RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780692|ref|YP_003065105.1| hypothetical protein CLIBASIA_02895 [Candidatus Liberibacter asiaticus str. psy62] (72 letters) >gnl|CDD|149146 pfam07907, YibE_F, YibE/F-like protein. The sequences featured in this family are similar to two proteins expressed by Lactococcus lactis, YibE and YibF. Most of the members of this family are annotated as being putative membrane proteins, and in fact the sequences contain a high proportion of hydrophobic residues. Length = 244 Score = 28.2 bits (64), Expect = 0.44 Identities = 7/20 (35%), Positives = 13/20 (65%) Query: 3 FLGGIIFTIICLYMMNGYQK 22 + II T + L+++NG+ K Sbjct: 55 IILAIIITAVTLFLVNGFNK 74 >gnl|CDD|161793 TIGR00263, trpB, tryptophan synthase, beta subunit. Tryptophan synthase catalyzes the last step in the biosynthesis of tryptophan. the beta chain contains the functional domain for or the synthesis of tryptophan from indole and serine. The enzyme requires pyridoxal-phosphate as a cofactor. The pyridoxal-P attachment site is contained within the conserved region [LIVM]-x-H-x-G-[STA]-H-K-x-N] [K is the pyridoxal-P attachment site] which is present between residues 90-100 of the model. Length = 385 Score = 25.8 bits (57), Expect = 2.8 Identities = 6/16 (37%), Positives = 10/16 (62%) Query: 24 KKDIERTRLNIERTRL 39 +D+ER + N+ R L Sbjct: 131 AEDVERQKPNVFRMEL 146 >gnl|CDD|185151 PRK15238, PRK15238, inner membrane transporter YjeM; Provisional. Length = 496 Score = 25.3 bits (56), Expect = 3.3 Identities = 5/21 (23%), Positives = 11/21 (52%) Query: 5 GGIIFTIICLYMMNGYQKEKK 25 G + F+I+ + Y+K+ Sbjct: 475 GPVFFSILAWIIYQNYEKKMA 495 >gnl|CDD|183324 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed. Length = 556 Score = 25.1 bits (56), Expect = 4.0 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Query: 38 RLTCEEARHTQDENLTKACKDELKNIKSNPK 68 RL EE Q+ KA K EL+ ++ +PK Sbjct: 255 RLAQEEK---QEAARQKALKRELEWVRQSPK 282 >gnl|CDD|178635 PLN03086, PLN03086, PRLI-interacting factor K; Provisional. Length = 567 Score = 24.8 bits (54), Expect = 4.6 Identities = 11/29 (37%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Query: 21 QKEKKDIERTRLNIERTRLTCEEARHTQD 49 Q+E+K +R +L +ER R EEA ++ Sbjct: 16 QRERK--QRAKLKLERERKAKEEAAKQRE 42 >gnl|CDD|131878 TIGR02831, spo_II_M, stage II sporulation protein M. A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This predicted integral membrane protein is designated stage II sporulation protein M. Length = 200 Score = 24.9 bits (55), Expect = 4.7 Identities = 8/21 (38%), Positives = 11/21 (52%) Query: 3 FLGGIIFTIICLYMMNGYQKE 23 FL GI+F + M+ QK Sbjct: 21 FLVGIVFGAYTVNSMSIVQKN 41 >gnl|CDD|177635 PHA03399, pif3, per os infectivity factor 3; Provisional. Length = 200 Score = 24.5 bits (54), Expect = 5.5 Identities = 11/51 (21%), Positives = 17/51 (33%), Gaps = 16/51 (31%) Query: 7 IIFTIICLYMMNGYQK------EKKDIERTRLNI----------ERTRLTC 41 II I+ Y + Q+ E + +N+ TRL C Sbjct: 10 IILLIVYYYTLKFVQQLNLNDDEARSRANPPMNLVFERNGIVDCSLTRLPC 60 >gnl|CDD|182970 PRK11111, PRK11111, hypothetical protein; Provisional. Length = 214 Score = 24.1 bits (53), Expect = 7.6 Identities = 8/29 (27%), Positives = 15/29 (51%), Gaps = 7/29 (24%) Query: 5 GGIIFTIICLYMMNGY-------QKEKKD 26 GGI+ I + M++G ++EK + Sbjct: 82 GGILVVTIAMSMISGKLGEDKQNKQEKSE 110 >gnl|CDD|178227 PLN02618, PLN02618, tryptophan synthase, beta chain. Length = 410 Score = 23.9 bits (52), Expect = 8.5 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Query: 25 KDIERTRLNIERTRLTCEEAR--HTQDENLTKACKDELKNIKSN 66 +D+ER LN+ R RL E R H+ L A + +++ +N Sbjct: 153 QDMERQALNVFRMRLLGAEVRPVHSGTATLKDATSEAIRDWVTN 196 >gnl|CDD|179834 PRK04346, PRK04346, tryptophan synthase subunit beta; Validated. Length = 397 Score = 23.9 bits (53), Expect = 9.1 Identities = 7/15 (46%), Positives = 11/15 (73%) Query: 25 KDIERTRLNIERTRL 39 +D+ER LN+ R +L Sbjct: 140 EDVERQALNVFRMKL 154 >gnl|CDD|148274 pfam06570, DUF1129, Protein of unknown function (DUF1129). This family consists of several hypothetical bacterial proteins of unknown function. Length = 206 Score = 23.7 bits (52), Expect = 9.6 Identities = 4/23 (17%), Positives = 10/23 (43%) Query: 3 FLGGIIFTIICLYMMNGYQKEKK 25 +GG+ + Y+ + + K Sbjct: 120 LVGGLAMYYMYRYLYRYLKDKSK 142 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.317 0.134 0.379 Gapped Lambda K H 0.267 0.0755 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,104,139 Number of extensions: 52543 Number of successful extensions: 152 Number of sequences better than 10.0: 1 Number of HSP's gapped: 152 Number of HSP's successfully gapped: 29 Length of query: 72 Length of database: 5,994,473 Length adjustment: 43 Effective length of query: 29 Effective length of database: 5,065,329 Effective search space: 146894541 Effective search space used: 146894541 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.0 bits)