BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780693|ref|YP_003065106.1| transcriptional regulator
protein [Candidatus Liberibacter asiaticus str. psy62]
         (235 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780693|ref|YP_003065106.1| transcriptional regulator protein [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040370|gb|ACT57166.1| transcriptional regulator protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 235

 Score =  216 bits (550), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 235/235 (100%), Positives = 235/235 (100%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLD 60
           MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLD
Sbjct: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLD 60

Query: 61  SGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAF 120
           SGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAF
Sbjct: 61  SGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAF 120

Query: 121 PVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETS 180
           PVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETS
Sbjct: 121 PVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETS 180

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYIC 235
           CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYIC
Sbjct: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYIC 235


>gi|327193021|gb|EGE59933.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli CNPAF512]
          Length = 306

 Score =  200 bits (509), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 109/231 (47%), Positives = 150/231 (64%), Gaps = 3/231 (1%)

Query: 6   LTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIP 65
           +   + SS  +L PRL  +Q    A+ FA+Y ++ +   P +Q+L+CEL N+   +    
Sbjct: 76  VRVNRISSRSDLFPRLIAMQKLADAQGFAIYRVSGS-GLPAKQRLVCELENWGPSNAGFG 134

Query: 66  NILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESS--GQLSVRLEGGLLPFAGIAFPVR 123
               + YGD  L H    LLP+ W    +      +       RL  G+LPF+G+AFPVR
Sbjct: 135 KAFTDAYGDILLDHIEKSLLPLSWAGAHDRAAPGPADFAPFMTRLRDGILPFSGLAFPVR 194

Query: 124 LGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
           LG   NG+++FT + +  ++++I+E HG C  ++ D L L ++R++AA  L+ERE +CLQ
Sbjct: 195 LGAVGNGFILFTGDDIDPSSDMIVELHGRCCHIMMDLLSLDERRTAAAEALSEREIACLQ 254

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           LAGDG  SEEIAEKLGLSVHTVNAYLGSAT+KLD+VNRIQAIAKAIR GYI
Sbjct: 255 LAGDGRISEEIAEKLGLSVHTVNAYLGSATIKLDSVNRIQAIAKAIRLGYI 305


>gi|315121858|ref|YP_004062347.1| transcriptional regulator protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495260|gb|ADR51859.1| transcriptional regulator protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 235

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 199/235 (84%), Positives = 217/235 (92%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLD 60
           MSENTL  KKS SL ELS +L +IQ RIKARNFALYTIN ALD PRRQQL+CEL+NYD +
Sbjct: 1   MSENTLLEKKSFSLLELSSKLKIIQKRIKARNFALYTINCALDSPRRQQLVCELNNYDPE 60

Query: 61  SGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAF 120
           SG+IPNILI+TYGD+FLFHFNSGLLPIIW ++QEET+IESSGQ  +RL+ G+LPFAGIAF
Sbjct: 61  SGEIPNILIKTYGDEFLFHFNSGLLPIIWNNMQEETIIESSGQFFIRLDKGILPFAGIAF 120

Query: 121 PVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETS 180
           P+RLGFHKNGYV+FT+E LMLANEVIIEAHGACYQVI  FL LFKKRSSAARNLTERETS
Sbjct: 121 PLRLGFHKNGYVVFTAECLMLANEVIIEAHGACYQVIMGFLALFKKRSSAARNLTERETS 180

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYIC 235
           CLQLAGDGYTSEEIA+KLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYIC
Sbjct: 181 CLQLAGDGYTSEEIAKKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYIC 235


>gi|218514696|ref|ZP_03511536.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli 8C-3]
          Length = 240

 Score =  198 bits (503), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 109/231 (47%), Positives = 150/231 (64%), Gaps = 3/231 (1%)

Query: 6   LTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIP 65
           +   + SS  +L PRL  +Q    A+ FA+Y ++ +   P +Q+L+CEL N+   +    
Sbjct: 10  VRVNRISSRSDLFPRLIAMQKLADAQGFAIYRVSGS-GLPAKQRLVCELENWGSSNAGFG 68

Query: 66  NILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESS--GQLSVRLEGGLLPFAGIAFPVR 123
               + YGD  L H    LLP+ W    +      +       RL  G+LPF+G+AFPVR
Sbjct: 69  KAFTDAYGDILLDHIEKSLLPLSWAGAHDRAAPGPADFAPFMTRLRDGILPFSGLAFPVR 128

Query: 124 LGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
           LG   NG+++FT + +  ++++I+E HG C  ++ D L L ++R++AA  L+ERE +CLQ
Sbjct: 129 LGAVGNGFILFTGDDIDPSSDMIVELHGRCCHIMMDLLSLDERRTAAAEALSEREIACLQ 188

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           LAGDG  SEEIAEKLGLSVHTVNAYLGSAT+KLD+VNRIQAIAKAIR GYI
Sbjct: 189 LAGDGRISEEIAEKLGLSVHTVNAYLGSATIKLDSVNRIQAIAKAIRLGYI 239


>gi|190890350|ref|YP_001976892.1| transcriptional regulator protein, LuxR family [Rhizobium etli CIAT
           652]
 gi|190695629|gb|ACE89714.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli CIAT 652]
          Length = 248

 Score =  198 bits (503), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 109/231 (47%), Positives = 150/231 (64%), Gaps = 3/231 (1%)

Query: 6   LTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIP 65
           +   + SS  +L PRL  +Q    A+ FA+Y ++ +   P +Q+L+CEL N+   +    
Sbjct: 18  VRVNRISSRSDLFPRLIAMQKLADAQGFAIYRVSGS-GLPAKQRLVCELENWGSSNAGFG 76

Query: 66  NILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESS--GQLSVRLEGGLLPFAGIAFPVR 123
               + YGD  L H    LLP+ W    +      +       RL  G+LPF+G+AFPVR
Sbjct: 77  KAFTDAYGDILLDHIEKSLLPLSWAGAHDRAAPGPADFAPFMTRLRDGILPFSGLAFPVR 136

Query: 124 LGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
           LG   NG+++FT + +  ++++I+E HG C  ++ D L L ++R++AA  L+ERE +CLQ
Sbjct: 137 LGAVGNGFILFTGDDIDPSSDMIVELHGRCCHIMMDLLSLDERRTAAAEALSEREIACLQ 196

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           LAGDG  SEEIAEKLGLSVHTVNAYLGSAT+KLD+VNRIQAIAKAIR GYI
Sbjct: 197 LAGDGRISEEIAEKLGLSVHTVNAYLGSATIKLDSVNRIQAIAKAIRLGYI 247


>gi|82940563|emb|CAJ44292.1| putative transcription regulator protein MotS, LuxR family
           [Rhizobium leguminosarum bv. viciae]
          Length = 248

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 107/231 (46%), Positives = 152/231 (65%), Gaps = 3/231 (1%)

Query: 6   LTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIP 65
           +   + SS  +L PRL  +Q  + A+ FA++ ++ +   P +Q+L+CEL N+   +    
Sbjct: 18  VRVSRISSRSDLFPRLIAMQKLVDAQGFAIFRVSGS-GLPAKQRLVCELENWGPSNAGFG 76

Query: 66  NILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESS--GQLSVRLEGGLLPFAGIAFPVR 123
               + YGD  L H +  LLP+ W    +      +       RL+ G+LPF+G+AFPVR
Sbjct: 77  KAFTDAYGDILLDHIDKSLLPLSWAGGYDRAAPGPADFAPFMTRLQDGILPFSGLAFPVR 136

Query: 124 LGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
           LG   NG+++FT + +  +++ I+E HG C  ++ D L L ++R++AA  L+ERE +CLQ
Sbjct: 137 LGAVGNGFILFTGDEIDPSSDTIVELHGRCCHIMMDLLSLDERRTAAAEALSEREIACLQ 196

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           LAGDG  SEEIA+KLGLSVHTVNAYLGSAT+KLD+VNRIQAIAKAIR GYI
Sbjct: 197 LAGDGRISEEIADKLGLSVHTVNAYLGSATIKLDSVNRIQAIAKAIRLGYI 247


>gi|241203093|ref|YP_002974189.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240856983|gb|ACS54650.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 248

 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 107/231 (46%), Positives = 151/231 (65%), Gaps = 3/231 (1%)

Query: 6   LTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIP 65
           +   + SS  +L PRL  +Q    A+ FA++ ++ +   P +Q+L+CEL N+   +    
Sbjct: 18  VRVNRISSRSDLFPRLIAMQKLADAQGFAIFRVSGS-GIPAKQRLVCELENWGSSNAGFG 76

Query: 66  NILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSG--QLSVRLEGGLLPFAGIAFPVR 123
               + YGD  L H +  LLP+ W    +      +       RL+ G+LPF+G+AFPVR
Sbjct: 77  KAFTDAYGDILLDHIDKSLLPLSWAGGYDRAAPGPADFSPFMTRLQDGILPFSGLAFPVR 136

Query: 124 LGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
           LG   NG+++FT + +  +++ I+E HG C  ++ D L L ++R++AA  L+ERE +CLQ
Sbjct: 137 LGAVGNGFILFTGDEIDPSSDTIVELHGRCCHIMMDLLSLDERRTAAAEALSEREIACLQ 196

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           LAGDG  SEEIA+KLGLSVHTVNAYLGSAT+KLD+VNRIQAIAKAIR GYI
Sbjct: 197 LAGDGRISEEIADKLGLSVHTVNAYLGSATIKLDSVNRIQAIAKAIRLGYI 247


>gi|86356299|ref|YP_468191.1| LuxR family transcriptional regulator [Rhizobium etli CFN 42]
 gi|86280401|gb|ABC89464.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli CFN 42]
          Length = 248

 Score =  196 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 112/231 (48%), Positives = 151/231 (65%), Gaps = 3/231 (1%)

Query: 6   LTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIP 65
           +   + SS  +L PRL  +Q    A+ FA+Y ++ +   P +Q+L+CEL N+ L +    
Sbjct: 18  VRVNRISSRSDLFPRLIAMQKLADAQGFAIYRVSGS-GMPAKQRLVCELENWGLSNVGFG 76

Query: 66  NILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSG--QLSVRLEGGLLPFAGIAFPVR 123
               + YGD  L H    LLP+ W    +      +       RL+ G+LPF+G+AFPVR
Sbjct: 77  KAFTDAYGDILLDHIEKSLLPLSWAGAHDRAAPGPADFSPFMTRLKDGILPFSGLAFPVR 136

Query: 124 LGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
           LG   NG+++FT + +  +++ I+E HG C  V+ D L L ++RS+AA  L+ERE +CLQ
Sbjct: 137 LGAVGNGFILFTGDDIDPSSDTIVELHGRCCHVMMDLLSLDERRSAAAEALSEREIACLQ 196

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           LAGDG  SEEIAEKLGLSVHTVNAYLGSAT+KLD+VNRIQAIAKAIR GYI
Sbjct: 197 LAGDGRISEEIAEKLGLSVHTVNAYLGSATIKLDSVNRIQAIAKAIRLGYI 247


>gi|262283888|gb|ACY40752.1| VisR [Rhizobium leguminosarum bv. viciae]
          Length = 248

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 108/232 (46%), Positives = 152/232 (65%), Gaps = 3/232 (1%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
           T+   + SS  +L PRL  +Q    A+ FA++ ++ +   P +Q+L+CEL N+   +   
Sbjct: 17  TVRVNRISSRSDLFPRLIAMQKLADAQGFAIFRVSGS-GLPAKQRLVCELENWGSSNAGF 75

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSG--QLSVRLEGGLLPFAGIAFPV 122
                + YGD  L H +  LLP+ W    +      +       RL+ G+LPF+G+AFPV
Sbjct: 76  GKAFTDAYGDILLDHIDKSLLPLSWAGGYDRAAPGPADFSPFMTRLQDGILPFSGLAFPV 135

Query: 123 RLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCL 182
           RLG   NG+++FT + +  +++ I+E HG C  ++ D L L ++R++AA  L+ERE +CL
Sbjct: 136 RLGAVGNGFILFTGDEIDPSSDTIVELHGRCCHIMMDLLSLDERRTAAAEALSEREIACL 195

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           QLAGDG  SEEIA+KLGLSVHTVNAYLGSAT+KLD+VNRIQAIAKAIR GYI
Sbjct: 196 QLAGDGRISEEIADKLGLSVHTVNAYLGSATIKLDSVNRIQAIAKAIRLGYI 247


>gi|116250469|ref|YP_766307.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115255117|emb|CAK06191.1| regulator of flagellar and motility genes, also regulates rem
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 248

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 108/232 (46%), Positives = 153/232 (65%), Gaps = 3/232 (1%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
           T+   + SS  +L PRL  +Q   +A+ FA++ ++ +   P +Q+L+CEL N+   +   
Sbjct: 17  TVRVNRISSRSDLFPRLIAMQKLAEAQGFAIFRVSGS-GLPAKQRLVCELENWGSSNAGF 75

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSG--QLSVRLEGGLLPFAGIAFPV 122
                + YGD  L H +  LLP+ W    +      +       RL+ G+LPF+G+AFPV
Sbjct: 76  GKAFTDAYGDILLDHIDKSLLPLSWAGGYDRAAPGPADFSPFMTRLQDGILPFSGLAFPV 135

Query: 123 RLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCL 182
           RLG   NG+++FT + +  +++ I+E HG C  ++ D L L ++R++AA  L+ERE +CL
Sbjct: 136 RLGAVGNGFILFTGDEIDPSSDTIVELHGRCCHIMMDLLSLDERRTAAAEALSEREIACL 195

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           QLAGDG  SEEIA+KLGLSVHTVNAYLGSAT+KLD+VNRIQAIAKAIR GYI
Sbjct: 196 QLAGDGRISEEIADKLGLSVHTVNAYLGSATIKLDSVNRIQAIAKAIRLGYI 247


>gi|209547915|ref|YP_002279832.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533671|gb|ACI53606.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 248

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 106/231 (45%), Positives = 149/231 (64%), Gaps = 3/231 (1%)

Query: 6   LTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIP 65
           +   + SS  +L PRL  +Q    A  FA++ ++ +   P +Q+L+CEL N+   +    
Sbjct: 18  VRVNRISSRSDLFPRLIAMQKLADAHGFAIFRVSGS-GIPAKQRLVCELENWGSSNAGFG 76

Query: 66  NILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESS--GQLSVRLEGGLLPFAGIAFPVR 123
               + YGD  L H    LLP+ W    +      +       RL+ G++PF+G+AFPVR
Sbjct: 77  KAFTDAYGDALLEHIEKSLLPLSWAGGCDRAAPGPADFAPFMTRLQDGIVPFSGLAFPVR 136

Query: 124 LGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
           LG   NG+++FT + +  +++ I+E HG C  ++ D L L ++R++AA  L+ERE +CLQ
Sbjct: 137 LGAVGNGFIVFTGDEIDPSSDTIVELHGRCCHIMMDLLSLDERRTAAAEALSEREIACLQ 196

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           LAGDG  SEEIA+KLGLSVHTVNAYLGSAT+KLD+VNRIQAIAKAIR GYI
Sbjct: 197 LAGDGRISEEIADKLGLSVHTVNAYLGSATIKLDSVNRIQAIAKAIRLGYI 247


>gi|222084852|ref|YP_002543381.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
 gi|221722300|gb|ACM25456.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
          Length = 248

 Score =  188 bits (478), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 116/227 (51%), Positives = 159/227 (70%), Gaps = 3/227 (1%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
           + S   +L P+L  +Q  I A+NFALY ++ +   P +Q+L+CEL N+   +  +    +
Sbjct: 22  RISGRSDLFPKLVSMQKLIDAQNFALYRLSGS-GLPSKQRLVCELENWGSANPVMNKAFV 80

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETVIESS--GQLSVRLEGGLLPFAGIAFPVRLGFH 127
           E YG+  + H    LLP++W     ++  E+      + RL+  LLPFAG+AFPVRLG  
Sbjct: 81  EAYGEAMIEHIEKSLLPLMWNGRDSDSTAETPDFAAFTQRLKPHLLPFAGVAFPVRLGSV 140

Query: 128 KNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGD 187
            NGYV+FT++F+ +A+++I+E HG   Q++ + L L ++RS AA  L+ERE +CLQLAGD
Sbjct: 141 GNGYVVFTAKFMDVASDMIVELHGRSCQIMMELLSLDERRSPAAEALSEREIACLQLAGD 200

Query: 188 GYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           G  SEEIAEKLGLSVHTVNAYLGSAT+KLD+VNRIQAIAKAIRFGYI
Sbjct: 201 GRISEEIAEKLGLSVHTVNAYLGSATIKLDSVNRIQAIAKAIRFGYI 247


>gi|150395471|ref|YP_001325938.1| response regulator receiver protein [Sinorhizobium medicae WSM419]
 gi|150026986|gb|ABR59103.1| response regulator receiver protein [Sinorhizobium medicae WSM419]
          Length = 247

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 109/227 (48%), Positives = 145/227 (63%), Gaps = 3/227 (1%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
           +++    L  RL  +Q +I ARNFA+   N     P  ++L C LHN+     +I   LI
Sbjct: 21  RAAQAAGLVTRLQAMQRQINARNFAVLRTNGR-GLPAARKLTCVLHNWGTSCEEIARDLI 79

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETVIE--SSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
           + YG++ L H +  LLP++W    E    E    G  + RL+   LP++GIA P+RLG  
Sbjct: 80  DHYGEELLQHLDHSLLPVLWDGKGEHQTAETSDFGPFTRRLKDRKLPYSGIALPIRLGAQ 139

Query: 128 KNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGD 187
            NGYV+F   ++  + E I+E HG   Q++TD L   +KR   A  L++RE SCLQ+AGD
Sbjct: 140 GNGYVVFAGSYIDASGEQIVELHGRSAQIMTDLLTFDEKRPLKAEALSDREISCLQMAGD 199

