HHsearch results for GI: 254780693 and protein with PDBid: 2nyx_A

>2nyx_A Probable transcriptional regulatory protein, RV1404; alpha/beta, structural genomics, PSI-2, protein structure initiative; 2.30A {Mycobacterium tuberculosis H37RV}
Probab=93.42  E-value=0.35  Score=26.01  Aligned_cols=44  Identities=14%  Similarity=0.123  Sum_probs=39.4

Q ss_pred             CCCCHHHHHHHHHHH--CCCCHHHHHHHHCCCHHHHHHHHHHHHHH
Q ss_conf             449989999999998--79997899999499988999999999998
Q gi|254780693|r  172 RNLTERETSCLQLAG--DGYTSEEIAEKLGLSVHTVNAYLGSATVK  215 (235)
Q Consensus       172 ~~LT~RE~evL~l~a--~G~t~~eIA~~L~iS~~TV~~hl~~i~~K  215 (235)
                      .+||.-|..||..+.  .|.+..+||..++|+..||...++++.+|
T Consensus        41 ~~LT~~q~~vL~~l~~~~~~~~~eLa~~l~i~~~~vs~~l~~Le~~   86 (168)
T 2nyx_A           41 ENITIPQFRTLVILSNHGPINLATLATLLGVQPSATGRMVDRLVGA   86 (168)
T ss_dssp             SSCCHHHHHHHHHHHHHCSEEHHHHHHHHTSCHHHHHHHHHHHHHT
T ss_pred             CCCCHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHCC
T ss_conf             9989999999999996799699999999896988999999998164