Query         gi|254780692|ref|YP_003065105.1| hypothetical protein CLIBASIA_02895 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 72
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 33803
Date          Wed Jun  1 14:35:31 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780692.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >3it8_D 2L protein; MHC class   18.3      53  0.0016   15.1   1.3   24    1-25    152-175 (177)
  2 >2wa0_A Melanoma-associated an   9.7 1.4E+02  0.0042   12.9   1.7   25    5-29     10-34  (127)
  3 >1v54_J Cytochrome C oxidase p   9.0 1.5E+02  0.0045   12.7   1.9   19    4-22     40-58  (59)
  4 >3hjc_A Heat shock protein 83-   8.7 1.6E+02  0.0046   12.7   2.8   44   27-70    117-160 (166)
  5 >1xi4_A Clathrin heavy chain;    8.7 1.6E+02  0.0046   12.7   2.3   33   28-60     61-93  (121)
  6 >1q79_A Poly(A) polymerase alp   7.6 1.7E+02  0.0049   12.5   1.1   20    1-20     77-96  (198)
  7 >2hhp_A Poly(A) polymerase; te   6.5 1.8E+02  0.0053   12.4   0.8   20    1-20     66-85  (187)
  8 >3hhs_A Propo-P2, phenoloxidas   6.4   2E+02   0.006   12.1   1.9   14   25-38      2-15  (31)
  9 >2gq0_A Chaperone protein HTPG   5.5 2.3E+02  0.0068   11.8   1.0   40   27-66     99-138 (156)
 10 >2cge_A ATP-dependent molecula   5.4 2.3E+02  0.0069   11.8   2.0   43   28-70    100-142 (148)

No 1  
>>3it8_D 2L protein; MHC class I homolog, cell membrane, cytokine, disulfide bond, glycoprotein, lipoprotein, membrane, myristate, phosphoprotein; HET: NAG; 2.80A {Yaba-like disease virus} (D:1-177)
Probab=18.29  E-value=53  Score=15.11  Aligned_cols=24  Identities=33%  Similarity=0.530  Sum_probs=18.7

Q ss_pred             CHHHHHHHHHHHHHHHHCCHHHHHH
Q ss_conf             9257789999999998313256787
Q gi|254780692|r    1 MEFLGGIIFTIICLYMMNGYQKEKK   25 (72)
Q Consensus         1 meflggiiftiiclymmngyqkekk   25 (72)
                      |+++||+. +.-|..-.+.|||-.|
T Consensus       152 ~ky~G~~v-~~~C~~t~~DY~K~aK  175 (177)
T 3it8_D          152 KAYLGGFE-YMGCSLAILDYQKMAK  175 (177)
T ss_dssp             HHHHHHHH-HTHHHHHHHHHHHHHT
T ss_pred             HHHHHHHH-HCHHHHHHHHHHHHHH
T ss_conf             99986120-2546999999998444


No 2  
>>2wa0_A Melanoma-associated antigen 4; immune system, multiple anomalous dispersion, cancer/testis antigen 1.4, melanoma antigen family A 4, CT1.4, MAGE-41; 2.30A {Homo sapiens} (A:114-240)
Probab=9.65  E-value=1.4e+02  Score=12.90  Aligned_cols=25  Identities=16%  Similarity=0.360  Sum_probs=19.4

Q ss_pred             HHHHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             7899999999983132567877888
Q gi|254780692|r    5 GGIIFTIICLYMMNGYQKEKKDIER   29 (72)
Q Consensus         5 ggiiftiiclymmngyqkekkdier   29 (72)
                      -|+.+.|+|+-+|+|..-...++-+
T Consensus        10 ~Gll~~VL~~I~l~g~~~~E~~L~~   34 (127)
T 2wa0_A           10 TGLLIIVLGTIAMEGDSASEEEIWE   34 (127)
T ss_dssp             HHHHHHHHHHHHHHSSCEEHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCCCCHHHHHH
T ss_conf             1279999999996599788999999


No 3  
>>1v54_J Cytochrome C oxidase polypeptide VIIA-heart; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} (J:)
Probab=8.96  E-value=1.5e+02  Score=12.75  Aligned_cols=19  Identities=32%  Similarity=0.613  Sum_probs=14.3