Query: 188 GYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           G+ SEEIAEK+GLSVHTVNAYLG+AT KLD+VNRIQAIAKAIR GYI
Sbjct: 200 GHISEEIAEKMGLSVHTVNAYLGAATTKLDSVNRIQAIAKAIRLGYI 246


>gi|167566108|ref|ZP_02359024.1| probable transcriptional activator of quorum sensing autoinducer
           synthesis transcription regulator protein [Burkholderia
           oklahomensis EO147]
          Length = 236

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 47/240 (19%), Positives = 86/240 (35%), Gaps = 15/240 (6%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLD 60
           +++  L+  + S+  E+   L      +   NF+          P  +  I  L NY   
Sbjct: 5   LTDLLLSITQKSTSSEIFSSLEKYTRELGFDNFSY---GFCHPIPFTKPRIVILSNYPER 61

Query: 61  SGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAF 120
                + L     D  + H  +   P  W  +    V     +             G A 
Sbjct: 62  WRGRYSELGYVNIDPTVLHGRNSQSPFTWSELPTSDV-----RSFWDEANAHGLVVGWAK 116

Query: 121 PVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLEL------FKKRSSAARNL 174
            +       G +        L  + +   +     ++ D   +       K+ +++A  L
Sbjct: 117 SILDSDGGLGMLTLARSNEELCGKELAAKNLRMC-LLADLTHMVLSDAYRKEMTASADKL 175

Query: 175 TERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           + RE   L+   DG T++EI   L +S+ TV  +  +A VKL A N+  A+A+A   G +
Sbjct: 176 SAREVEILRWHADGKTADEIGRILSISIDTVKFHTKNAVVKLGASNKTAAVARAAIMGLL 235


>gi|227820844|ref|YP_002824814.1| predicted LuxR family transcriptional regulator [Sinorhizobium
           fredii NGR234]
 gi|227339843|gb|ACP24061.1| predicted LuxR family transcriptional regulator [Sinorhizobium
           fredii NGR234]
          Length = 246

 Score =  178 bits (453), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 101/220 (45%), Positives = 141/220 (64%), Gaps = 3/220 (1%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDF 76
           L  RL  +Q ++ A+NFA+  +N     P  ++L C LHN+   S    + L++ YG++ 
Sbjct: 27  LVTRLQAMQRQVNAKNFAVLRVNGR-GMPATRKLTCVLHNWGAASETNAHELLKVYGEEL 85

Query: 77  LFHFNSGLLPIIWQSIQEETVIESSGQ--LSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
           L H +   L ++W    E    ++      S RL+G  L ++GIAFP+RLG   NGYV+F
Sbjct: 86  LQHLDRSPLAVLWDGQGEHQAADAPDMALFSNRLKGRKLSYSGIAFPIRLGAQGNGYVVF 145

Query: 135 TSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEI 194
              ++    E +++ HG C QV+ D L   ++R     +L++RE +CLQ+AGDGY SEEI
Sbjct: 146 AGSYIDAPAEQVLDLHGRCAQVMADMLAADERRLFKGESLSDREIACLQMAGDGYISEEI 205

Query: 195 AEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           AEK+GLSVHTVNAYLG+AT KLD+VNRIQAIAKAIR GYI
Sbjct: 206 AEKMGLSVHTVNAYLGAATTKLDSVNRIQAIAKAIRLGYI 245


>gi|325291914|ref|YP_004277778.1| transcriptional regulator, LuxR family [Agrobacterium sp. H13-3]
 gi|325059767|gb|ADY63458.1| transcriptional regulator, LuxR family [Agrobacterium sp. H13-3]
          Length = 248

 Score =  177 bits (449), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 108/225 (48%), Positives = 147/225 (65%), Gaps = 3/225 (1%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S  +L P+L  +Q  + ARNF +    +A  FP +++L CEL N+ +++ +     I  
Sbjct: 24  TSRSDLFPKLVAMQKLVGARNFVVTK-AAASGFPNKKKLTCELENWGMNAAEQSAQFIRA 82

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIE--SSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
            GD  L H  + LLP+IW++       +      L  R+E   LP+AG+A PVRLG   N
Sbjct: 83  VGDILLDHIETSLLPVIWRNKNAGGFADLPDVPALMRRIENDTLPYAGLALPVRLGTIGN 142

Query: 130 GYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGY 189
           GY++F    L+L NEV+IE H  C +++ D L L +++ + +  L+ERE +CLQLAGDG 
Sbjct: 143 GYIVFCGSNLVLDNEVVIEQHIKCCEIMVDMLALDERKVAPSEALSEREIACLQLAGDGR 202

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            SEEIA KLGLSVHTVNAYLGSAT+KLD+VNRIQAIAKAIR GYI
Sbjct: 203 ISEEIAVKLGLSVHTVNAYLGSATIKLDSVNRIQAIAKAIRLGYI 247


>gi|15964401|ref|NP_384754.1| putative transcription regulator protein [Sinorhizobium meliloti
           1021]
 gi|307311543|ref|ZP_07591184.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
 gi|307318898|ref|ZP_07598329.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|3894103|emb|CAA11949.1| unnamed protein product [Sinorhizobium meliloti]
 gi|15073578|emb|CAC45220.1| Regulator of flagellar operons, LuxR family, probable forming a
           heterodimer with VisN [Sinorhizobium meliloti 1021]
 gi|306895312|gb|EFN26067.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|306899560|gb|EFN30189.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
          Length = 246

 Score =  175 bits (445), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 107/220 (48%), Positives = 139/220 (63%), Gaps = 3/220 (1%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDF 76
           L  RL  +Q +I A+NFA+   N     P  ++L C LHN+     +    LI  YGD+ 
Sbjct: 27  LVTRLQAMQRQINAKNFAVLRTNGR-GLPATRKLTCVLHNWGASCEENARDLIMLYGDEL 85

Query: 77  LFHFNSGLLPIIWQSIQEETVIE--SSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
           L H +  LLP++W    E    E    G  + RL    LP++GIAFP+RLG   NGYV+F
Sbjct: 86  LQHLDLSLLPVLWNGQGEHQTAEVSDFGPFTRRLRERKLPYSGIAFPIRLGAQGNGYVMF 145

Query: 135 TSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEI 194
              ++  + E I+E HG   Q++ D L   +KR   A  L++RE +CLQ+AGDG+ SEEI
Sbjct: 146 AGSYIDASGEQIVELHGRSAQIMADLLAADEKRLFKAEALSDREIACLQMAGDGHISEEI 205

Query: 195 AEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           AEK+GLSVHTVNAYLG+AT KLD+VNRIQAIAKAIR GYI
Sbjct: 206 AEKMGLSVHTVNAYLGAATTKLDSVNRIQAIAKAIRLGYI 245


>gi|159045392|ref|YP_001534186.1| transcriptional regulator [Dinoroseobacter shibae DFL 12]
 gi|157913152|gb|ABV94585.1| transcriptional regulator [Dinoroseobacter shibae DFL 12]
          Length = 236

 Score =  175 bits (444), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 49/237 (20%), Positives = 92/237 (38%), Gaps = 22/237 (9%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
             +++ SL ++  RL  ++  ++  NFA + ++++ +             YD        
Sbjct: 11  DLQEAKSLDDVQARLFGLRESLEVENFAYHCLDASGNK-------YGAMTYDAPWVKRYI 63

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
            +     D  +        P+ W+ +          +         +   G++ PVR   
Sbjct: 64  EMDYARVDPVIKGTYQRFHPVDWKQLDWSPKAAR--EFMGEALETGVGNQGLSVPVRGPN 121

Query: 127 HKNGYVIFTSEFLMLANE---------VIIEAHGACYQVITDFLELFKKRSSAARNLTER 177
            +       +     A E          I+ AH    +     LEL +  +  A+ L+ R
Sbjct: 122 GQFAVFSVNNRATDAAWESYQKEYLKTFILAAHFINQRA----LELEEDINPTAKPLSPR 177

Query: 178 ETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           E+  L    +G +  ++AEKL +S HT+  Y+ SA  KL A N   A+A+A+  G I
Sbjct: 178 ESDALTHLANGLSRGQVAEKLKISEHTLRVYIESARFKLGAANTTHAVARAMVRGLI 234


>gi|15887874|ref|NP_353555.1| LuxR family transcriptional regulator [Agrobacterium tumefaciens
           str. C58]
 gi|15155462|gb|AAK86340.1| transcriptional regulator, LuxR family [Agrobacterium tumefaciens
           str. C58]
          Length = 251

 Score =  174 bits (442), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 107/225 (47%), Positives = 147/225 (65%), Gaps = 3/225 (1%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S  +L P+L  +Q  + ARNF +    +A  FP ++++ CEL N+ +++ +     I  
Sbjct: 27  TSRSDLFPKLVAMQKLVGARNFVVTK-AAASGFPNKKKMTCELENWGMNAAEQSAQFIRA 85

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIE--SSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
            GD  L H  + LLP+IW++       +      L  R+E   LP+AG+A PVRLG   N
Sbjct: 86  VGDILLDHIETSLLPVIWRNKNAGGFADLPDVPALLRRIENDTLPYAGLALPVRLGTIGN 145

Query: 130 GYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGY 189
           GY++F    L+L NEV+IE H  C +++ D L L +++ + +  L+ERE +CLQLAGDG 
Sbjct: 146 GYIVFCGTNLILDNEVVIEQHIKCCEIMVDMLALDERKVAPSEALSEREIACLQLAGDGR 205

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            SEEIA KLGLSVHTVNAYLGSAT+KLD+VNRIQAIAKAIR GYI
Sbjct: 206 ISEEIAVKLGLSVHTVNAYLGSATIKLDSVNRIQAIAKAIRLGYI 250


>gi|145301148|ref|YP_001143989.1| LuxR family transcriptional regulator [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142853920|gb|ABO92241.1| transcriptional regulator, LuxR family [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 260

 Score =  174 bits (442), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 58/232 (25%), Positives = 96/232 (41%), Gaps = 10/232 (4%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
           K+    E+  +L    +++    F  + +        ++  +   +N      +  +   
Sbjct: 17  KAKKTSEIQQQLERFSHQM---GFDYFRLLIIFPISMQKSHVALFNNCPTSWFEAYSERH 73

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
               D  +F       PI W  +  ++  + S+ +  + L        G++FP+     +
Sbjct: 74  YLTQDPVVFLGLKQTQPIFWNKLDCDSPWLPSASREVMNLAADFGVRNGVSFPLHTPQGE 133

Query: 129 NGYVIFTS---EFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTE---RETSCL 182
           +G + F S       L  E +         +    L+L K R    ++LTE   RE  CL
Sbjct: 134 HGILSFISKEKSNSDLMFENVPLLSFCASYIFNSALQLIKSRPDLMKHLTELSDREKECL 193

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             A +G TS EIA  LG+S  TVN +L   T K D+ NR QAIAK+I  G I
Sbjct: 194 FWASEGKTSWEIATILGISERTVNFHLNQVTNKTDSKNRNQAIAKSISSGII 245


>gi|220921013|ref|YP_002496314.1| LuxR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219945619|gb|ACL56011.1| transcriptional regulator, LuxR family [Methylobacterium nodulans
           ORS 2060]
          Length = 245

 Score =  173 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 48/232 (20%), Positives = 78/232 (33%), Gaps = 9/232 (3%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           + +SS   L   L          +F +  +               L  + ++        
Sbjct: 16  QAASSQTALFSELKEAGRYFGYDSFIVTGLPHRQGENLND--CSLLVGWPMEWAKRYTER 73

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
              + D  +      L P +W     +   +      +          G   P+     +
Sbjct: 74  RYIHVDPVIAQIRRTLDPFMWDEAPYD-RSDPGPATVMNESPSFGLNQGFCVPIHRIDGR 132

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARN------LTERETSCL 182
              V F +  + L+++     H       +    L    S+ A         + RE  C+
Sbjct: 133 EAGVSFGASRMDLSDDARAGLHLVAIYAFSAARALSAMPSNPADPERQPPRCSAREIECM 192

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           + A  G T  EI+E L LS  TV AYL +A  KL   NR+  IA+AIR G I
Sbjct: 193 RWAAAGKTGWEISEILSLSQRTVEAYLNNAARKLGVANRVHLIAEAIRHGLI 244


>gi|330831695|ref|YP_004394647.1| LuxR family transcriptional regulator [Aeromonas veronii B565]
 gi|328806831|gb|AEB52030.1| Transcriptional regulator, LuxR family [Aeromonas veronii B565]
          Length = 258

 Score =  173 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 56/232 (24%), Positives = 95/232 (40%), Gaps = 10/232 (4%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
           K++   ++   L    +++    F  + +        ++  +   +N      D  +   
Sbjct: 15  KATKTSDIQQLLERFSHQM---GFDYFRLLIIFPISMQKSHVALFNNCPTTWFDAYSENQ 71

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
               D  ++       PI W  +  ++  + S+ +  + L        G++FP+     +
Sbjct: 72  YLTQDPVVYLGLKQTQPIFWNKLDCDSPWLPSASRDVMNLAADFGVRNGVSFPLHTPQGE 131

Query: 129 NGYVIFTSEF---LMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTE---RETSCL 182
           +G + F ++      L  E +         +    L+L K R    + LTE   RE  CL
Sbjct: 132 HGILSFITKDKSNSDLMFENVPLLSFCASYIFNSALQLIKSRPDMMKYLTELSDREKECL 191

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             A +G TS EIA  LG+S  TVN +L   T K D+ NR QAIAK I  G I
Sbjct: 192 FWASEGKTSWEIATILGISERTVNFHLTQVTNKTDSKNRSQAIAKGITSGII 243


>gi|222149994|ref|YP_002550951.1| transcriptional regulator LuxR family [Agrobacterium vitis S4]
 gi|221736976|gb|ACM37939.1| transcriptional regulator LuxR family [Agrobacterium vitis S4]
          Length = 251

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 105/238 (44%), Positives = 146/238 (61%), Gaps = 6/238 (2%)

Query: 2   SENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDS 61
           S   L  + +++  ++ PRL  +Q  I AR+FA++ +  +   PR++ L CE  ++    
Sbjct: 14  SAADLKARLAANRGDIFPRLIAMQKAINARSFAVFRVAGS-GLPRKRMLQCECESWAASG 72

Query: 62  G--DIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVI--ESSGQLSVRLEGGLLPFAG 117
                 +  +  YGD  L H +  LLP++W +    T       G    RL  G LPF+G
Sbjct: 73  MVGSYSDAFVSCYGDLLLSHIDDLLLPLMWNAKDNATFCISSEFGAFVSRLPAGNLPFSG 132

Query: 118 IAFPVRLGFHKNGYVIFTSEF-LMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTE 176
           +AFPVRLG   NGYVIF       L ++V+I+ H    +++ D L L +++ + +  L++
Sbjct: 133 VAFPVRLGAVGNGYVIFALNGSEDLDSDVMIDMHNRSCKLMMDILSLSERKVAPSEALSD 192

Query: 177 RETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           RE +CLQLAGDG  SEEIAE LGLSVHTVNAYLGSAT+KLD+VNRIQAIAKAIR GYI
Sbjct: 193 REIACLQLAGDGRISEEIAENLGLSVHTVNAYLGSATIKLDSVNRIQAIAKAIRLGYI 250


>gi|126730312|ref|ZP_01746123.1| autoinducer-binding transcriptional regulator LuxR [Sagittula
           stellata E-37]
 gi|126709045|gb|EBA08100.1| autoinducer-binding transcriptional regulator LuxR [Sagittula
           stellata E-37]
          Length = 226

 Score =  172 bits (437), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 44/232 (18%), Positives = 86/232 (37%), Gaps = 15/232 (6%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           + +  L++L   +  +++     +   + +NSA +             YDL+  +     
Sbjct: 2   ESADGLEDLQLLIEELRDEYGVDHIVYHWVNSAGEQ-------YGCGTYDLEWVNHYIEK 54

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +        P+ W+ +   +   S+        G  +   G + P+R    +
Sbjct: 55  GYLRIDPVIQGCYQRFHPVNWKRLDWSSK--SARAFLEDAIGHGIGNQGYSIPIRGPNGQ 112

Query: 129 NGYVIFTSEFLMLANEV-----IIEAHGACYQVITDFLELFKKRSS-AARNLTERETSCL 182
                 +        E        +     +   +  LE    R+   A+ L+ RE   +
Sbjct: 113 FALFTMSHSCNDDEWEAFTISNRRDLILVAHSFNSKALEFEPGRTPEPAQPLSPREIEAM 172

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            L   GY+  + A+ L +S HT+  Y+ SA  KL A+N   A+A+A+  G I
Sbjct: 173 TLLAIGYSRAQAADTLSISEHTLRVYVESARHKLGAMNTTHAVAQALSRGVI 224


>gi|39933398|ref|NP_945674.1| two-component LuxR family transcriptional regulator
           [Rhodopseudomonas palustris CGA009]
 gi|39647244|emb|CAE25765.1| two-component transcriptional regulator, LuxR family
           [Rhodopseudomonas palustris CGA009]
          Length = 243

 Score =  172 bits (436), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 46/240 (19%), Positives = 83/240 (34%), Gaps = 7/240 (2%)

Query: 1   MSENTLTGKKSSSLQELSPRLHL------IQNRIKARNFALYTINSALDFPRRQQLICEL 54
           + E+ L G+++    +   RL         ++ I +  F  Y +            +   
Sbjct: 3   VGEDQLWGRRALEFVDSVERLEAPALISRFESLIASCGFTAYIMAGLPSRNAGLPELTLA 62

Query: 55  HNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLP 114
           + +  D  D+      +  D    H  + + P +W     +   + +    +        
Sbjct: 63  NGWPRDWFDLYVSENFSAVDPVPRHGATTVHPFVWSDAPYDRDRDPAAHRVMTRAAEFGL 122

Query: 115 FAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNL 174
             G   P+      +  +    +   L+               +    L + +      L
Sbjct: 123 VEGYCIPLHYDDG-SAAISMAGKDPDLSPAARGAMQLVSIYAHSRLRALSRPKPIRRNRL 181

