BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780691|ref|YP_003065104.1| hypothetical protein CLIBASIA_02890 [Candidatus Liberibacter asiaticus str. psy62] (55 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780691|ref|YP_003065104.1| hypothetical protein CLIBASIA_02890 [Candidatus Liberibacter asiaticus str. psy62] Length = 55 Score = 114 bits (284), Expect = 4e-28, Method: Compositional matrix adjust. Identities = 55/55 (100%), Positives = 55/55 (100%) Query: 1 MEEDAEVFRTSHVRGVHDILLRSSFFLKLQNMKNIGLQRYYKRVKTVIRAKKYQE 55 MEEDAEVFRTSHVRGVHDILLRSSFFLKLQNMKNIGLQRYYKRVKTVIRAKKYQE Sbjct: 1 MEEDAEVFRTSHVRGVHDILLRSSFFLKLQNMKNIGLQRYYKRVKTVIRAKKYQE 55 >gi|254780583|ref|YP_003064996.1| glyoxalase II [Candidatus Liberibacter asiaticus str. psy62] Length = 256 Score = 20.4 bits (41), Expect = 6.1, Method: Composition-based stats. Identities = 9/37 (24%), Positives = 21/37 (56%) Query: 11 SHVRGVHDILLRSSFFLKLQNMKNIGLQRYYKRVKTV 47 +H+ H+ +++F + N+ LQ+Y +VK++ Sbjct: 165 THIYFGHEYTENNAYFALSCDPHNLELQKYCSKVKSM 201 >gi|255764501|ref|YP_003064973.2| thiamine transporter membrane protein [Candidatus Liberibacter asiaticus str. psy62] Length = 535 Score = 20.4 bits (41), Expect = 6.2, Method: Composition-based stats. Identities = 10/28 (35%), Positives = 14/28 (50%) Query: 13 VRGVHDILLRSSFFLKLQNMKNIGLQRY 40 + V I+L FFL L+N N+ Y Sbjct: 379 ILAVPSIVLAVGFFLLLKNTVNLTSSSY 406 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.325 0.137 0.377 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,178 Number of Sequences: 1233 Number of extensions: 850 Number of successful extensions: 3 Number of sequences better than 100.0: 3 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 55 length of database: 328,796 effective HSP length: 27 effective length of query: 28 effective length of database: 295,505 effective search space: 8274140 effective search space used: 8274140 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 31 (16.5 bits)