Q ss_pred             HHHHHHHHHHHHHHCCHHH
Q ss_conf             7789999999998313256
Q gi|254780692|r    4 LGGIIFTIICLYMMNGYQK   22 (72)
Q Consensus         4 lggiiftiiclymmngyqk   22 (72)
                      ++|+++.+.++|+|.-.+|
T Consensus        40 ~~G~~~~~~~l~~a~~pkK   58 (59)
T 1v54_J           40 LGGTLYSLYCLGWASFPHK   58 (59)
T ss_dssp             HHHHHHHHHHHHHHTSCCC
T ss_pred             HHHHHHHHHHHHHHHCCCC
T ss_conf             9989999999999877688


No 4  
>>3hjc_A Heat shock protein 83-1; sleeping sickness, structural genomics, stress response protein, chaperone, structural genomics consortium, SGC; 2.50A {Leishmania major} (A:1-166)
Probab=8.68  E-value=1.6e+02  Score=12.69  Aligned_cols=44  Identities=23%  Similarity=0.360  Sum_probs=32.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCHHHH
Q ss_conf             88877336887733898730324556699999987510286763
Q gi|254780692|r   27 IERTRLNIERTRLTCEEARHTQDENLTKACKDELKNIKSNPKEK   70 (72)
Q Consensus        27 iertrlniertrltceearhtqdenltkackdelkniksnpkek   70 (72)
                      -+.-.||+-|--|--...--.--+.|+++.++.|+.++.++..-
T Consensus       117 S~dLplnvSRE~Lq~~~~l~~i~~~l~~ki~~~L~~l~~d~~ky  160 (166)
T 3hjc_A          117 SEDLPLNISRENLQQNKILKVIRKNIVKKCLEMFDEVAENKEDY  160 (166)
T ss_dssp             ESSCC-----CHHHHHHHHHHHHHHHHHHHHHHHHHHTTSHHHH
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHH
T ss_conf             05477201199986418999998789999999999872066779


No 5  
>>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis/exocytosis complex; 7.90A {Bos taurus} (A:1279-1399)
Probab=8.66  E-value=1.6e+02  Score=12.68  Aligned_cols=33  Identities=18%  Similarity=0.096  Sum_probs=20.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHH
Q ss_conf             887733688773389873032455669999998
Q gi|254780692|r   28 ERTRLNIERTRLTCEEARHTQDENLTKACKDEL   60 (72)
Q Consensus        28 ertrlniertrltceearhtqdenltkackdel   60 (72)
                      --+|+||.+.--.||++.+-+.--.--..-||.
T Consensus        61 f~sriNipK~ir~ce~~~lW~Elv~Ly~~yde~   93 (121)
T 1xi4_A           61 FWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEY   93 (121)
T ss_pred             HHHHCCHHHHHHHHHHHHHHHHHHHHHHCCHHH
T ss_conf             875215678999999876268888886511147


No 6  
>>1q79_A Poly(A) polymerase alpha; mRNA processing, nucleotidyl transferase; HET: 3AT; 2.15A {Bos taurus} (A:1-50,A:215-362)
Probab=7.64  E-value=1.7e+02  Score=12.53  Aligned_cols=20  Identities=25%  Similarity=0.610  Sum_probs=13.6

Q ss_pred             CHHHHHHHHHHHHHHHHCCH
Q ss_conf             92577899999999983132
Q gi|254780692|r    1 MEFLGGIIFTIICLYMMNGY   20 (72)
Q Consensus         1 meflggiiftiiclymmngy   20 (72)
                      +-|||||-..|..-....-|
T Consensus        77 ~GfLGGI~wAILvArVCQly   96 (198)
T 1q79_A           77 LGFLGGVSWAMLVARTCQLY   96 (198)
T ss_dssp             TTSBCHHHHHHHHHHHHHHS
T ss_pred             CCCCCHHHHHHHHHHHHCCC
T ss_conf             27730899999999996447