Query: 175 TERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           T RE   LQ A  G T+ EI+  L ++  TV  +L  A  KLDA NR  A+AKA+  G I
Sbjct: 182 TPRECEILQWAAQGKTAWEISVILCITERTVKFHLIEAARKLDAANRTAAVAKALTLGLI 241


>gi|192288754|ref|YP_001989359.1| LuxR family transcriptional regulator [Rhodopseudomonas palustris
           TIE-1]
 gi|192282503|gb|ACE98883.1| transcriptional regulator, LuxR family [Rhodopseudomonas palustris
           TIE-1]
          Length = 243

 Score =  171 bits (435), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 46/240 (19%), Positives = 83/240 (34%), Gaps = 7/240 (2%)

Query: 1   MSENTLTGKKSSSLQELSPRLHL------IQNRIKARNFALYTINSALDFPRRQQLICEL 54
           + E+ L G+++    +   RL         ++ I +  F  Y +            +   
Sbjct: 3   VGEDQLWGRRALEFVDSVERLEAPALISRFESLIASCGFTAYIMAGLPSRNAGLPELTLA 62

Query: 55  HNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLP 114
           + +  D  D+      +  D    H  + + P +W     +   + +    +        
Sbjct: 63  NGWPRDWFDLYVSENFSAVDPVPRHGATTVYPFVWSDAPYDRDRDPAAHRVMTRAAEFGL 122

Query: 115 FAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNL 174
             G   P+      +  +    +   L+               +    L + +      L
Sbjct: 123 VEGYCIPLHYDDG-SAAISMAGKDPDLSPAARGAMQLVSIYAHSRLRALSRPKPIRRNRL 181

Query: 175 TERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           T RE   LQ A  G T+ EI+  L ++  TV  +L  A  KLDA NR  A+AKA+  G I
Sbjct: 182 TPRECEILQWAAQGKTAWEISVILCITERTVKFHLIEAARKLDAANRTAAVAKALTLGLI 241


>gi|115524334|ref|YP_781245.1| LuxR family transcriptional regulator [Rhodopseudomonas palustris
           BisA53]
 gi|115518281|gb|ABJ06265.1| transcriptional regulator, LuxR family [Rhodopseudomonas palustris
           BisA53]
          Length = 246

 Score =  171 bits (434), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 43/227 (18%), Positives = 69/227 (30%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNI 67
            ++ S+L  +S  +  I+    A  F    +    +  +    +     +  +   +   
Sbjct: 18  VEELSTLTTISAAIDFIEKGFCAYGFETIIVTGIPNHKQSFSQMVMAKRWPDEWFKLYTQ 77

Query: 68  LIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
                 D  + H      P  W         E      +          G   PV     
Sbjct: 78  NNYHRDDPVVRHLRKSFNPFEWSDAPYSRRNEPRAAAVMDRAADFRMSRGFIVPVHGLAG 137

Query: 128 KNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGD 187
               V    + + L        H            L    + A   LT RE   L     
Sbjct: 138 YEAAVSLGGDHIDLNPRSKPALHLMAMYAFDRIRSLVSPANDAPPRLTHRECETLNWTAQ 197

Query: 188 GYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           G ++ EI E L ++  T   +L +A  KL AVN+  A+A AIR   I
Sbjct: 198 GKSAWEIGEILQIAQRTAEEHLATAARKLGAVNKTHAVAIAIRQKLI 244


>gi|316931698|ref|YP_004106680.1| LuxR family transcriptional regulator [Rhodopseudomonas palustris
           DX-1]
 gi|315599412|gb|ADU41947.1| transcriptional regulator, LuxR family [Rhodopseudomonas palustris
           DX-1]
          Length = 243

 Score =  171 bits (434), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 48/240 (20%), Positives = 83/240 (34%), Gaps = 7/240 (2%)

Query: 1   MSENTLTGKKSSSLQELSPRLHL------IQNRIKARNFALYTINSALDFPRRQQLICEL 54
           + E+ L G+++    +   RL         ++ I +  F  Y I            +   
Sbjct: 3   VGEDQLWGRRALEFVDAVERLDAPALVSQFESLIASCGFTAYIIAGLPSRNAGLPELTLA 62

Query: 55  HNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLP 114
           + +  D  D+      +  D    H  S + P +W     +   + +    +        
Sbjct: 63  NGWPRDWFDLYVSENFSAVDPVPRHVASTVHPFVWSEAPYDRDRDPAAHRVMTRAAEFGL 122

Query: 115 FAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNL 174
             G   P+      +  +    +   L+               +    L + +      L
Sbjct: 123 VEGYCIPLHYDDG-SAAISMAGKDPDLSPAARGAMQLVSIYAHSRLRTLGRPKPGRRNKL 181

Query: 175 TERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           T RE   LQ A  G T+ EI+  L ++  TV  +L  A  KLDA NR  A+AKA+  G I
Sbjct: 182 TARECEILQWAAQGKTAWEISMILCIAERTVKFHLIEAARKLDAANRTAAVAKALTLGLI 241


>gi|9297072|sp|P74946|VANR_VIBAN RecName: Full=Transcriptional activator protein vanR
 gi|1568660|gb|AAC45213.1| VanR [Listonella anguillarum]
          Length = 240

 Score =  171 bits (433), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 54/232 (23%), Positives = 88/232 (37%), Gaps = 13/232 (5%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++ +S  +L   L+ + N I    F L+ ++        +       NY        +  
Sbjct: 12  QQITSHDDLENVLNGLNNLIGHEFF-LFGLSFQPTLKTSE--TLVTDNYPNSWRQQYDES 68

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
              + D  + +  +  LPI W    +   + + G++           AG + P+     +
Sbjct: 69  GFMHIDPIVKYSITNFLPIRW---DDAKRVNNDGRVIFEEARCNGLKAGFSIPIHGLRGE 125

Query: 129 NGYVIFTSEFL---MLANEVIIEAHGA---CYQVITDFLELFKKRSSAARNLTERETSCL 182
            G + F +       L  + I  +          I +     K     A  LT RE  CL
Sbjct: 126 FGMISFATSDTKSYDLNQQSIHTSQLIVPLLAHNIGNITRYHKDAKPRA-VLTAREVQCL 184

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             A +G ++ EIA  +  S  TV  +  +A  KL A NR QAI KAI  GYI
Sbjct: 185 AWAAEGKSAWEIATIINTSERTVKFHFSNACKKLGATNRYQAITKAILGGYI 236


>gi|167589289|ref|ZP_02381677.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia ubonensis Bu]
          Length = 229

 Score =  170 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 44/233 (18%), Positives = 77/233 (33%), Gaps = 16/233 (6%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           +++ S +E+   +      +    +        + +P  +  I  L+NY           
Sbjct: 5   EQADSEREIYGWIEHAARSL---GYEYCAYGLRMPWPVSRPRIYMLNNYPEAWQKRYQEA 61

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  + H      P++W         +                 G           
Sbjct: 62  RYVDIDPTVKHARRSQAPLVWSDACFAATPQ-----LWCEAQAHGLRHGWTQSAFDSCGV 116

Query: 129 NGYVIFTSEFLMLANEVI-------IEAHGACYQVITDFLELFKKRSSAARNLTERETSC 181
           +G +        +    +              +  +T  L L K      R LT+RE   
Sbjct: 117 SGMLTLARSNGPITPAELEQNEFKMRWLVSTAHLAMTGKL-LPKLAPDTERGLTDREVEV 175

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           L+ A DG TS EI+  L +SV TVN ++ +A  KL A N+  A+ +A   G +
Sbjct: 176 LKWAADGKTSGEISTILVISVDTVNFHVKNAVSKLKAANKTSAVVRATMLGLL 228


>gi|260425367|ref|ZP_05779347.1| autoinducer-binding transcriptional regulator LuxR [Citreicella sp.
           SE45]
 gi|260423307|gb|EEX16557.1| autoinducer-binding transcriptional regulator LuxR [Citreicella sp.
           SE45]
          Length = 242

 Score =  170 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 41/234 (17%), Positives = 81/234 (34%), Gaps = 15/234 (6%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
             + +   ++L      +++R K  +   + +++  +             YD    +   
Sbjct: 16  QLELAERREDLQSVAEALRDRFKVDHLVYHWVSANGEQ-------YGCGTYDPVWVERYL 68

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                  D  +        P+ W+ +   +    +           +   G + P+R   
Sbjct: 69  EKGYLRIDPVIQGCFQRFHPVDWKRLDWSSKAARA--FQWDAIAHGVGNQGYSIPIRGPN 126

Query: 127 HKNGYVIFTSEFLMLANEV-----IIEAHGACYQVITDFLELFK-KRSSAARNLTERETS 180
            +             A          +     +      LEL   +R   A+ L+ RE  
Sbjct: 127 GQFALFTVNHSCDDEAWAEFTALNRRDMILIAHYFNQKALELEPGRRPEPAQPLSPREIE 186

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            + L   GY+  ++AE L +S HT+  Y+ SA  KL A+N   A+A+A+  G I
Sbjct: 187 AMTLIAVGYSRAQVAETLSISEHTLRVYIESARFKLGAMNTTHAVARALSRGLI 240


>gi|218532854|ref|YP_002423670.1| LuxR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218525157|gb|ACK85742.1| transcriptional regulator, LuxR family [Methylobacterium
           chloromethanicum CM4]
          Length = 243

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 54/231 (23%), Positives = 85/231 (36%), Gaps = 6/231 (2%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYT---INSALDFPRRQQLICELHNYDLDSGD 63
           +  ++ S +++   L  I  R+ A          I       R Q+    L N   +   
Sbjct: 15  SLDRAHSREDI---LRAIMPRLNALGIEYVISAMIPLKRLPARTQKNYLILENTSDEWNR 71

Query: 64  IPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVR 123
           +       Y D  +    S      W  I+   V++   +  +   G      G   P+ 
Sbjct: 72  LYFSKGYMYTDPVVQATLSSTTGFRWSEIEPAGVLDPRSRQVMNEAGEFGLGDGFTVPLA 131

Query: 124 LGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
               + G + F    L ++             V+   L +    S     LT RE   LQ
Sbjct: 132 TLEEERGGLTFAGPRLDISPGQRGMLTLLASYVVGQTLLIDNGPSERRMGLTPRERESLQ 191

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              +G T  EI E +G+S H V+ +L SA VKL  V+R QA+A+  R G I
Sbjct: 192 WVAEGKTDWEIGELMGISRHGVDFHLRSARVKLGCVSRTQAVAEGFRRGLI 242


>gi|163853910|ref|YP_001641953.1| autoinducer-binding domain-containing protein [Methylobacterium
           extorquens PA1]
 gi|163665515|gb|ABY32882.1| Autoinducer-binding domain protein [Methylobacterium extorquens
           PA1]
          Length = 243

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 54/231 (23%), Positives = 85/231 (36%), Gaps = 6/231 (2%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYT---INSALDFPRRQQLICELHNYDLDSGD 63
           +  ++ S +++   L  I  R+ A          I       R Q+    L N   +   
Sbjct: 15  SLDRAHSREDI---LRAIMPRLNALGIEYVISAMIPLKRLPARTQKNYLILENTSDEWNR 71

Query: 64  IPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVR 123
           +       Y D  +    S      W  I+   V++   +  +   G      G   P+ 
Sbjct: 72  LYFSKGYMYTDPVVQATLSSTTGFRWSEIEPAGVLDPRSRQVMNEAGEFGLGDGFTVPLA 131

Query: 124 LGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
               + G + F    L ++             V+   L +    S     LT RE   LQ
Sbjct: 132 TLEEERGGLTFAGPQLDISPGQRGMLTLLASYVVGQTLLIDNGPSERRMGLTPRERESLQ 191

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              +G T  EI E +G+S H V+ +L SA VKL  V+R QA+A+  R G I
Sbjct: 192 WVAEGKTDWEIGELMGISRHGVDFHLRSARVKLGCVSRTQAVAEGFRRGLI 242


>gi|117620077|ref|YP_855658.1| transcriptional activator protein AhyR/asaR [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|117561484|gb|ABK38432.1| transcriptional activator protein AhyR/asaR [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 264

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 36/226 (15%), Positives = 77/226 (34%), Gaps = 4/226 (1%)

Query: 13  SLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETY 72
           +  +    + L++       F  + +        ++  +   +       D         
Sbjct: 23  TAADERTIVTLLRELSGRMGFDYFRLALIFPSTIQRPDVIIFNGCPQAWVDTYTSSGFFA 82

Query: 73  GDDFLFHFNSGLLPIIWQSIQ-EETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
            D  +    +   PI+W  +  +E   +  G+  ++L        GI  P        G 
Sbjct: 83  IDPIVKCAMTKSTPILWADVVNDEERCDEQGREMMQLANEYGICDGITLPWHGANGHVGL 142

Query: 132 VIFTSEFLMLANEVIIE---AHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDG 188
           + F +       + +            +      +     S    L+ RE    + A +G
Sbjct: 143 LSFITSTPRTQQQWLSAVPFISWLSMHIFEAVARVCLAGLSPHDALSLRELEVCRWAAEG 202

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               +IA+ LG++  TV  +L +   KL A ++ QAI+ A++ G +
Sbjct: 203 KQVSDIAQILGITPRTVTFHLNNVVSKLGASSKSQAISWALKQGMV 248


>gi|88797814|ref|ZP_01113402.1| LuxR, transcriptional regulator [Reinekea sp. MED297]
 gi|88779491|gb|EAR10678.1| LuxR, transcriptional regulator [Reinekea sp. MED297]
          Length = 240

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 57/233 (24%), Positives = 88/233 (37%), Gaps = 11/233 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           +++ S  EL   L  I   ++   F  +    AL        I    NY  +   + +  
Sbjct: 8   QQAQSTSELPEILESISQVVE---FDYFLFGLALPNSITHSDILMYDNYPGEWRRVYDES 64

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  + +  S  +P+ W  I E      S    +         AG + P+     +
Sbjct: 65  GYAKRDPIVQYSISNYMPVTWAQISESPSYSRSDLKIMWEAEASGLKAGFSLPIHGAVGE 124

Query: 129 NGYVIFTSEFLMLA-----NEVIIEAHGACYQVITDF--LELFKKRSSAARNLTERETSC 181
            G + F S            E I         +      L + + +   A  LT+RE  C
Sbjct: 125 FGMISFASNHNTDEQRLKYAEAIPVIQMLVPAIQDAVKRLRVSESKEPPA-KLTKREIEC 183

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           L  A +G +S EI++ LG S  T   +L +A  KL A NR QAI+KA+  G I
Sbjct: 184 LTWATEGKSSWEISQILGCSERTAIFHLSNAANKLGATNRYQAISKALLCGII 236


>gi|82703532|ref|YP_413098.1| LuxR family transcriptional regulator [Nitrosospira multiformis
           ATCC 25196]
 gi|82411597|gb|ABB75706.1| transcriptional regulator, LuxR family [Nitrosospira multiformis
           ATCC 25196]
          Length = 244

 Score =  169 bits (429), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 50/231 (21%), Positives = 80/231 (34%), Gaps = 14/231 (6%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
            S++EL      I   +   +F        ++    +     L  Y  +     +     
Sbjct: 14  DSVEELHSATTTIARAMGFEHFLY---GVQVNTSLTRPYRFILSCYPEEWRKHYDKEGYA 70

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  + H     +PIIW+    E                    +G +F V  G  +   
Sbjct: 71  NFDPTVSHCARTSIPIIWKK---EIFKGRRETRVRNEAKDCGLVSGASFSVHGGRGEAAM 127

Query: 132 VIFTSEFLMLANE-----VIIEAHGACYQVITDFLE--LFKKRSSAARN-LTERETSCLQ 183
           +   +       +      + +A      +        L K      +  LTERE  CL 
Sbjct: 128 LSLATSRESREAQNDILATMAKAQLLTCYLHEAVQRIVLSKGPLPVKKANLTEREQECLL 187

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G T  EIA  + +S  TV  +L +A  KL  VNR QAI++A+  G I
Sbjct: 188 WAAEGKTGWEIANIVKISERTVTFHLQNAIQKLGVVNRQQAISRALSMGLI 238


>gi|27376354|ref|NP_767883.1| transcriptional regulator [Bradyrhizobium japonicum USDA 110]
 gi|27349494|dbj|BAC46508.1| transcriptional regulatory protein [Bradyrhizobium japonicum USDA
           110]
          Length = 242

 Score =  168 bits (427), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 47/223 (21%), Positives = 79/223 (35%), Gaps = 2/223 (0%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFP-RRQQLICELHNYDLDSGDIPNILIETY 72
           L +++  L  +   +    F  +  +          +             D+ +     +
Sbjct: 18  LPDVASILDAMSRTLGQHGFDYFCSSYVAPLSTESPREAVLAERLPAGFLDMYSEAQYVW 77

Query: 73  GDDFLFHFNSGLLPIIW-QSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
            D  L +  + L P  W +    +   E      VR         G+  PV     + G 
Sbjct: 78  HDPALRYCRTTLQPFRWFREAPYDPEREPRAVELVRRARDFGMVDGVVIPVISPAGRTGQ 137

Query: 132 VIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTS 191
           V F    + L    +   H          L+L    ++    L+ RE   L LA  G +S
Sbjct: 138 VWFGGAEIDLPERDLPALHLMALYAFDRVLKLRGLPAAPQLALSLREREVLTLAAVGRSS 197

Query: 192 EEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +EIA+ L ++  TV A++ S   KL A  R QA+  A+R   I
Sbjct: 198 DEIADALAITGRTVKAHIKSCCKKLGAATRTQAVMIAMRDRII 240


>gi|27376173|ref|NP_767702.1| transcriptional regulator [Bradyrhizobium japonicum USDA 110]
 gi|27349312|dbj|BAC46327.1| transcriptional regulatory protein [Bradyrhizobium japonicum USDA
           110]
          Length = 242

 Score =  168 bits (425), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 40/218 (18%), Positives = 68/218 (31%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDF 76
           +   ++ ++       F    +    +  +R   +     +     ++         D  
Sbjct: 23  VPDAMNALEAAFGRFGFETIIVTGLPNPDQRFAQMVLAKRWPAGWFNLYTQNNYDRFDPV 82

