Score = 75.0 bits (185), Expect = 3e-15 Identities = 30/82 (36%), Positives = 55/82 (67%), Gaps = 3/82 (3%) Query: 66 TDNFDLIMNIPVKMQIILGSCCMQISNLVNLSKGDVITLDKRVGESVDITINNQKIAKGE 125 +D +L+++IP+K+ + LG M + ++ + G +I LDK GE VDI +N + IA+GE Sbjct: 1 SDKLELLLDIPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPVDILVNGKLIARGE 60 Query: 126 ITIMEEDDTHFGVRVIEILNAQ 147 + +++E +FGVR+ EI++ + Sbjct: 61 VVVIDE---NFGVRITEIVSPK 79
class: All beta proteins
fold: Surface presentation of antigens (SPOA)
superfamily: Surface presentation of antigens (SPOA)
family: Surface presentation of antigens (SPOA)
domain: Putative flagelar motor switch protein FliN
species: Thermotoga maritima [TaxId: 2336]