No 7  
>>2hhp_A Poly(A) polymerase; template-independent RNA polymerase, transferase; HET: FLC; 1.80A {Saccharomyces cerevisiae} (A:1-39,A:202-349)
Probab=6.52  E-value=1.8e+02  Score=12.37  Aligned_cols=20  Identities=20%  Similarity=0.554  Sum_probs=13.1

Q ss_pred             CHHHHHHHHHHHHHHHHCCH
Q ss_conf             92577899999999983132
Q gi|254780692|r    1 MEFLGGIIFTIICLYMMNGY   20 (72)
Q Consensus         1 meflggiiftiiclymmngy   20 (72)
                      +-|||||-..|..-....-|
T Consensus        66 ~GylGGI~wAILvArVCQly   85 (187)
T 2hhp_A           66 FGFPGGVAWAMLVARICQLY   85 (187)
T ss_dssp             GTSCCHHHHHHHHHHHHHHS
T ss_pred             CCCCHHHHHHHHHHHHHHCC
T ss_conf             47728999999999998436


No 8  
>>3hhs_A Propo-P2, phenoloxidase subunit 2; alpha helix, beta strand, copper, melanin biosynthesis, metal-binding, monooxygenase, oxidoreductase, secreted; 1.97A {Manduca sexta} (A:313-343)
Probab=6.39  E-value=2e+02  Score=12.09  Aligned_cols=14  Identities=50%  Similarity=0.634  Sum_probs=9.6

Q ss_pred             HHHHHHHHHHHHHH
Q ss_conf             77888773368877
Q gi|254780692|r   25 KDIERTRLNIERTR   38 (72)
Q Consensus        25 kdiertrlniertr   38 (72)
                      .|.||-|-|||..-
T Consensus         2 ddmeryrrnieeai   15 (31)
T 3hhs_A            2 DDMERYRRNIEEAI   15 (31)
T ss_dssp             HHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999999999


No 9  
>>2gq0_A Chaperone protein HTPG; molecular chaperone, HSP90, E. coli, hydrolase; 1.90A {Escherichia coli} (A:1-156)
Probab=5.54  E-value=2.3e+02  Score=11.82  Aligned_cols=40  Identities=20%  Similarity=0.222  Sum_probs=27.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCC
Q ss_conf             8887733688773389873032455669999998751028
Q gi|254780692|r   27 IERTRLNIERTRLTCEEARHTQDENLTKACKDELKNIKSN   66 (72)
Q Consensus        27 iertrlniertrltceearhtqdenltkackdelkniksn   66 (72)
                      -+.-.||+-|--|--...-..--+.+++.+.+.|+.+..+
T Consensus        99 S~dLplnvSRE~lQ~~~~l~~ir~~l~~ki~~~L~~la~~  138 (156)
T 2gq0_A           99 SSDLPLNVSREILQDSTVTRNLRNALTKRVLQMLEKLAKD  138 (156)
T ss_dssp             ESSSCTTCCHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             5778753459998764799999999999999999987430


No 10 
>>2cge_A ATP-dependent molecular chaperone HSP82; chaperone complex, heat shock protein, CO-chaperone, ATP-binding, heat shock; 3.0A {Saccharomyces cerevisiae} (A:1-148)
Probab=5.42  E-value=2.3e+02  Score=11.78  Aligned_cols=43  Identities=19%  Similarity=0.264  Sum_probs=29.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCHHHH
Q ss_conf             8877336887733898730324556699999987510286763
Q gi|254780692|r   28 ERTRLNIERTRLTCEEARHTQDENLTKACKDELKNIKSNPKEK   70 (72)
Q Consensus        28 ertrlniertrltceearhtqdenltkackdelkniksnpkek   70 (72)
                      +.-.||+-|--|--...-..--+.|++.-.+.|+.++.+|..-
T Consensus       100 ~dLplNvSRE~LQ~~~~l~~ir~~l~~ki~~~L~~la~d~~~y  142 (148)
T 2cge_A          100 EDLPLNLSREMLQQNKIMKVIRKNIVKKLIEAFNEIAEDSEQF  142 (148)
T ss_dssp             SSCCSSCCTTCTHHHHHHHHHHHHHHHHHHHHHHHHTTSHHHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHH
T ss_conf             7688542267663118999998888999999998621368899


Done!