Query: 77  LFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTS 136
           +      + P  W     +  +E S    +   G      G   P+         V    
Sbjct: 83  VRLCRQSVNPFEWSEAPYDAELEPSAAEVMNRAGDFRMSRGFIVPIHGLTGYEAAVSLGG 142

Query: 137 EFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAE 196
             L L        H            L +     +  LT RE   +  A  G ++ EI E
Sbjct: 143 VHLDLNPRSKPALHLMAMYGFDHIRRLLEPTPYPSTRLTPREREVISWASQGKSAWEIGE 202

Query: 197 KLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            L ++  T   +L +A  KL AVNR  A+A AIR   I
Sbjct: 203 ILHITQRTAEEHLATAARKLGAVNRTHAVALAIRHKII 240


>gi|88812489|ref|ZP_01127738.1| transcriptional regulator, LuxR family protein [Nitrococcus mobilis
           Nb-231]
 gi|88790275|gb|EAR21393.1| transcriptional regulator, LuxR family protein [Nitrococcus mobilis
           Nb-231]
          Length = 249

 Score =  167 bits (424), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 47/231 (20%), Positives = 87/231 (37%), Gaps = 10/231 (4%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           +  ++ +      +       +F      ++      +  +  +  +     D       
Sbjct: 17  ADGVEGVQRLCAALGEAYGFDHFIY---GASFPTSLIKPAVLVISGHPEAWRDHYQACGY 73

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
              D  + H    + P+IWQ +  +  I+      ++        +G++  +R    + G
Sbjct: 74  LAVDPAVQHCTRSIRPLIWQDLMLDPKIDEKPFTVMQEAREFGLVSGVSLSIRGSRGELG 133

Query: 131 YVIFTSEFLMLANE-----VIIEAHGACYQVITDFLELFKKRSSA--ARNLTERETSCLQ 183
            + F+SE             I + +     V      L  + S       LT RE  CL 
Sbjct: 134 VLSFSSERTAQQTRSEIDSAIPDLYLLSAYVHEAVGRLVTQGSLPFNRPELTAREHECLL 193

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG+S  T   +L +A  +L+A +R QA+A+A+  G I
Sbjct: 194 WAAEGKTSWEIARILGISERTAIFHLQNAARRLNASSRQQAVARAVSQGLI 244


>gi|171316408|ref|ZP_02905627.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           MEX-5]
 gi|171098441|gb|EDT43244.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           MEX-5]
          Length = 237

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 45/231 (19%), Positives = 74/231 (32%), Gaps = 16/231 (6%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           + S  ++          ++A  F   +    +  P  +       NY     D       
Sbjct: 15  AKSEADVF---LEFTADVRALGFEYCSFGLRVPLPVSKPQFMLQSNYPQTWVDRYVSQNY 71

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
              D  + H  S + P+IW++  +   +E                 G   P        G
Sbjct: 72  FAVDPTVRHGLSQMSPLIWRADSQTQSVE-----FWDEAEHHGLRHGWCMPSISRTGAIG 126

Query: 131 YVIFTSEFLMLANEVIIE-------AHGACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
            V        +    + E               ++  L L K     A  LT RE   LQ
Sbjct: 127 LVTMVRSGEPIDERELAEKGYQMSWLANMANYAMSMHL-LAKFVPEYAVELTARERETLQ 185

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +  G T  EI + + +   TV  +L +A  KL+A N+ +A  KA   G +
Sbjct: 186 WSAAGKTYAEIGKIMHVDDRTVKFHLVNAMRKLNATNKTEAAVKAAMLGLL 236


>gi|260770016|ref|ZP_05878949.1| transcriptional activator protein vanR [Vibrio furnissii CIP
           102972]
 gi|260615354|gb|EEX40540.1| transcriptional activator protein vanR [Vibrio furnissii CIP
           102972]
          Length = 240

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 53/232 (22%), Positives = 84/232 (36%), Gaps = 13/232 (5%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           +  +S + L   L  + N I    F L+ ++        +       NY        +  
Sbjct: 12  QVITSYENLESTLAALNNIIDHEYF-LFGLSLQPTLTTSE--TIITDNYPASWRQQYDEA 68

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
              + D  + +  +  LPI W  I    V  +                G + P+     +
Sbjct: 69  GFMHVDPIVQYSMTNFLPIRWSQIP---VASNQAHEMFEEARINGLKEGFSIPIHGLRGE 125

Query: 129 NGYVIFTSEFL---MLANEVIIEAHGA---CYQVITDFLELFKKRSSAARNLTERETSCL 182
            G + F +       L  + I  +          I +     K  +     LT RE  CL
Sbjct: 126 FGMLSFATSDTRHYELNCDAIQTSQLIIPLLSHNIHNIARCHKDAAPRIE-LTARENQCL 184

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             A +G ++ EIA+ +  S  TV  ++ +A  KL A NR QAI KAI  GYI
Sbjct: 185 TWAAEGKSAWEIAKIIDTSERTVKFHIANACKKLGATNRYQAITKAILGGYI 236


>gi|300693708|ref|YP_003749681.1| transcriptional activator of quorum sensing autoinducer synthesis
           transcription regulator protein (luxr family) [Ralstonia
           solanacearum PSI07]
 gi|299075745|emb|CBJ35050.1| transcriptional activator of quorum sensing autoinducer synthesis
           transcription regulator protein (LuxR family) [Ralstonia
           solanacearum PSI07]
          Length = 238

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 40/236 (16%), Positives = 80/236 (33%), Gaps = 14/236 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            +  + ++S  ++   +        A  F           P  +  I  L+NY     + 
Sbjct: 10  DIFSEAATSTSDVFAHIEAAA---LALGFEHVAYGFRAPLPLSEPKIILLNNYPQAWRER 66

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                  + D  + H      P+IW     +                     G A     
Sbjct: 67  YLEAGYLHVDPSVAHACRSQAPVIWSDPLFQYTPA-----LWDEAQAQGLRVGWAQSSLD 121

Query: 125 GFHKNGYVIFTSEFLMLANEVIIE----AHGACYQVITDFLELFKKRSS--AARNLTERE 178
                G +  +     L    + +         +        L +   +  +  +LT RE
Sbjct: 122 SLGVGGMLSLSRSCEPLTARELADNTRRMQWLTHMAHLALSRLLRADLAGDSDDSLTGRE 181

Query: 179 TSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              ++   DG ++++IA+ L +S +TV+ ++ +A  KL AVN+  A+ +A   GY+
Sbjct: 182 VEVMKWTADGKSAQDIADILAISKNTVDFHVKNAVKKLQAVNKTAAVVRAAMLGYL 237


>gi|315182540|gb|ADT89453.1| Transcriptional activator protein vanR [Vibrio furnissii NCTC
           11218]
          Length = 240

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 53/232 (22%), Positives = 84/232 (36%), Gaps = 13/232 (5%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           +  +S + L   L  + N I    F L+ ++        +       NY        +  
Sbjct: 12  QVITSYENLETTLAALNNIIDHEYF-LFGLSLQPTLTTSE--TLITDNYPASWRQQYDEA 68

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
              + D  + +  +  LPI W  I    V  +                G + P+     +
Sbjct: 69  GFMHVDPIVQYSMTNFLPIRWSQIP---VASNQAHEMFEEARINGLKEGFSIPIHGLRGE 125

Query: 129 NGYVIFTSEFL---MLANEVIIEAHGA---CYQVITDFLELFKKRSSAARNLTERETSCL 182
            G + F +       L  + I  +          I +     K  +     LT RE  CL
Sbjct: 126 FGMLSFATSDTRHYELNCDAIQTSQLIIPLLSHNIHNIARCHKDAAPRIE-LTARENQCL 184

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             A +G ++ EIA+ +  S  TV  ++ +A  KL A NR QAI KAI  GYI
Sbjct: 185 TWAAEGKSAWEIAKIIDTSERTVKFHIANACKKLGATNRYQAITKAILGGYI 236


>gi|188584215|ref|YP_001927660.1| LuxR family transcriptional regulator [Methylobacterium populi
           BJ001]
 gi|179347713|gb|ACB83125.1| transcriptional regulator, LuxR family [Methylobacterium populi
           BJ001]
          Length = 243

 Score =  165 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 51/231 (22%), Positives = 81/231 (35%), Gaps = 6/231 (2%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYT---INSALDFPRRQQLICELHNYDLDSGD 63
           +  ++ S +++   L  I  R+ A          I       R Q+    L N   +   
Sbjct: 15  SLDRAHSREDI---LRAIMPRLNAMGIEYVISAMIPQKRLPARTQKNFVILENTSDEWNR 71

Query: 64  IPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVR 123
           +       Y D  +    S      W       + +   +  +          G   P+ 
Sbjct: 72  LYFSKGYMYFDPIVQATLSSTTGFRWSETDPAGLQDPKARQVMNEAVEFGLGDGFTVPLA 131

Query: 124 LGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
               + G + F    L ++             V+   L +    S     LT RE   LQ
Sbjct: 132 TLEEERGGLTFAGRQLDISPGQRGMLTLIASYVVGQTLLIDNGPSERRMGLTPRERESLQ 191

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              +G T  EI E +G+S H V+ +L SA VKL  V+R QA+A+  R G I
Sbjct: 192 WVAEGKTDWEIGELMGISRHGVDFHLRSARVKLGCVSRTQAVAEGFRRGLI 242


>gi|260461224|ref|ZP_05809472.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
 gi|319785401|ref|YP_004144877.1| Autoinducer-binding domain protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|259032761|gb|EEW34024.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
 gi|317171289|gb|ADV14827.1| Autoinducer-binding domain protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 248

 Score =  165 bits (418), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 50/228 (21%), Positives = 79/228 (34%), Gaps = 13/228 (5%)

Query: 15  QELSPRLHLIQNRIKARNFALYTINSALDFPR------RQQLICELHNYDLDSGDIPNIL 68
           ++L   L        A NF    I      P        +     + NY  +  +    +
Sbjct: 24  EQLFELLSAF-----ALNFDCPWIAYGPLAPEQRVLKPTRPDSAMMWNYPDEWQERYLKM 78

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +     G+ P  W  +        + +  +   G     +G+  P+      
Sbjct: 79  GYAKIDPLIKKGRKGVGPFRWSEVYTHESTTENERRVLDEAGTFGLKSGVTVPLHGPAGS 138

Query: 129 NGYVIFT-SEFLMLANEVIIEAHGACYQVITDFLELFKKRSSA-ARNLTERETSCLQLAG 186
              + F  S    L N  I     A  Q      +L  +RSS  A  +++RE  C+    
Sbjct: 139 FKLMCFAKSADCELENRAITYLQIAAVQFHLRVAKLGTQRSSEHAYKISDRERECIHWIS 198

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            G TS EI   LG S +TV+ ++ +   KLD   R    AKA+  G I
Sbjct: 199 KGKTSGEIGTILGRSQNTVDFHVKNVMRKLDTTRRTALAAKAVELGII 246


>gi|254473001|ref|ZP_05086399.1| transcriptional regulator, LuxR family [Pseudovibrio sp. JE062]
 gi|211957722|gb|EEA92924.1| transcriptional regulator, LuxR family [Pseudovibrio sp. JE062]
          Length = 239

 Score =  165 bits (417), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 48/214 (22%), Positives = 78/214 (36%), Gaps = 1/214 (0%)

Query: 22  HLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFN 81
             I    ++  F  + + +  +          L  +  +             D  +    
Sbjct: 25  KRIAELGQSFGFTSFCLAAIPEAGASFDGSIMLSGWRPEWQQRYLDRDYVQNDPIVAKAR 84

Query: 82  SGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLML 141
           +   P +W S+  +  + ++ Q  +        + G+  PV       G +IF    + L
Sbjct: 85  TASRPFLWSSVARDRNLTAAAQQVLSEARDYGMYDGVCVPVHGLQGYQGMLIFGGPEVRL 144

Query: 142 ANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGL 200
               I   H           EL     +     LT RE  CL+ +  G TS EI++ L +
Sbjct: 145 NEREISVLHLVGIYASNKVRELVGANTNRPRHRLTPRELECLKWSAAGKTSWEISQILNI 204

Query: 201 SVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           S HT + YL SA  KL A NR  A+A+  R G I
Sbjct: 205 SQHTADWYLASAARKLHAANRTHAVAEGFRLGLI 238


>gi|149913176|ref|ZP_01901710.1| autoinducer-binding transcriptional regulator LuxR [Roseobacter sp.
           AzwK-3b]
 gi|149813582|gb|EDM73408.1| autoinducer-binding transcriptional regulator LuxR [Roseobacter sp.
           AzwK-3b]
          Length = 242

 Score =  164 bits (416), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 41/230 (17%), Positives = 83/230 (36%), Gaps = 15/230 (6%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           +S + +L   +  +++ I   +   + ++S  +             Y      +      
Sbjct: 19  ASDIDDLQRLIERLRDEIGVDHVVYHWVSSGGEQ-------YGCGTYPAAWVQLYVAKDY 71

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
              D  +        P+ W+ +   +    +           +   G + P+R    +  
Sbjct: 72  LRIDPVVQGCYQTFHPVDWKRLDWSSRAARA--FLSDAVAHGIGNQGYSVPLRGPNGQFA 129

Query: 131 YVIFTSEFLMLANEVIIEAH-----GACYQVITDFLELFKKRSS-AARNLTERETSCLQL 184
               +      A  +  + H        +      L L   R    A+ L+ RE   + L
Sbjct: 130 LFSVSHHCTDEAWAMFTDTHRRTLILIAHYFNHKALLLEPGRCPLTAQPLSPREVDVITL 189

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              GY+  ++AE L +S HT+  Y+ SA +KL A+N + A+++AI  G I
Sbjct: 190 LAMGYSRAQVAETLMISEHTLRTYVESARLKLGAINTLHAVSRAITRGLI 239


>gi|170697219|ref|ZP_02888313.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           IOP40-10]
 gi|170137839|gb|EDT06073.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           IOP40-10]
          Length = 237

 Score =  164 bits (416), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 44/231 (19%), Positives = 74/231 (32%), Gaps = 16/231 (6%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           + S  ++          ++A  F   +    +  P  +       NY     D       
Sbjct: 15  AKSEADVF---LEFTADVRALGFEYCSFGLRIPLPVSKPQFMLQSNYPQTWVDRYVSQNY 71

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
              D  + H  S + P+IW++  +   +E                 G   P        G
Sbjct: 72  FAVDPTVRHGLSQMSPLIWRADSQTQSVE-----FWDEAEHHGLRHGWCMPSISRTGAIG 126

Query: 131 YVIFTSEFLMLANEVIIE-------AHGACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
            V        +    + E               ++  L L +     A  LT RE   LQ
Sbjct: 127 LVTMVRSGEPIDERELAEKGYQMSWLANMANYAMSMHL-LARFVPEYAVELTARERETLQ 185

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +  G T  EI + + +   TV  +L +A  KL+A N+ +A  KA   G +
Sbjct: 186 WSAAGKTYAEIGKIMHVDDRTVKFHLVNAMRKLNATNKTEAAVKAAMLGLL 236


>gi|184156458|ref|YP_001844797.1| DNA-binding HTH domain-containing protein [Acinetobacter baumannii
           ACICU]
 gi|183208052|gb|ACC55450.1| DNA-binding HTH domain-containing protein [Acinetobacter baumannii
           ACICU]
          Length = 238

 Score =  164 bits (416), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 47/224 (20%), Positives = 76/224 (33%), Gaps = 12/224 (5%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDF 76
           L   +  I +R+    F              +     L+NY                D  
Sbjct: 21  LFDIVKSIASRL---GFDYCAYGMQSPLSIAEPKTIMLNNYPEAWQKRYVEQQYVKIDPT 77

Query: 77  LFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTS 136
           + H    L P++W S   +T  E                 G A   R      G +    
Sbjct: 78  VQHCMVSLQPLVWSSQSAKTQAEKD---FWEEARSYGLNVGWAQSSRDFIGTRGMLTLAR 134

Query: 137 EFLMLANEVIIE----AHGACYQVITDFLELFKKRSSAARNL--TERETSCLQLAGDGYT 190
               L+ +         +     V +   ++      A  NL  T RE   L+   +G T
Sbjct: 135 SNDQLSEKEQKAQYTNMYWLTQTVHSSIAKIVNDVEFAKFNLYLTNREKEALRWTAEGKT 194

Query: 191 SEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           S EIA+ LG++  TVN +L ++  KL+  N+I A  +A+  G +
Sbjct: 195 SAEIAQILGVTERTVNFHLSNSMQKLNVNNKISAAIRAVMLGLL 238


>gi|156933489|ref|YP_001437405.1| DNA-binding transcriptional activator SdiA [Cronobacter sakazakii
           ATCC BAA-894]
 gi|156531743|gb|ABU76569.1| hypothetical protein ESA_01307 [Cronobacter sakazakii ATCC BAA-894]
          Length = 241

 Score =  164 bits (416), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 40/245 (16%), Positives = 77/245 (31%), Gaps = 19/245 (7%)

Query: 2   SENTLTGKKSSSL-------QELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICEL 54
           S+     ++ ++         ++   L      ++   +  + +      P  +  +   
Sbjct: 4   SDFFNWRREMTTRFQEIQDSSDIYSLLKTETQNME---YDYFALCVRHPVPFTRPKLTLH 60

Query: 55  HNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLP 114
             Y     +          D  L   N  + P+ W         E               
Sbjct: 61  TTYPEAWLEHYQAENYYVIDPVLKPANYLVGPLSWNDALFAGAAEE----LWNAARDHGL 116

Query: 115 FAGIAFPVRLGFHKNGYVIFTSE----FLMLANEVIIEAHGACYQVITDFLELFKKRSSA 170
             G+   V       G++  +        M  +E+ +       Q +   + L    ++ 
Sbjct: 117 VKGVTQCVIAPNRAQGFLSVSGTSPRGHSMADDELALRLQHLVEQSLVTMMRLEDPAATV 176

