HHsearch alignment for GI: 254780693 and conserved domain: PRK12522

>PRK12522 RNA polymerase sigma factor; Provisional.
Probab=97.76  E-value=8.5e-05  Score=53.37  Aligned_cols=45  Identities=27%  Similarity=0.337  Sum_probs=42.1

Q ss_pred             CCCHHHHHHHHHHH-CCCCHHHHHHHHCCCHHHHHHHHHHHHHHCC
Q ss_conf             49989999999998-7999789999949998899999999999807
Q gi|254780693|r  173 NLTERETSCLQLAG-DGYTSEEIAEKLGLSVHTVNAYLGSATVKLD  217 (235)
Q Consensus       173 ~LT~RE~evL~l~a-~G~t~~eIA~~L~iS~~TV~~hl~~i~~KLg  217 (235)
T Consensus       119 ~L~~~~R~vi~L~~~~~~s~~EIA~~l~is~~tVksrl~rAr~~Lr  164 (173)
T PRK12522        119 LLNEKYKTVLVLYYYEQYSYKEMSEILNIPIGTVKYRLNYAKKQMR  164 (173)
T ss_pred             CCCHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             1999999999999983999999999989399999999999999999