RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780692|ref|YP_003065105.1| hypothetical protein CLIBASIA_02895 [Candidatus Liberibacter asiaticus str. psy62] (72 letters) >gnl|CDD|36682 KOG1469, KOG1469, KOG1469, Predicted acyl-CoA dehydrogenase [General function prediction only]. Length = 392 Score = 29.2 bits (65), Expect = 0.25 Identities = 15/40 (37%), Positives = 21/40 (52%) Query: 25 KDIERTRLNIERTRLTCEEARHTQDENLTKACKDELKNIK 64 DI +R+ IE+ RL +A H+ D K K E+ IK Sbjct: 284 HDIAESRVEIEQARLLVLKAAHSMDTLGNKGAKKEIAMIK 323 >gnl|CDD|34229 COG4591, LolE, ABC-type transport system, involved in lipoprotein release, permease component [Cell envelope biogenesis, outer membrane]. Length = 408 Score = 27.5 bits (61), Expect = 0.87 Identities = 9/21 (42%), Positives = 15/21 (71%) Query: 6 GIIFTIICLYMMNGYQKEKKD 26 G+ I+ L +MNG+QKE ++ Sbjct: 36 GVAVLIVVLSVMNGFQKELEN 56 >gnl|CDD|88607 cd04434, LanC_like, LanC-like proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins of unknown function.. Length = 343 Score = 27.1 bits (59), Expect = 1.2 Identities = 9/37 (24%), Positives = 15/37 (40%) Query: 4 LGGIIFTIICLYMMNGYQKEKKDIERTRLNIERTRLT 40 L GI + + L G Q+ K++ L + L Sbjct: 52 LAGIAYALAALSKGLGDQELLKELLELLLLLVELILE 88 >gnl|CDD|32154 COG1971, COG1971, Predicted membrane protein [Function unknown]. Length = 190 Score = 25.9 bits (57), Expect = 2.8 Identities = 7/17 (41%), Positives = 10/17 (58%) Query: 1 MEFLGGIIFTIICLYMM 17 E LGGII I + ++ Sbjct: 168 AEILGGIILIGIGVKIL 184 >gnl|CDD|110875 pfam01914, MarC, MarC family integral membrane protein. Integral membrane protein family that includes the antibiotic resistance protein MarC. These proteins may be transporters. Length = 203 Score = 25.3 bits (56), Expect = 3.4 Identities = 9/36 (25%), Positives = 17/36 (47%) Query: 1 MEFLGGIIFTIICLYMMNGYQKEKKDIERTRLNIER 36 GGI+ +I + M+ G Q ++K + + E Sbjct: 72 FRIAGGILLFLIAIDMLFGKQSKEKTSKSEKEESED 107 >gnl|CDD|33945 COG4220, COG4220, Phage DNA packaging protein, Nu1 subunit of terminase [DNA replication, recombination, and repair]. Length = 174 Score = 25.4 bits (55), Expect = 3.6 Identities = 10/33 (30%), Positives = 15/33 (45%) Query: 22 KEKKDIERTRLNIERTRLTCEEARHTQDENLTK 54 + D+E R ER RLT +A + +N Sbjct: 65 DLRDDVEELREARERHRLTRAQADAQELKNARD 97 >gnl|CDD|112550 pfam03740, PdxJ, Pyridoxal phosphate biosynthesis protein PdxJ. Members of this family belong to the PdxJ family that catalyses the condensation of 1-deoxy-d-xylulose-5-phosphate (DXP) and 1-amino-3-oxo-4-(phosphohydroxy)propan-2-one to form pyridoxine 5'-phosphate (PNP). This reaction is involved in de novo synthesis of pyridoxine (vitamin B6) and pyridoxal phosphate. Length = 239 Score = 25.0 bits (55), Expect = 4.3 Identities = 11/31 (35%), Positives = 15/31 (48%), Gaps = 4/31 (12%) Query: 42 EEARHTQD---ENLTKACKDELKNIKSNPKE 69 E+ RH QD E L + + NI+ P E Sbjct: 45 EDRRHIQDRDVEVLKELIRTRF-NIEMAPTE 74 >gnl|CDD|34372 COG4758, COG4758, Predicted membrane protein [Function unknown]. Length = 235 Score = 24.8 bits (54), Expect = 4.8 Identities = 13/46 (28%), Positives = 24/46 (52%) Query: 1 MEFLGGIIFTIICLYMMNGYQKEKKDIERTRLNIERTRLTCEEARH 46 + FL IIF I LY++ Y +K++ + L E + + + R+ Sbjct: 73 LGFLLAIIFIFIGLYLIIKYIIKKREPQLVNLKKEPSEVNNTDFRN 118 >gnl|CDD|34524 COG4915, XpaC, 5-bromo-4-chloroindolyl phosphate hydrolysis protein [General function prediction only]. Length = 204 Score = 24.5 bits (53), Expect = 5.8 Identities = 7/41 (17%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Query: 24 KKDIERTRLNIERTRLTCEEARHTQDENLTKACKDELKNIK 64 K E + ++ TR+ +E + +++L + D++ + Sbjct: 153 VKSKEINQ-DLSETRILLKELSRSIEKDLHELLMDDVNVLD 192 >gnl|CDD|38522 KOG3312, KOG3312, KOG3312, Predicted membrane protein [Function unknown]. Length = 186 Score = 23.8 bits (51), Expect = 9.9 Identities = 11/60 (18%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Query: 10 TIICLYMMNGYQKEKKDIERTRLNIERTRLTCEEARHTQDENLTKACKDELKNIKSNPKE 69 T + +Y + Y++ K ++++ +E+ + EE + D++ K + + +K+N ++ Sbjct: 26 TWVLVYRTDKYKRLKAEVDKQSKKLEKKK---EENGDSNDKSKKKKIERVEEKLKNNNRD 82 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.134 0.379 Gapped Lambda K H 0.267 0.0522 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 829,133 Number of extensions: 32483 Number of successful extensions: 142 Number of sequences better than 10.0: 1 Number of HSP's gapped: 141 Number of HSP's successfully gapped: 21 Length of query: 72 Length of database: 6,263,737 Length adjustment: 43 Effective length of query: 29 Effective length of database: 5,334,550 Effective search space: 154701950 Effective search space used: 154701950 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.9 bits)