Query: 171 AR-NLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAI 229
               L++RE   LQ   +G TS EIA  L +S +TVN +  +   K +A N+ Q    A 
Sbjct: 177 LEMKLSKREKEILQWTAEGKTSAEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAA 236

Query: 230 RFGYI 234
             G I
Sbjct: 237 AIGLI 241


>gi|254477011|ref|ZP_05090397.1| autoinducer-binding transcriptional regulator LuxR [Ruegeria sp.
           R11]
 gi|214031254|gb|EEB72089.1| autoinducer-binding transcriptional regulator LuxR [Ruegeria sp.
           R11]
          Length = 239

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 43/231 (18%), Positives = 80/231 (34%), Gaps = 15/231 (6%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
            +S++  L   +  +       +   + ++SA D             Y  +         
Sbjct: 16  AASTVDGLREIVERVCESFGVDHAMYHWVDSAGDH-------YYFGTYKDEWVARYQEKS 68

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
               D  +        P+ W+ +   +      +         +   G + P+R    + 
Sbjct: 69  YVRVDPVIIGCYQRFHPVDWRRLDWSSKPAR--EFMQDARDHDVGNQGYSIPIRGPKGQF 126

Query: 130 GYVIFTSEFLMLANEVIIEAH-----GACYQVITDFLELFKKRSS-AARNLTERETSCLQ 183
                ++       +  IE H        + +    LE    R     + L+ RE   L 
Sbjct: 127 ALFTVSNNCDDATWDNFIERHSRDLILMGHYLNRKVLEFEPDRGPGQVQPLSPREIDALT 186

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           L   GY+  ++A+ L +S HT+  Y+ SA  KL A+N   AIA+A+  G I
Sbjct: 187 LLAMGYSRAQVAQTLSISEHTLRVYIESARFKLGAINTTHAIARALSLGLI 237


>gi|17548999|ref|NP_522339.1| transcriptional activator of quorum sensing autoinducer synthesis
           transcription regulator protein [Ralstonia solanacearum
           GMI1000]
          Length = 248

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 41/229 (17%), Positives = 77/229 (33%), Gaps = 14/229 (6%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S  ++   +        A  F           P  +  +  L+NY              
Sbjct: 27  ASTSDVFEHIEAAA---LALGFEHVAYGFKAPLPLSEPKVVLLNNYPQAWRARYLEAGYL 83

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
           + D  +        PI+W     + V                   G A          G 
Sbjct: 84  HVDPSVAQACRSQAPIVWSDRLFQDVPA-----LWDEAKAHGLRVGWAQSSLDSLGVGGM 138

Query: 132 VIFTSEFLMLANEVIIE----AHGACYQVITDFLELFKKRSS--AARNLTERETSCLQLA 185
           +  +     L+   + E         +        L +   +  +  NLT RE   ++  
Sbjct: 139 LSLSRSCEPLSARELAENTRRMQWLAHMAHVALSRLLRADVAGYSDDNLTNREVEVMKWT 198

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            DG ++++IA+ L +S +TV+ ++ +A  KL AVN+  A+ +A   GY+
Sbjct: 199 ADGKSAQDIADILAISKNTVDFHVKNAVKKLHAVNKTAAVVRAAMLGYL 247


>gi|171315924|ref|ZP_02905153.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           MEX-5]
 gi|171098927|gb|EDT43717.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           MEX-5]
          Length = 228

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 39/234 (16%), Positives = 76/234 (32%), Gaps = 15/234 (6%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
           T  ++ S  ++   +      +    F +    +    P  +      + Y         
Sbjct: 3   TLSRALSFDDVFEIVAAQARALD---FEMCAYGARDPLPVTRPTFRTRNTYPDSWQQRYV 59

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                  D  + +      P++W       V   +               G + P+R   
Sbjct: 60  EGNYFARDPVVRYGLIYTSPLVW------PVDACADAPFWEEAKAHGVAHGWSQPIRDKH 113

Query: 127 HKNGYVIFTSEFLMLANEVII----EAHGACYQVITDFLELFKKRSSAAR--NLTERETS 180
            +            +++  +           +        L    ++A +    T RE  
Sbjct: 114 GRIAMWSVARSADPISDLELAATEGRLIYLAHAAHAVNSRLADAPAAAMQMGPFTTREKE 173

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            L+ A DG T+ EIA  L +S  T+  ++ +   KL++VN+ QAI KA+  G I
Sbjct: 174 VLKWAADGKTALEIASILSISERTITFHMQNIMEKLNSVNKTQAIVKAVLLGII 227


>gi|260431508|ref|ZP_05785479.1| autoinducer-binding transcriptional regulator LuxR [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260415336|gb|EEX08595.1| autoinducer-binding transcriptional regulator LuxR [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 239

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 48/240 (20%), Positives = 82/240 (34%), Gaps = 15/240 (6%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLD 60
           +S+     + SS+L EL      ++N +K  N   + ++ A D             Y   
Sbjct: 7   LSQVLEDLENSSTLDELGAVAERLRNALKIDNIVYHWVDGAGDQ-------YGCTTYSDS 59

Query: 61  SGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAF 120
                        D  +        P+ W+S+                    +   G + 
Sbjct: 60  WAQRYRERNYHRIDPVILGCFQRFHPVDWKSLDWSGKA--VRAFLQDALEHGVGNQGFSI 117

Query: 121 PVRLGFHKNGYVIFTSEFLMLANEVII-----EAHGACYQVITDFLELFK-KRSSAARNL 174
           P+R    +               +  I     +     +      LE  + +R  + R L
Sbjct: 118 PIRGPNGQFALFTANHSCSDAEWQNFIAKYGRDLILIAHYFNRKALEFEQNRRPDSPRAL 177

Query: 175 TERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           + RE   + L   GY+  ++A  L +S HT+  Y+ SA  KL A+N   AIA A+  G I
Sbjct: 178 SPREIDAMTLLALGYSRAQVAHSLSISEHTLRVYIESARAKLGALNTTHAIATALSRGLI 237


>gi|114764851|ref|ZP_01444033.1| autoinducer-binding transcriptional regulator LuxR [Pelagibaca
           bermudensis HTCC2601]
 gi|114542737|gb|EAU45760.1| autoinducer-binding transcriptional regulator LuxR [Roseovarius sp.
           HTCC2601]
          Length = 223

 Score =  163 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 41/230 (17%), Positives = 76/230 (33%), Gaps = 15/230 (6%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
              L++L      +++ +   +   + I +                Y  D          
Sbjct: 1   MQRLEDLQHITEQMRDCLGVDHLVYHWIGAQGAQ-------YGCGTYTPDWLARYVAQGY 53

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
              D  +        P+ W+++   +    +           L   G   P+R    +  
Sbjct: 54  LRVDPVIQGCFQRFHPVDWKALDWSSKAARA--FLKDALRHGLGNQGFTVPIRGPNGQFA 111

Query: 131 YVIFTSEFLMLAN-----EVIIEAHGACYQVITDFLELFKKRSSAAR-NLTERETSCLQL 184
                             +   E   A + +    LEL    +S A   L+ RE   ++L
Sbjct: 112 LFTVNHGCEDALWSSFIAQWRAELILAAHGINAKALELMPGPASQAPVALSPRELDAMRL 171

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              G +  ++A +L +S HTV  Y+  A  KL A+N   A+A+A+  G I
Sbjct: 172 LASGLSRAQVAAELNISEHTVRVYIEGARFKLGALNTTHAVARAMSCGLI 221


>gi|260598411|ref|YP_003210982.1| DNA-binding transcriptional activator SdiA [Cronobacter turicensis
           z3032]
 gi|260217588|emb|CBA31841.1| Regulatory protein sdiA [Cronobacter turicensis z3032]
          Length = 241

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 40/245 (16%), Positives = 77/245 (31%), Gaps = 19/245 (7%)

Query: 2   SENTLTGKKSSSL-------QELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICEL 54
           S+     ++ ++         ++   L      ++   +  + +      P  +  +   
Sbjct: 4   SDFFNWRREMTTRFQEIQDSGDIYSLLKTETQNME---YDYFALCVRHPVPFTRPKLTLH 60

Query: 55  HNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLP 114
             Y     +          D  L   N  + P+ W         E               
Sbjct: 61  TTYPEAWLEHYQAENYFVIDPVLKPANYLIGPLSWNDALFAGAAEE----LWNAARDHGL 116

Query: 115 FAGIAFPVRLGFHKNGYVIFTSE----FLMLANEVIIEAHGACYQVITDFLELFKKRSSA 170
             G+   V       G++  +        M  +E+ +       Q +   + L    ++ 
Sbjct: 117 VKGVTQCVIAPNRAQGFLSVSGTSPRGHSMPDDELALRLQHLVEQSLVAMMRLEDPAATV 176

Query: 171 AR-NLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAI 229
               L++RE   LQ   +G TS EIA  L +S +TVN +  +   K +A N+ Q    A 
Sbjct: 177 LEMKLSKREKEILQWTAEGKTSAEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAA 236

Query: 230 RFGYI 234
             G I
Sbjct: 237 AIGLI 241


>gi|311105770|ref|YP_003978623.1| LuxR family transcriptional regulator [Achromobacter xylosoxidans
           A8]
 gi|310760459|gb|ADP15908.1| bacterial regulatory protein, LuxR family protein 7 [Achromobacter
           xylosoxidans A8]
          Length = 237

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 43/238 (18%), Positives = 83/238 (34%), Gaps = 14/238 (5%)

Query: 3   ENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSG 62
           +  LT   ++S Q +  ++  +   +    F+          P        + +Y +   
Sbjct: 7   DLLLTTNSATSEQAVFTKVAAVAQEL---GFSYCAYGLRAALPFTNPQFVMISDYPIAWQ 63

Query: 63  DIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPV 122
           +          D  + H +   +PI+W         E            +    G +   
Sbjct: 64  ERYAQARYLEIDPTVKHCSRSSIPIVWSDRVFAETPE-----LWDEAQAVGLCVGWSQSN 118

Query: 123 RLGFHKNGYVIFTSEFLMLANEVII----EAHGACYQVITDFLELFKKR--SSAARNLTE 176
              +   G +    +   L++  ++                F ++   R   +    LT 
Sbjct: 119 LDAYGTGGMLTLARQKEQLSDAELLSKELRMRWLVTAAHLAFSKVLLPRFKLAPNVPLTR 178

Query: 177 RETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           RET  L+ A DG TS +++E L ++  TV  +  +A  KL A NR  A+A+A   G +
Sbjct: 179 RETEILKWAADGKTSSDVSEILAIAESTVRFHTKNAISKLGARNRTAAVARAALLGLL 236


>gi|59940143|gb|AAX12610.1| LuxR-type transcriptional regulator [Aeromonas veronii bv. sobria]
          Length = 260

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 52/231 (22%), Positives = 89/231 (38%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ + +    LI        +  Y     L    ++  +   +                
Sbjct: 14  TSVTDGNRLAELIGRFTLGMGYDYYRFALILPMSMQRPKVVLFNQCPDSWVQAYTENNML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEE-TVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E  + ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPVIRLARKQTLPIYWNRLDERASFLQEGTMDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       +      S+    LTERET CL 
Sbjct: 134 ILSFITSER-ASSDLLLESSPILSWMSNYIFEAAIRVVRFSMMDSAGKDPLTERETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSTGLL 243


>gi|170697389|ref|ZP_02888481.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           IOP40-10]
 gi|170137720|gb|EDT05956.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           IOP40-10]
          Length = 228

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 39/234 (16%), Positives = 77/234 (32%), Gaps = 15/234 (6%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
           T  ++ S  ++   +      +    F +    +    P  +      + Y         
Sbjct: 3   TLSRALSFDDVFEIVAAQARALD---FEMCAYGARDPLPVTRPTFRTRNTYPESWQQRYL 59

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                  D  + +      P++W       V   + +             G + P+R   
Sbjct: 60  EGNYFARDPVVRYGLIYTSPLVW------PVDACADEPFWEEAKAHGVAHGWSQPIRDKH 113

Query: 127 HKNGYVIFTSEFLMLANEVII----EAHGACYQVITDFLELFKKRSSAAR--NLTERETS 180
            +            +++  +           +        L    ++A +    T RE  
Sbjct: 114 GRIAMWSVARSADPISDLELAATESRLIYLAHAAHAVNSRLVDAPAAAMQMGPFTTREKE 173

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            L+ A DG T+ EIA  L +S  T+  ++ +   KL++VN+ QAI KA+  G I
Sbjct: 174 VLKWAADGKTALEIASILSISERTITFHMQNIMEKLNSVNKTQAIVKAVLLGII 227


>gi|95108205|emb|CAD17929.2| probable transcriptional activator of quorum sensing autoinducer
           synthesis transcription regulator protein [Ralstonia
           solanacearum GMI1000]
          Length = 238

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 41/229 (17%), Positives = 77/229 (33%), Gaps = 14/229 (6%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S  ++   +        A  F           P  +  +  L+NY              
Sbjct: 17  ASTSDVFEHIEAAA---LALGFEHVAYGFKAPLPLSEPKVVLLNNYPQAWRARYLEAGYL 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
           + D  +        PI+W     + V                   G A          G 
Sbjct: 74  HVDPSVAQACRSQAPIVWSDRLFQDVPA-----LWDEAKAHGLRVGWAQSSLDSLGVGGM 128

Query: 132 VIFTSEFLMLANEVIIE----AHGACYQVITDFLELFKKRSS--AARNLTERETSCLQLA 185
           +  +     L+   + E         +        L +   +  +  NLT RE   ++  
Sbjct: 129 LSLSRSCEPLSARELAENTRRMQWLAHMAHVALSRLLRADVAGYSDDNLTNREVEVMKWT 188

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            DG ++++IA+ L +S +TV+ ++ +A  KL AVN+  A+ +A   GY+
Sbjct: 189 ADGKSAQDIADILAISKNTVDFHVKNAVKKLHAVNKTAAVVRAAMLGYL 237


>gi|59940069|gb|AAX12573.1| LuxR-type transcriptional regulator [Aeromonas veronii]
          Length = 260

 Score =  162 bits (411), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 51/231 (22%), Positives = 89/231 (38%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ + +    LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGNRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTENNML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEE-TVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E  + ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPVIRLARKQTLPIYWNRLDERASFLQEGTMDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       +      S+    LTERET CL 
Sbjct: 134 ILSFITSER-ASSDLLLESSPILSWMSNYIFEAAIRVVRFSMMDSAGKDPLTERETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSTGLL 243


>gi|299069138|emb|CBJ40391.1| transcriptional activator of quorum sensing autoinducer synthesis
           transcription regulator protein (LuxR family) [Ralstonia
           solanacearum CMR15]
          Length = 238

 Score =  162 bits (411), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 40/228 (17%), Positives = 75/228 (32%), Gaps = 14/228 (6%)

Query: 13  SLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETY 72
           S  ++   +        A  F           P  +  +  L+NY              +
Sbjct: 18  STSDVFEHIEAAA---LALGFEHVAYGFKAPLPLSEPKVVLLNNYPQAWRVRYLEAGYLH 74

Query: 73  GDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYV 132
            D  +        PI+W     + V                   G A          G +
Sbjct: 75  VDPSVAQACRSQAPIVWSDRLFQDVPA-----LWDEAKAHGLRVGWAQSSLDSLGVGGML 129

Query: 133 IFTSEFLMLANEVIIE----AHGACYQVITDFLELFKKRSS--AARNLTERETSCLQLAG 186
             +     L+   + E         +        L +   +     +LT RE   ++   
Sbjct: 130 SLSRSCEPLSARELAENTRRMQWLAHMAHVALSRLLRADVAGYVDDSLTNREVEVMKWTA 189

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           DG ++++IA+ L +S +TV+ ++ +A  KL AVN+  A+ +A   GY+
Sbjct: 190 DGKSAQDIADILAISKNTVDFHVKNAVKKLQAVNKTAAVVRAAMLGYL 237


>gi|313110609|ref|ZP_07796491.1| putative transcriptional regulator [Pseudomonas aeruginosa 39016]
 gi|310882993|gb|EFQ41587.1| putative transcriptional regulator [Pseudomonas aeruginosa 39016]
          Length = 226

 Score =  162 bits (411), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 45/232 (19%), Positives = 75/232 (32%), Gaps = 14/232 (6%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
            + ++ +E    +  I        F  ++  +   FP        L NY  +        
Sbjct: 2   SRITTEEEFFSLVLEI---CGNYGFEFFSFGARAPFPLTAPKYHFLSNYPGEWKSRYISE 58

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
             T  D  + H      P+IW     +       +             G + PVR  +  
Sbjct: 59  DYTSIDPIVRHGLLEYTPLIWNGEDFQEN-----RFFWEEALHHGIRHGWSIPVRGKYGL 113

Query: 129 NGYVIFTSEFLMLANEVIIE----AHGACYQVITDFLELFKKRSSAAR--NLTERETSCL 182
              +        +A   I+E           +   F +L   R        LT RET  L
Sbjct: 114 ISMLSLVRSSESIAATEILEKESFLLWITSMLQATFGDLLAPRIVPESNVRLTARETEML 173

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +    G T  EI   L +   TV  ++ +A  KL++ N+ +A  KA   G +
Sbjct: 174 KWTAVGKTYGEIGLILSIDQRTVKFHIVNAMRKLNSSNKAEATMKAYAIGLL 225


>gi|330828294|ref|YP_004391246.1| LuxR-like protein [Aeromonas veronii B565]
 gi|328803430|gb|AEB48629.1| LuxR-like protein [Aeromonas veronii B565]
          Length = 268

 Score =  162 bits (410), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 52/231 (22%), Positives = 89/231 (38%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ + +    LI        +  Y     L    ++  +   +                
Sbjct: 22  TSVTDGNRLAELIGRFTLGMGYDYYRFALILPMSMQRPKVVLFNQCPDSWVQAYTENNML 81

