HHsearch alignment for GI: 254780693 and conserved domain: PRK00215

>PRK00215 LexA repressor; Validated.
Probab=96.34  E-value=0.0084  Score=39.15  Aligned_cols=42  Identities=38%  Similarity=0.484  Sum_probs=28.8

Q ss_pred             CCHHHHHHHHHHHC-----C--CCHHHHHHHHCC-CHHHHHHHHHHHHHH
Q ss_conf             99899999999987-----9--997899999499-988999999999998
Q gi|254780693|r  174 LTERETSCLQLAGD-----G--YTSEEIAEKLGL-SVHTVNAYLGSATVK  215 (235)
Q Consensus       174 LT~RE~evL~l~a~-----G--~t~~eIA~~L~i-S~~TV~~hl~~i~~K  215 (235)
T Consensus         2 LT~kQ~~il~fI~~~~~~~g~~Ps~rEI~~~~g~~S~~tV~~~l~~Le~k   51 (204)
T PRK00215          2 LTARQQEILDFIKDRIEETGYPPSRREIADALGLRSPSAVHEHLKALERK   51 (204)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCHHHHHHHHHHHHC
T ss_conf             89899999999999999748899899999980999818999999999879