  398 (398)
T ss_pred             HHHC
T ss_conf             7409