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEE-TVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E  + ++      + L        GI+FP+     +NG
Sbjct: 82  ACDPVIRLARKQTLPIYWNRLDERASFLQEGTMDVMGLAAEFGLRNGISFPLHGAAGENG 141

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       +      S+    LTERET CL 
Sbjct: 142 ILSFITSER-ASSDLLLESSPILSWMSNYIFEAAIRVVRFSMMDSAGKDPLTERETECLF 200

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 201 WASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSTGLL 251


>gi|222149185|ref|YP_002550142.1| transcriptional regulator protein [Agrobacterium vitis S4]
 gi|221736170|gb|ACM37133.1| transcriptional regulator protein [Agrobacterium vitis S4]
          Length = 243

 Score =  162 bits (410), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 45/229 (19%), Positives = 79/229 (34%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
             K++ +++ L        +R   +N  L         P +Q     L ++  +   +  
Sbjct: 15  QIKQTDTVKNLVDLTKHATSRYGVKNIVLGFPPEIGMLPSQQMQGILLADWPDEWSHLYF 74

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                + D  + H  S     +W    +   I    +  +          G   P+    
Sbjct: 75  RDNLAFQDPAIRHIVSSEPSFVWSDFSKTLPISRDEKWLMDQAKEFFVSNGFTLPILSLD 134

Query: 127 HKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAG 186
            +   V F    +  + +           V    LEL+         LT RE   +    
Sbjct: 135 GRRAGVTFAGSDIDDSPQARTGMALIASLVFARALELYGANQKQTTRLTPREREVIGWIA 194

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYIC 235
           +G T  EI+   G+S   V  ++G+  +KL AV+R  AIA+A R   IC
Sbjct: 195 NGKTDWEISVIFGVSEKAVTKHVGNIMMKLGAVSRSHAIAEAFRQKLIC 243


>gi|332875591|ref|ZP_08443403.1| putative autoinducer-binding transcriptional regulator BmaR5
           [Acinetobacter baumannii 6014059]
 gi|332736164|gb|EGJ67179.1| putative autoinducer-binding transcriptional regulator BmaR5
           [Acinetobacter baumannii 6014059]
          Length = 238

 Score =  162 bits (410), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 46/224 (20%), Positives = 75/224 (33%), Gaps = 12/224 (5%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDF 76
           L   +    +R+    F              +     L+NY                D  
Sbjct: 21  LFDIVKSTASRL---GFDYCAYGMQSPLSIAEPKTIMLNNYPEAWQKRYVEGQYVKIDPT 77

Query: 77  LFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTS 136
           + H    L P++W S   +T  E                 G A   R      G +    
Sbjct: 78  VQHCMVSLQPLVWSSQSAKTQAEKD---FWEEARSYGLNVGWAQSSRDFIGTRGMLTLAR 134

Query: 137 EFLMLANEVIIE----AHGACYQVITDFLELFKKRSSAARNL--TERETSCLQLAGDGYT 190
               L+ +         +     V +   ++      A  NL  T RE   L+   +G T
Sbjct: 135 SNDQLSEKEQKAQYTNMYWLTQTVHSSIAKIVNDVEFAKFNLYLTNREKEALRWTAEGKT 194

Query: 191 SEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           S EIA+ LG++  TVN +L ++  KL+  N+I A  +A+  G +
Sbjct: 195 SAEIAQILGVTERTVNFHLSNSMQKLNVNNKISAAIRAVMLGLL 238


>gi|169797684|ref|YP_001715477.1| autoinducer-binding transcriptional regulator [Acinetobacter
           baumannii AYE]
 gi|213155522|ref|YP_002317567.1| eR transcriptional regulator [Acinetobacter baumannii AB0057]
 gi|215485038|ref|YP_002327279.1| Transcriptional activator protein phzR [Acinetobacter baumannii
           AB307-0294]
 gi|239503083|ref|ZP_04662393.1| Transcriptional activator protein phzR [Acinetobacter baumannii
           AB900]
 gi|301348492|ref|ZP_07229233.1| Transcriptional activator protein phzR [Acinetobacter baumannii
           AB056]
 gi|301513441|ref|ZP_07238678.1| Transcriptional activator protein phzR [Acinetobacter baumannii
           AB058]
 gi|301597204|ref|ZP_07242212.1| Transcriptional activator protein phzR [Acinetobacter baumannii
           AB059]
 gi|332853574|ref|ZP_08434826.1| putative autoinducer-binding transcriptional regulator BmaR5
           [Acinetobacter baumannii 6013150]
 gi|332869309|ref|ZP_08438707.1| putative autoinducer-binding transcriptional regulator BmaR5
           [Acinetobacter baumannii 6013113]
 gi|169150611|emb|CAM88520.1| putative Autoinducer-binding transcriptional regulator (LuxR
           family) [Acinetobacter baumannii AYE]
 gi|193076010|gb|ABO10598.2| eR transcriptional regulator [Acinetobacter baumannii ATCC 17978]
 gi|213054682|gb|ACJ39584.1| eR transcriptional regulator [Acinetobacter baumannii AB0057]
 gi|213987791|gb|ACJ58090.1| Transcriptional activator protein phzR [Acinetobacter baumannii
           AB307-0294]
 gi|323516195|gb|ADX90576.1| autoinducer-binding transcriptional regulator [Acinetobacter
           baumannii TCDC-AB0715]
 gi|332728538|gb|EGJ59911.1| putative autoinducer-binding transcriptional regulator BmaR5
           [Acinetobacter baumannii 6013150]
 gi|332732817|gb|EGJ64032.1| putative autoinducer-binding transcriptional regulator BmaR5
           [Acinetobacter baumannii 6013113]
          Length = 238

 Score =  162 bits (410), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 44/210 (20%), Positives = 70/210 (33%), Gaps = 9/210 (4%)

Query: 31  RNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQ 90
             F              +     L+NY                D  + H    L P++W 
Sbjct: 32  LGFDYCAYGMQSPLSIAEPKTIMLNNYPEAWQKRYVERQYVKIDPTVQHCMVSLQPLVWS 91

Query: 91  SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIE-- 148
           S   +T  E                 G A   R      G +        L+ +      
Sbjct: 92  SQSAKTQAEKD---FWEEARSYGLNVGWAQSSRDFIGTRGMLTLARSNDQLSEKEQKAQY 148

Query: 149 --AHGACYQVITDFLELFKKRSSAARNL--TERETSCLQLAGDGYTSEEIAEKLGLSVHT 204
              +     V +   ++      A  NL  T RE   L+   +G TS EIA+ LG++  T
Sbjct: 149 TNMYWLTQTVHSSIAKIVNDVEFAKFNLYLTNREKEALRWTAEGKTSAEIAQILGVTERT 208

Query: 205 VNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           VN +L ++  KL+  N+I A  +A+  G +
Sbjct: 209 VNFHLSNSMQKLNVNNKISAAIRAVMLGLL 238


>gi|254438192|ref|ZP_05051686.1| Autoinducer binding domain protein [Octadecabacter antarcticus 307]
 gi|198253638|gb|EDY77952.1| Autoinducer binding domain protein [Octadecabacter antarcticus 307]
          Length = 256

 Score =  161 bits (409), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 39/236 (16%), Positives = 82/236 (34%), Gaps = 15/236 (6%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            +T  +++ L  L   +  +++     +   + +++  +             Y L     
Sbjct: 9   LVTLDQATELSALQDTIVRLRDHYGVAHMVYHWVSADGEQ-------YGCGTYPLSWVQH 61

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  +        P+ W+++   +    +           +   G + P+R 
Sbjct: 62  YVQKDYLRIDPVIIGCFKQFHPVDWKALDWSSKAAVA--FRAEAMQAGVGNQGYSIPIRG 119

Query: 125 GFHKNGYVIFTSEFLMLANEV-----IIEAHGACYQVITDFLELFKKRSS-AARNLTERE 178
              +      ++                +     +      LE+  KR     + L+ RE
Sbjct: 120 PSGQFALFSLSNNTDDTDWAAFTESNRRDLILCAHSFNQKALEVETKRMPDPVKPLSGRE 179

Query: 179 TSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              L     GY+  ++A+ L +S HT+ AY+ SA  KL A N + A+A+A+  G I
Sbjct: 180 IDVLTYLAMGYSRSQVAQTLTISEHTLRAYVESARFKLGASNTMHAVARAVSEGLI 235


>gi|260557627|ref|ZP_05829841.1| transcriptional activator protein phzR [Acinetobacter baumannii
           ATCC 19606]
 gi|260408800|gb|EEX02104.1| transcriptional activator protein phzR [Acinetobacter baumannii
           ATCC 19606]
          Length = 238

 Score =  161 bits (409), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 44/210 (20%), Positives = 71/210 (33%), Gaps = 9/210 (4%)

Query: 31  RNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQ 90
             F              +     L+NY                D  + H  + L P++W 
Sbjct: 32  LGFDYCAYGMQSPLSIAEPKTIMLNNYPEAWQKRYVERQYVKIDPTVQHCMASLQPLVWS 91

Query: 91  SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIE-- 148
           S   +T  E                 G A   R      G +        L+ +      
Sbjct: 92  SQSAKTQAEKD---FWEEARSYGLNVGWAQSSRDFIGTRGMLTLARSNDQLSEKEQKAQY 148

Query: 149 --AHGACYQVITDFLELFKKRSSAARNL--TERETSCLQLAGDGYTSEEIAEKLGLSVHT 204
              +     V +   ++      A  NL  T RE   L+   +G TS EIA+ LG++  T
Sbjct: 149 TNMYWLTQTVHSSIAKIVNDVEFAKFNLYLTNREKEALRWTAEGKTSAEIAQILGVTERT 208

Query: 205 VNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           VN +L ++  KL+  N+I A  +A+  G +
Sbjct: 209 VNFHLSNSMQKLNVNNKISAAIRAVMLGLL 238


>gi|115360781|ref|YP_777918.1| LuxR family transcriptional regulator [Burkholderia ambifaria AMMD]
 gi|172065092|ref|YP_001815804.1| LuxR family transcriptional regulator [Burkholderia ambifaria
           MC40-6]
 gi|115286109|gb|ABI91584.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           AMMD]
 gi|171997334|gb|ACB68251.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           MC40-6]
          Length = 228

 Score =  161 bits (408), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 39/234 (16%), Positives = 77/234 (32%), Gaps = 15/234 (6%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
           T  ++ S  ++   +      +    F +    +    P  +      + Y         
Sbjct: 3   TLSRALSFDDVFEIVAAQARALD---FEMCAYGARDPLPVTRPTFRTRNTYPESWQQRYI 59

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                  D  + +      P++W       V   + +             G + P+R   
Sbjct: 60  EGNYFARDPVVRYGLIYTSPLVW------PVDACADESFWEEAKAHGVAHGWSQPIRDKH 113

Query: 127 HKNGYVIFTSEFLMLANEVII----EAHGACYQVITDFLELFKKRSSAAR--NLTERETS 180
            +            +++  +           +        L    ++A +    T RE  
Sbjct: 114 GRIAMWSVARSADPISDLELAATESRLIYLAHAAHAVNSRLVDAPAAAMQMGPFTTREKE 173

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            L+ A DG T+ EIA  L +S  T+  ++ +   KL++VN+ QAI KA+  G I
Sbjct: 174 VLKWAADGKTALEIASILSISERTITFHMQNIMEKLNSVNKTQAIVKAVLLGII 227


>gi|15597095|ref|NP_250589.1| quorum-sensing control repressor [Pseudomonas aeruginosa PAO1]
 gi|116049852|ref|YP_791341.1| putative transcriptional regulator [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218892145|ref|YP_002441012.1| quorum-sensing control repressor [Pseudomonas aeruginosa LESB58]
 gi|254234991|ref|ZP_04928314.1| quorum-sensing control repressor [Pseudomonas aeruginosa C3719]
 gi|254240292|ref|ZP_04933614.1| quorum-sensing control repressor [Pseudomonas aeruginosa 2192]
 gi|6014709|gb|AAF01471.1|AF190630_1 PhzR [Pseudomonas aeruginosa PAO1]
 gi|9947891|gb|AAG05287.1|AE004616_1 quorum-sensing control repressor [Pseudomonas aeruginosa PAO1]
 gi|115585073|gb|ABJ11088.1| probable transcriptional regulator [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126166922|gb|EAZ52433.1| quorum-sensing control repressor [Pseudomonas aeruginosa C3719]
 gi|126193670|gb|EAZ57733.1| quorum-sensing control repressor [Pseudomonas aeruginosa 2192]
 gi|218772371|emb|CAW28153.1| quorum-sensing control repressor [Pseudomonas aeruginosa LESB58]
          Length = 237

 Score =  161 bits (408), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 45/232 (19%), Positives = 75/232 (32%), Gaps = 14/232 (6%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
            + ++ +E    +  I        F  ++  +   FP        L NY  +        
Sbjct: 13  SRITTEEEFFSLVLEI---CGNYGFEFFSFGARAPFPLTAPKYHFLSNYPGEWKSRYISE 69

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
             T  D  + H      P+IW     +       +             G + PVR  +  
Sbjct: 70  DYTSIDPIVRHGLLEYTPLIWNGEDFQEN-----RFFWEEALHHGIRHGWSIPVRGKYGL 124

Query: 129 NGYVIFTSEFLMLANEVIIE----AHGACYQVITDFLELFKKRSSAAR--NLTERETSCL 182
              +        +A   I+E           +   F +L   R        LT RET  L
Sbjct: 125 ISMLSLVRSSESIAATEILEKESFLLWITSMLQATFGDLLAPRIVPESNVRLTARETEML 184

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +    G T  EI   L +   TV  ++ +A  KL++ N+ +A  KA   G +
Sbjct: 185 KWTAVGKTYGEIGLILSIDQRTVKFHIVNAMRKLNSSNKAEATMKAYAIGLL 236


>gi|146312149|ref|YP_001177223.1| DNA-binding transcriptional activator SdiA [Enterobacter sp. 638]
 gi|145319025|gb|ABP61172.1| transcriptional activator SdiA [Enterobacter sp. 638]
          Length = 240

 Score =  161 bits (407), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 43/235 (18%), Positives = 80/235 (34%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  S  E+      +Q + +A  F  Y++      P  +  I    +Y  +    
Sbjct: 14  FLRFQEMGSADEVY---EELQRQTQALEFDYYSLCVRHPVPFTRPKISIHSSYPAEWISQ 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L          +   +     + +  Q             GI   + L
Sbjct: 71  YQSENYYAIDPVLKR-----ENFLQGHLPWTDALFADAQALWDGARDHGLRKGITQCLML 125

Query: 125 GFHKNGYVIFTSE----FLMLANEVIIEAHGACYQVITDFLELF-KKRSSAARNLTERET 179
             H  G++  +       +M ++E+ +         +T  L    +         ++RE 
Sbjct: 126 PNHALGFLSVSRTSQFGKMMDSDEIELRLQVLVQMALTTLLRFEHEMVMPPEMKFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K +A N+ Q    A   G+I
Sbjct: 186 EILKWTAEGKTSAEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGFI 240


>gi|46370360|gb|AAS89968.1| transcriptional regulator [Agrobacterium vitis]
          Length = 230

 Score =  161 bits (407), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 56/220 (25%), Positives = 87/220 (39%), Gaps = 3/220 (1%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++   +  + +   A+ F +  + SA            + N+  D     ++        
Sbjct: 12  DVFRLMKRLTDFFGAKGFMVMNVPSAGAKTLTGS--SVITNWPADFLSEYDMASLLSSSP 69

Query: 76  FLFHFNSGLLPIIWQ-SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
                 +  +P+++   +        + +L+  L        G  FPV       G V  
Sbjct: 70  MFNRLRNTSIPVVFDIHVVARERDPKTVELATDLFLRFGMPRGACFPVHDAHGNRGAVNI 129

Query: 135 TSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEI 194
             E    +   ++  H     V     E+ +  +     LTERE  CL     G TS EI
Sbjct: 130 CGEMPAFSFVDMVLLHYLAGHVFNRLAEIRELDARVTETLTEREIECLTWTAAGKTSVEI 189

Query: 195 AEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           AE +GLS HT+N YL  AT KLD VNR QA+AKA+R   I
Sbjct: 190 AEIMGLSEHTINHYLNRATRKLDTVNRTQAVAKALRLSLI 229


>gi|262196287|ref|YP_003267496.1| LuxR family transcriptional regulator [Haliangium ochraceum DSM
           14365]
 gi|262079634|gb|ACY15603.1| transcriptional regulator, LuxR family [Haliangium ochraceum DSM
           14365]
          Length = 254

 Score =  161 bits (407), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 50/228 (21%), Positives = 77/228 (33%), Gaps = 8/228 (3%)

Query: 15  QELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGD 74
           +     L           F      +             L+ Y     D        Y D
Sbjct: 25  EHAQSILQDTLATYGFDFFCFAIYGAPRGAIAIDNYHLLLNAYPNAWADRYYEKHYWYSD 84

Query: 75  DFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
             L H      PI W ++Q +    +S +  +R        +G+   VR    + G +  
Sbjct: 85  PVLAHCGRSPTPIDWTTVQNQPAQPASAEQVMREAHEHDLCSGVTVTVRDVSGRLGILSL 144

Query: 135 TSEF------LMLANEVIIEAHGACYQVITDFLELFKKRSSAARN--LTERETSCLQLAG 186
            +               I  A      ++      F  R    +   L+ERE  CL+   
Sbjct: 145 ATRDVYSAELRDRIRHAIPIAQFVLSHLVEKLEAHFHVRLEDLQRYKLSERERECLRWVA 204

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            G TS EI   LG++  T   +L +A  KL AVNR  A+A+A++ G I
Sbjct: 205 AGKTSWEIGHILGIAERTAIFHLNNAMKKLGAVNRSHAVARALQHGVI 252


>gi|260773944|ref|ZP_05882859.1| transcriptional activator protein luxR [Vibrio metschnikovii CIP
           69.14]
 gi|260610905|gb|EEX36109.1| transcriptional activator protein luxR [Vibrio metschnikovii CIP
           69.14]
          Length = 240

 Score =  161 bits (407), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 56/230 (24%), Positives = 82/230 (35%), Gaps = 13/230 (5%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
             S Q L P L  + + I+      +    +L             NY L      +    
Sbjct: 14  IDSFQALQPTLAKMNHLIEHE---YFLFGLSLQTTLTSNDTLIADNYPLAWRQQYDESQF 70

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
              D  + +  +  LPI W  I+         Q+            G + PV     + G
Sbjct: 71  MLIDPIVRYSMTNFLPIRWSEIRAHHQDS---QIIFEEARLNGLKEGFSIPVHGLRGEFG 127

Query: 131 YVIFTSEFLM------LANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQL 184
            + F +           A +          Q I + +   +     A  LT RE  CL  
Sbjct: 128 MLSFATSDTRHYDLNLPAIQASQLLVPLLAQNIDNIVRCHRDAKPRAE-LTCREGQCLSW 186

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           A +G ++ EIA+ +  S  TV  +L +A  KL A NR QAI KAI  GYI
Sbjct: 187 AAEGKSAWEIAQIINTSERTVKFHLSNACKKLGATNRYQAITKAILGGYI 236


>gi|86138963|ref|ZP_01057534.1| autoinducer-binding transcriptional regulator LuxR [Roseobacter sp.
           MED193]
 gi|85824194|gb|EAQ44398.1| autoinducer-binding transcriptional regulator LuxR [Roseobacter sp.
           MED193]
          Length = 255

 Score =  160 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 45/229 (19%), Positives = 78/229 (34%), Gaps = 17/229 (7%)

Query: 13  SLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETY 72
           +L+ L   +  I       +   + ++SA D             Y             T 
Sbjct: 35  TLEGLQSIIECICKVFAIDHAMYHWVDSAGDH-------YYFGTYSEAWTQQYQEKNYTR 87

Query: 73  GDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLP-FAGIAFPVRLGFHKNGY 131
            D  +        P+ W+ +   +      +              G + P+R    +   
Sbjct: 88  IDPVVIGCYQRFHPVDWRRLDWSSKP---AREFFDAAMEHGVGNQGYSIPIRGPNGQFAL 144

Query: 132 VIFTSEFLMLANEVIIE-----AHGACYQVITDFLELFKKRSS-AARNLTERETSCLQLA 185
              +      A +   +          +      LE    R+   A+ L+ RE   L L 
Sbjct: 145 FSVSHHCDDAAWDKFCDQNSRDLILIGHYFNRKALEFEPDRAPEQAQPLSPRELDALTLL 204

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           G GY+  ++A+ L +S HT+  Y+ SA  KL A+N   AIA+A+  G I
Sbjct: 205 GIGYSRAQVAQTLSISEHTLRVYIESARFKLGALNTTHAIARAVSCGLI 253


>gi|86356503|ref|YP_468395.1| LuxR family transcriptional regulator [Rhizobium etli CFN 42]
 gi|86280605|gb|ABC89668.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli CFN 42]
          Length = 248

 Score =  160 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 55/220 (25%), Positives = 83/220 (37%), Gaps = 3/220 (1%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++   L  +    ++R F +  +        +      + ++  +   + +         
Sbjct: 30  DIFRFLKRVTEAYRSRAFMVLNLPPTTSLDLQGS--TVITSWPAELLALYDQEALMVNSP 87

Query: 76  FLFHFNSGLLPIIWQSIQEE-TVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
            L    +   P  +   +E  +  +    L   L        G  FP        G V F
Sbjct: 88  VLRRLRTSTRPFFYDMTRETWSRDDGKSVLVTGLFERFRMMRGAYFPTHEASGLRGAVSF 147

Query: 135 TSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEI 194
             +    +   + E       V     E+    +    +LT+RE  CL     G TS EI
Sbjct: 148 AGDREPFSAAEMRELCYIAIHVFDRLAEIRNLDTRMTDSLTDREIDCLNWTAAGKTSAEI 207

Query: 195 AEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           AE L LS HTVN YL  AT KLD VNR QA+AKA+R G I
Sbjct: 208 AEILALSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGLI 247


>gi|166798330|gb|ABY89693.1| transcriptional regulator [Mesorhizobium loti]
          Length = 243

 Score =  160 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 55/230 (23%), Positives = 92/230 (40%), Gaps = 2/230 (0%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
             + +++   +  RL  I            T+        +Q+    L ++  +  +   
Sbjct: 13  QLQHAATAAAVCERLLGITADFGLTALMAGTVPQPGTPAGQQKQHVLLCDWPGEWLERYV 72

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                  D  + H      P  W+   +   I+ S    +   G      G+AFP+    
Sbjct: 73  ARNYVDHDPVVSHMKQLQAPFQWREASQSIRIDKSSGEVMGDAGAFKLRDGLAFPLVTLD 132

Query: 127 HKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARN--LTERETSCLQL 184
            +   V    E + L+     +        +   ++L    S +  +  LT RE  CLQ 
Sbjct: 133 GQIVMVSLGGEAVELSAAEFGQVSLVSTYAVGRAMQLHTMASKSIDHIVLTPRERECLQW 192

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           A  G +  EI++ LG+S HT   +L +A  KL AVNR+QA+A+AIR GYI
Sbjct: 193 AAVGKSEWEISQILGISEHTSEKHLLNAKSKLGAVNRVQAVAEAIRRGYI 242


>gi|254485722|ref|ZP_05098927.1| autoinducer-binding transcriptional regulator LuxR [Roseobacter sp.
           GAI101]
 gi|214042591|gb|EEB83229.1| autoinducer-binding transcriptional regulator LuxR [Roseobacter sp.
           GAI101]
          Length = 239

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 48/239 (20%), Positives = 87/239 (36%), Gaps = 29/239 (12%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           +K+ +L  L      ++  +   +   + ++SA D             Y  +        
Sbjct: 15  EKTDTLDGLQTATEALRTFLGVAHIVYHWVDSAGDQ-------YGCGTYSPEWRSRYLDQ 67

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESS------------GQLSVRLEGGLLPFA 116
                D  +        P+ W+ +   +    +               +V + G    FA
Sbjct: 68  NYLRVDPVVSGCFQRFHPVDWKRLDWSSKAARALLTEAIDHGVGNQGFTVPIRGPNGQFA 127

Query: 117 GIAFPVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSS-AARNLT 175
              F V      + +  FT        ++I+ AH    +     LE    R+   A+ L+
Sbjct: 128 --LFTVNDNCTDDAWQAFTQANR---RDLILIAHYFNQKA----LEFEPGRTPEVAQALS 178

Query: 176 ERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            RE   + L   GY   ++A+ L +S HT+  Y+ SA  KL A+N   A+A+A+  G I
Sbjct: 179 PREIDAMTLLAIGYNRAQVADSLSISEHTLRVYIESARFKLGAMNTTHAVARALSRGLI 237


>gi|163738954|ref|ZP_02146367.1| autoinducer-binding transcriptional regulator LuxR [Phaeobacter
           gallaeciensis BS107]
 gi|163741802|ref|ZP_02149192.1| autoinducer-binding transcriptional regulator LuxR [Phaeobacter
           gallaeciensis 2.10]
 gi|161384975|gb|EDQ09354.1| autoinducer-binding transcriptional regulator LuxR [Phaeobacter
           gallaeciensis 2.10]
 gi|161387759|gb|EDQ12115.1| autoinducer-binding transcriptional regulator LuxR [Phaeobacter
           gallaeciensis BS107]
          Length = 239

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 41/229 (17%), Positives = 76/229 (33%), Gaps = 15/229 (6%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+  L   +  + +     +   + ++SA D             Y     +        
Sbjct: 18  TSVDGLQEIIQRVCDTFDVDHAMYHWVDSAGDH-------YHFGTYSQGWVERYQEKAYV 70

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  +        P+ W+ +   +      +         +   G + P+R    +   
Sbjct: 71  RVDPVIIGCYQRFHPVDWRRLDWSSKPAR--EFLQDALAHDVGNQGYSIPIRGPNGQFAL 128

Query: 132 VIFTSEFLMLANEVI-----IEAHGACYQVITDFLELFKKRSSAA-RNLTERETSCLQLA 185
              +                 +     +      LE    RS    + L+ RE   L L 
Sbjct: 129 FTVSHNCDDDTWTRFTDKHSRDLILIGHYFNRKALEFEPDRSPEHVQPLSPREIDALTLL 188

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             GY+  ++A+ L +S HT+  Y+ SA  KL A+N   AIA+A+  G I
Sbjct: 189 AMGYSRAQVAKTLTISEHTLRVYIESARFKLGAINTTHAIARALSLGLI 237


>gi|12620586|gb|AAG60862.1|AF322012_167 ID375 [Bradyrhizobium japonicum]
          Length = 261

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 41/233 (17%), Positives = 81/233 (34%), Gaps = 11/233 (4%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELH-NYDLDSGDIPNIL 68
           ++ S+  L   L    +       A   ++ + +    + L      N+  D        
Sbjct: 32  QTRSIAALFDLLVNFASNEGFDKVAYGALSCSNERRLPEYLPPPPTINFPSDWCQRYAEQ 91

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +        P +W  +     ++      +R         G++ P+     +
Sbjct: 92  EYQAIDPVVRRTAMLPRPFLWDELTSRYELQPRELRVLREAKEAGLKHGMSVPLFGSQGR 151

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAAR-------NLTERETSC 181
           + +V F S F     +  +           + +    + +            LT RET C
Sbjct: 152 SAFVSFASPFDDADPQDRMAHLTTLASAFHNAVA---QITPPLDESCETDIPLTPRETEC 208

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           L    +G ++  I + + ++ +TVN ++ +   KL A NR  A+AKA R G I
Sbjct: 209 LYWVAEGKSAWVIGQLVNVTDNTVNFHMKNVIRKLGAANRTNAVAKATRRGII 261


>gi|222147695|ref|YP_002548652.1| transcriptional regulator LuxR family [Agrobacterium vitis S4]
 gi|221734683|gb|ACM35646.1| transcriptional regulator LuxR family [Agrobacterium vitis S4]
          Length = 230

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 55/220 (25%), Positives = 86/220 (39%), Gaps = 3/220 (1%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++   +  + +   A+ F +  + SA            + N+  D     ++        
Sbjct: 12  DVFRLMKRLTDFFGAKGFMVMNVPSAGAKTLTGS--SVITNWPADFLSEYDMASLLSSSP 69

Query: 76  FLFHFNSGLLPIIWQ-SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
                 +  +P+++   +        + +L+  L        G  FPV       G V  
Sbjct: 70  MFNRLRNTSIPVVFDVHVVARERDPKTVELATDLFLRFGMPRGACFPVHDAHGNRGAVNI 129

Query: 135 TSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEI 194
             E    +   ++        V     E+ +  +     LTERE  CL     G TS EI
Sbjct: 130 CGEMPAFSFVDMVLLQYLAGHVFNRLAEIRELDARVTETLTEREIECLTWTAAGKTSVEI 189

Query: 195 AEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           AE +GLS HT+N YL  AT KLD VNR QA+AKA+R   I
Sbjct: 190 AEIMGLSEHTINHYLNRATRKLDTVNRTQAVAKALRLSLI 229


>gi|260461917|ref|ZP_05810162.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
 gi|259032164|gb|EEW33430.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
          Length = 243

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 53/230 (23%), Positives = 91/230 (39%), Gaps = 2/230 (0%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
             + + +   +  +L  I +          T+        +Q+    L ++ ++  +   
Sbjct: 13  QLQHAGTAAAVCEKLLGITSDFGLTALMAGTVPQPGTPAGQQKQHVLLCDWPVEWLERYV 72

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                  D  + H      P  W+   ++  I+ S    +   G      G+AFP+    
Sbjct: 73  ARNYVDHDPVVSHMKQLQAPFQWREAAQDIRIDKSSGEVMGDAGAFKLRDGLAFPLITLD 132

Query: 127 HKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAAR--NLTERETSCLQL 184
            +   V    E + L+              +   ++L     +      LT RE  CLQ 
Sbjct: 133 GQIVMVSLGGEAVELSAAEFGLVSLVSTYAVGRAMQLHTMSGNTIDHVELTPRERECLQW 192

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           A  G +  EI++ LG+S HT   +L +A  KL AVNR+QA+A+AIR GYI
Sbjct: 193 AAVGKSEWEISQILGISEHTSEKHLLNAKSKLGAVNRVQAVAEAIRRGYI 242


>gi|325124101|gb|ADY83624.1| probable transcriptional activator of quorum sensing autoinducer
           synthesis transcription regulator protein [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 238

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 44/210 (20%), Positives = 72/210 (34%), Gaps = 9/210 (4%)

Query: 31  RNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQ 90
             F              +     L+NY                D  + H    L P++W 
Sbjct: 32  LGFDYCAYGMQSPLSIAEPKTIMLNNYPEAWQKRYMEQQYVKIDPTVQHCMVSLQPLVWS 91

Query: 91  SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIE-- 148
           S   +T      +             G A   R      G +        L+ +      
Sbjct: 92  SQFAKTQ---EEKDFWEEARSYGLNVGWAQSSRDFIGTRGMLTLARSNDQLSEKEQKAQY 148

Query: 149 --AHGACYQVITDFLELFKKRSSAARNL--TERETSCLQLAGDGYTSEEIAEKLGLSVHT 204
              +     V +   ++  +   A  NL  T RE   L+   +G TS EIA+ LG++  T
Sbjct: 149 TNMYWLSQTVHSSIAKVVNEVEFAQFNLYLTNREKEALRWTAEGKTSAEIAQILGVTERT 208

Query: 205 VNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           VN +LG++  KL+  N+I A  +A+  G +
Sbjct: 209 VNFHLGNSMQKLNVNNKISAAIRAVMLGLL 238


>gi|319785576|ref|YP_004145052.1| Autoinducer-binding domain protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317171464|gb|ADV15002.1| Autoinducer-binding domain protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 243

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 54/230 (23%), Positives = 91/230 (39%), Gaps = 2/230 (0%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
             + +++   +  RL  I +          T+        +Q+    L ++  +  +   
Sbjct: 13  QLQHAATAAAVCERLLGITSDFGLTALMAGTVPQPGTPAGQQKQHVLLCDWPGEWLERYV 72

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                  D  + H      P  W    +   I+ S    +   G      G+AFP+    
Sbjct: 73  ARNYVDHDPVVSHMKQLQAPFQWHEASQGIRIDKSSGEVMGDAGAFKLRDGLAFPLITLD 132

Query: 127 HKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARN--LTERETSCLQL 184
            +   V    E + L+     +        +   ++L    +    +  LT RE  CLQ 
Sbjct: 133 GQIVMVSLGGEAVELSAAEFGQVSLVSTYAVGRAMQLHTMANRTIDHIVLTPRERECLQW 192

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           A  G +  EI++ LG+S HT   +L +A  KL AVNR+QA+A+AIR GYI
Sbjct: 193 AAVGKSEWEISQILGISEHTSEKHLLNAKSKLGAVNRVQAVAEAIRRGYI 242


>gi|239820479|ref|YP_002947664.1| transcriptional regulator, LuxR family [Variovorax paradoxus S110]
 gi|239805332|gb|ACS22398.1| transcriptional regulator, LuxR family [Variovorax paradoxus S110]
          Length = 235

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 45/229 (19%), Positives = 70/229 (30%), Gaps = 9/229 (3%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
           +     E S  L  +    +   F           P  +        YD           
Sbjct: 11  RLDEASEPSQVLAQVSVAARQLGFEHCAYGLRTLVPFTRPKTLMFSTYDERWSRRYISAG 70

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
               D  + H      P+IW +       +                 G A  V     + 
Sbjct: 71  YLQVDPTVAHGVHSGTPVIWSNEVFRDAPQ-----MWDEARSFGLRVGWAQSVFEPDARV 125

Query: 130 GYVIFTSEFLMLANEVI----IEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLA 185
           G +        L    +    +   G   +    F  L     +    LT+R+   L+  
Sbjct: 126 GMLSLARSSEPLTAAEMRAKDLLFQGLVNKAHRAFCRLLGGPLAGIEPLTKRQVEVLRWT 185

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           GDG TS+EIA  L +S  TV+ +L +A  +L A  +  A A A R G +
Sbjct: 186 GDGKTSDEIAAILCISKPTVDFHLRNAMARLGASTKSSAAAFASRLGLL 234


>gi|240142370|ref|YP_002966880.1| LuxR type transcriptional regulator [Methylobacterium extorquens
           AM1]
 gi|240012314|gb|ACS43539.1| LuxR type transcriptional regulator [Methylobacterium extorquens
           AM1]
          Length = 242

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 36/220 (16%), Positives = 72/220 (32%), Gaps = 1/220 (0%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           +     H ++  +    F  + I    +   R   +  +        +        Y D 
Sbjct: 21  DHDQVAHSVERILAEFGFEHFVITGLPNPNDRLDQVLLIRRLPAGWFEHYARHNYMYLDP 80

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
              +  +   P  W     +   E      ++         G + P+            +
Sbjct: 81  VFRNCRATTSPFDWGEAPYDPETEPGAIEVMQRATDFGMARGFSVPIHGPEGCEACFSMS 140

Query: 136 SEFLMLANEVIIEAHGACYQVITDFLELFKKRS-SAARNLTERETSCLQLAGDGYTSEEI 194
                L        H           ++ ++ +   +  LT+RE   L  A  G +S + 
Sbjct: 141 GRNPDLTGRTKPAVHMIAMYAFERARQVGRRPAKPPSNPLTQREQEVLTWAALGKSSRDT 200

Query: 195 AEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           AE + ++  T  A+  +AT KL A NR QA+ +A++  +I
Sbjct: 201 AEIMQITERTALAHAVNATHKLGAANRTQAVVRAMQSKFI 240


>gi|167590019|ref|ZP_02382407.1| transcriptional regulator, LuxR family protein [Burkholderia
           ubonensis Bu]
          Length = 233

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 41/234 (17%), Positives = 71/234 (30%), Gaps = 14/234 (5%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
             + + S  +   ++      +    F          +P  +  I  L N+        +
Sbjct: 7   DLESTRSEHDAYEKIAAAVREV---GFEYSAYYLHTPWPLSRPKIYMLTNFPEAWQQRYH 63

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                  D  + H      PIIW     E           +         G +       
Sbjct: 64  AARYVDVDPVIRHARQSYAPIIWSDAVFE-----ETPHLWQEAQAHGLRYGYSLAAVSNC 118

Query: 127 HKNGYVIFTSEFLMLANEVI----IEAHGACYQVITDFLELFKKRSSA--ARNLTERETS 180
              G +        L    +    ++                  + S   A  LT RE  
Sbjct: 119 GVAGMMSMARSHGPLTRRELQQQELKMRWLVNAAHLAITRAVLPKLSPDNAIELTAREVE 178

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            L+   DG T+ EI+  + +SV+TVN ++ +A  KL   N   A+A+A   G +
Sbjct: 179 VLKWVADGKTASEISMIMLISVYTVNFHVKNAVTKLKTSNTTAAVARAAMLGLL 232


>gi|238027274|ref|YP_002911505.1| Autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia glumae BGR1]
 gi|237876468|gb|ACR28801.1| Autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia glumae BGR1]
          Length = 237

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 46/230 (20%), Positives = 74/230 (32%), Gaps = 14/230 (6%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           +SS +E+S  +    N +    +        + +P  +  I  L NY             
Sbjct: 15  ASSEREISILIEGAANHL---GYEFCGYGLRIPWPVSRPKIYLLSNYPEAWKQRYMEAGY 71

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
              D  + H      P++W         E       R         G +         +G
Sbjct: 72  IDIDPTMKHMRRFQTPVVWTDAFFSRTPE-----LWRDAQAHGLRHGWSQSTFDSCGVSG 126

Query: 131 YVIFTSEFLMLANEVI----IEAHGACYQVITDFLE-LFKKRSSAARN-LTERETSCLQL 184
            +        +    +                     L  K        LT+RE   L+ 
Sbjct: 127 MLTLARSTGPVTPAELERNEFRMRWLVSTTHLAMTRVLMPKLMPDTERGLTDREVEVLKW 186

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           A DG TS EI+  L +SV TVN ++ +A  KL  VN+  A+ +A   G +
Sbjct: 187 AADGKTSGEISTILRISVDTVNFHVKNAVAKLKTVNKTSAVVRAAMLGLL 236


>gi|12620899|gb|AAG61129.1|AF330018_1 AHL receptor [Burkholderia cepacia ATCC 25416]
 gi|17939926|emb|CAD19536.1| CepR protein [Burkholderia cepacia]
 gi|288551614|gb|ADC53303.1| transcriptional activator [Burkholderia cepacia]
          Length = 239

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 41/232 (17%), Positives = 69/232 (29%), Gaps = 11/232 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++ S+ ++       I    K   F        +  P  +  +     Y           
Sbjct: 10  QQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPSVAIFDTYPDGWMAHYQAH 69

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +         I+W  + +            +         G+A         
Sbjct: 70  NYIEIDSTVRDGALSTNMIVWPDVDQIEPC-----PLWQDARDFGLSVGVAQSSWAARGA 124

Query: 129 NGYVIFTSEFLMLANEVIIEA----HGACYQVITDFLELFKKRSSAARN--LTERETSCL 182
            G +        L    I       +       +        + S A    LT RE   L
Sbjct: 125 FGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPAAGVTLTAREREVL 184

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               +G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 185 CWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|107025997|ref|YP_623508.1| LuxR family transcriptional regulator [Burkholderia cenocepacia AU
           1054]
 gi|116692818|ref|YP_838351.1| LuxR family transcriptional regulator [Burkholderia cenocepacia
           HI2424]
 gi|170737931|ref|YP_001779191.1| LuxR family transcriptional regulator [Burkholderia cenocepacia
           MC0-3]
 gi|105895371|gb|ABF78535.1| transcriptional regulator, LuxR family [Burkholderia cenocepacia AU
           1054]
 gi|116650818|gb|ABK11458.1| transcriptional regulator, LuxR family [Burkholderia cenocepacia
           HI2424]
 gi|169820119|gb|ACA94701.1| transcriptional regulator, LuxR family [Burkholderia cenocepacia
           MC0-3]
          Length = 239

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 41/232 (17%), Positives = 69/232 (29%), Gaps = 11/232 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++ S+ ++       I    K   F        +  P  +  +   + Y           
Sbjct: 10  QQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFNTYPDGWMAHYQAQ 69

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +         I+W  +              +         G+A         
Sbjct: 70  NYIEIDSTVRDGALSTNMIVWPDVDRIDPC-----PLWQDARDFGLSVGVAQSSWAARGA 124

Query: 129 NGYVIFTSEFLMLANEVIIEA----HGACYQVITDFLELFKKRSSAARN--LTERETSCL 182
            G +        L    I       +       +        + S A    LT RE   L
Sbjct: 125 FGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPAAGVTLTAREREVL 184

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               +G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 185 CWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|307824873|ref|ZP_07655096.1| transcriptional regulator, LuxR family [Methylobacter tundripaludum
           SV96]
 gi|307734231|gb|EFO05085.1| transcriptional regulator, LuxR family [Methylobacter tundripaludum
           SV96]
          Length = 236

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 47/238 (19%), Positives = 73/238 (30%), Gaps = 13/238 (5%)

Query: 4   NTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGD 63
                +   S+Q        I +  K   F        +  P         +NY      
Sbjct: 5   QETQLQALQSIQCAHQLFQTILSFSKELGFDHCAYGLRMPLPLTNPKTLMFNNYPTAWQA 64

Query: 64  IPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVR 123
                     D  + H    LLPIIW         +                 G A   R
Sbjct: 65  QYQAKNYLAIDPTVQHAMRSLLPIIWTDDLFSPASD-----LWEEACSFGLRVGWAQSSR 119

Query: 124 LGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAAR-------NLTE 176
                 G +        +  E+ ++A+      +T    L   R    +        L+ 
Sbjct: 120 DFNGFVGMLTLARSNEPIT-EIELDANKFKMAWLTQVAHLGMSRCLTPKLMQEVNVTLSN 178

Query: 177 RETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           RE   L+   DG TS EI+  L ++  TVN ++ +   KL+A N+  A  KA   G +
Sbjct: 179 REIEVLRWTADGKTSSEISCILNIAERTVNFHINNVVTKLNAANKTSATIKAAMLGLL 236


>gi|293611186|ref|ZP_06693484.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826437|gb|EFF84804.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 238

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 43/210 (20%), Positives = 72/210 (34%), Gaps = 9/210 (4%)

Query: 31  RNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQ 90
             F              +     L+NY                D  + H    L P++W 
Sbjct: 32  LGFDYCAYGMQSPLSIAEPKTIMLNNYPEAWQKRYLEQHYVKIDPTVQHCMVSLQPLVWS 91

Query: 91  SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIE-- 148
           S   ++      +             G A   R      G +        L+ +      
Sbjct: 92  S---QSAKTQEEKDFWEEARSYGLNVGWAQSSRDFIGTRGMLTLARSSDQLSEKEQKAQY 148

Query: 149 --AHGACYQVITDFLELFKKRSSAARNL--TERETSCLQLAGDGYTSEEIAEKLGLSVHT 204
              +     V +   ++  +   A  NL  T RE   L+   +G TS EIA+ LG++  T
Sbjct: 149 TNMYWLSQTVHSSIAKVVNEMEFAQFNLYLTNREKEALRWTAEGKTSAEIAQILGVTERT 208

Query: 205 VNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           VN +LG++  KL+  N+I A  +A+  G +
Sbjct: 209 VNFHLGNSMQKLNVNNKISAAIRAVMLGLL 238


>gi|14586756|gb|AAK70350.1|AF333005_1 N-acyl homoserine lactone transcriptional regulator [Burkholderia
           stabilis]
          Length = 239

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 41/232 (17%), Positives = 68/232 (29%), Gaps = 11/232 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++ S+ ++       I    K   F        +  P  +  +     Y           
Sbjct: 10  QQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPSVAIFDTYPDGWMARYQAQ 69

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +         I+W  +              +         G+A         
Sbjct: 70  NYIEIDSTVRDGALSTNMIVWPDVDRSDP-----GPLWQDAREFGLSVGVAQSSWAARGA 124

Query: 129 NGYVIFTSEFLMLANEVIIEA----HGACYQVITDFLELFKKRSSAARN--LTERETSCL 182
            G +        L    I       +       +        + S A    LT RE   L
Sbjct: 125 FGLLSIARHADRLTPAEINILTLQTNWLASLSHSLMSRFMVPKLSPAAGVTLTAREREVL 184

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               +G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 185 CWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|27376991|ref|NP_768520.1| transcriptional regulator [Bradyrhizobium japonicum USDA 110]
 gi|27350133|dbj|BAC47145.1| transcriptional regulatory protein [Bradyrhizobium japonicum USDA
           110]
          Length = 253

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 42/230 (18%), Positives = 81/230 (35%), Gaps = 5/230 (2%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELH-NYDLDSGDIPNIL 68
           ++ S+  L   L    +       A   ++ + +    + L      N+  D        
Sbjct: 24  QTRSIAALFDLLVNFASNEGFDKVAYGALSCSNERRLPEYLPPPPTINFPSDWCQRYAEQ 83

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +        P +W  +     ++      +R         G++ P+     +
Sbjct: 84  EYQAIDPVVRRTAMLPRPFLWDELTSRYELQPRELRVLREAKEAGLKHGMSVPLFGSQGR 143

Query: 129 NGYVIFTSEFLMLANEVIIE----AHGACYQVITDFLELFKKRSSAARNLTERETSCLQL 184
           + +V F S F     +  +        A +  +        +       LT RET CL  
Sbjct: 144 SAFVSFASPFDDADPQDRMAHLTTLASAFHNAVAQITPPLDESCETDIPLTPRETECLYW 203

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             +G ++  I + + ++ +TVN ++ +   KL A NR  A+AKA R G I
Sbjct: 204 VAEGKSAWVIGQLVNVTDNTVNFHMKNVIRKLGAANRTNAVAKATRRGII 253


>gi|13625780|gb|AAK35156.1|AF296284_2 transcriptional activator BviR [Burkholderia cepacia]
 gi|116878313|gb|ABK32010.1| transcriptional regulator [Burkholderia vietnamiensis]
 gi|116878322|gb|ABK32016.1| transcriptional regulator [Burkholderia vietnamiensis]
          Length = 237

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 74/231 (32%), Gaps = 16/231 (6%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           + S  ++          ++A  F   +    +  P  +       NY     +       
Sbjct: 15  AKSEADVFLEFSA---DVRALGFDHCSFGLRIPLPISKPQFMLQSNYPQTWVERYVSQNY 71

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
              D  + H  S + P+IW++  +   ++          G      G   P        G
Sbjct: 72  FAVDPTVRHGLSRMSPLIWRADSQTQCVQ-----FWEEAGQHGLRHGWCMPSVSRTGAIG 126

Query: 131 YVIFTSEFLMLANEVIIE-------AHGACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
            +        +    + E               ++  L L +        LT RE   LQ
Sbjct: 127 LITMVRSGEPIEERELAEKGYQMSWLANTANYAMSMHL-LQRLVPEYTVELTVREREALQ 185

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +  G T  EI + + +   TV  +L +A  KL+A N+ +A  KA   G +
Sbjct: 186 WSAAGKTYAEIGKIMHVDDRTVKFHLVNAMRKLNAANKTEAAVKATMLGLL 236


>gi|218463393|ref|ZP_03503484.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli Kim 5]
          Length = 245

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 56/220 (25%), Positives = 80/220 (36%), Gaps = 3/220 (1%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++   L  +    + R F +  +        +      L ++  +   + +         
Sbjct: 27  DIFRFLKRVTEAYRCRAFMVLNLPPITSLDLQGS--TVLTSWPAELLALYDQEGLMVDSP 84

Query: 76  FLFHFNSGLLPIIWQSIQEE-TVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
            L    +   P  +   ++     +    L V L           FP        G V F
Sbjct: 85  VLRRLRTSARPFFYDMSRQSWPRDDGKSALVVGLFERFRMMRCAYFPTHEASGLRGAVSF 144

Query: 135 TSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEI 194
             +    +   + E       V     E+    +     LTERE  CL     G TS EI
Sbjct: 145 AGDREPFSPAEMRELCYIAIHVFDRLAEIRNLDTRVTDALTEREIDCLNWTAAGKTSAEI 204

Query: 195 AEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           AE L LS HTVN YL  AT KLD VNR QA+AKA+R G I
Sbjct: 205 AEILSLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGLI 244


>gi|13507195|gb|AAK28504.1| MupR [Pseudomonas fluorescens]
          Length = 234

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 49/230 (21%), Positives = 85/230 (36%), Gaps = 15/230 (6%)

Query: 13  SLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETY 72
           +L+  S  L  +       +  L+ +   +  P     I  + NY      I +      
Sbjct: 10  TLEAWSKVLFALAKEYGFSS-VLFGVKPTISTPFSSSTI--ISNYSRSWRSIYDANAYYE 66

Query: 73  GDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYV 132
            D  +FH  +  LP++W     E  I    Q            +G+  P+     + G +
Sbjct: 67  VDPVVFHCLNSSLPLVWTK---ENFINKPEQQLYEAASASGVCSGLCMPIHGPRGEFGML 123

Query: 133 IFTSEFLMLANEVIIEAHGACYQVITDFL--------ELFKKRSSAARNLTERETSCLQL 184
            F ++      +VI       + ++ D+L           +K       LT RE  CL+ 
Sbjct: 124 NFITDEKSP-ADVIRSKGLPQFALMRDYLIESFQKIQSAAEKEVEKPPKLTARELECLKW 182

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              G TS EI+  L  +  TVN ++ +   K +A +R  A+   IR G +
Sbjct: 183 VAAGKTSWEISRILSCAEVTVNYHVTNFMRKFNAESRQHAVISGIRSGLV 232


>gi|110678944|ref|YP_681951.1| transcriptional activator protein RaiR, putative [Roseobacter
           denitrificans OCh 114]
 gi|109455060|gb|ABG31265.1| Transcriptional activator protein RaiR, putative [Roseobacter
           denitrificans OCh 114]
          Length = 239

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 41/232 (17%), Positives = 83/232 (35%), Gaps = 15/232 (6%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           +++ +L+ ++  +  ++      +   + ++SA +             Y L+        
Sbjct: 15  EQADTLEGINEAIFTLRGHFGVEHMVYHWVDSAGEQ-------YGYGTYSLEWAARYQEQ 67

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +        P+ W+ +   +    + +      G  L   G + P+R    +
Sbjct: 68  NYIRVDPVVIGCYQRFHPVDWKRLDWSSKAARALRAEAATYG--LGNQGYSIPIRGPNGQ 125

Query: 129 NGYVIFTSEFLMLAN-----EVIIEAHGACYQVITDFLELFKKRSS-AARNLTERETSCL 182
                  +            E   E     +      LE    ++   ++ L+ RE   +
Sbjct: 126 FALFTVNTSCDDEEWAKFTEENRRELILIAHYFNQKALEFEPNKTPEQSQALSPREIDAM 185

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            L   GY   ++AE L +S HT+  Y+ SA  KL A N   A+A+A+  G I
Sbjct: 186 TLLAIGYNRAQVAETLSISEHTLRVYIESARFKLGAANTTHAVARALSRGLI 237


>gi|12620907|gb|AAG61133.1|AF330022_1 AHL receptor [Burkholderia vietnamiensis]
          Length = 239

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 43/233 (18%), Positives = 73/233 (31%), Gaps = 13/233 (5%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++ S+ ++       I    K   F        +  P  +  +     Y           
Sbjct: 10  QQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFDTYPDGWMAHYQAR 69

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +         I+W  +                        G+A         
Sbjct: 70  NYIEIDSTVREGALSTNMIVWPDVDRIDPC-----PLWEDARDFGLAVGVAQSSWAARGA 124

Query: 129 NGYVIFTSEFLMLANEVIIEAHG-------ACYQVITDFLELFKKRSSAARNLTERETSC 181
            G +  +     L    I              + +++ F+ L K   +A   LT RE   
Sbjct: 125 FGLLSISRHADRLTPAEINMLTLQTNWLANLSHSLMSRFM-LPKLSPAAGVTLTAREREV 183

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           L    +G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 184 LCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|327188113|gb|EGE55336.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli CNPAF512]
          Length = 245

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 53/220 (24%), Positives = 81/220 (36%), Gaps = 3/220 (1%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++   +  +    + R F +  +        +      + ++  +   + +         
Sbjct: 27  DIFRFMKRVTEAYRCRAFMVLNLPPITSLDLQG--NTVITSWPAELLALYDQEGLMVNSP 84

Query: 76  FLFHFNSGLLPIIWQSIQEE-TVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
            L    +   P  +   ++  +  +    L V L           FP        G V F
Sbjct: 85  VLRRLRTSARPFSYDMSRQNWSRDDGKSDLVVGLFERFRMTRCAYFPTHEPSGLRGAVSF 144

Query: 135 TSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEI 194
             +    +   + E       V     E+    +     LT+RE  CL     G TS EI
Sbjct: 145 AGDREPFSPTEMRELCYIAIHVFDRLAEIRNLDTRVTDALTDREIDCLNWTAAGKTSAEI 204

Query: 195 AEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           AE L LS HTVN YL  AT KLD VNR QA+AKA+R G I
Sbjct: 205 AEILVLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGLI 244


>gi|59940141|gb|AAX12609.1| LuxR-type transcriptional regulator [Aeromonas veronii bv. sobria]
          Length = 260

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 52/231 (22%), Positives = 88/231 (38%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S  + +    LI        +  Y     L    ++  +   +                
Sbjct: 14  NSSADGNRLAELIGRFTLGMGYDYYRFALILPMSMQRPKVVLFNQCPDSWVQAYTENNML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEE-TVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E  + ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPVIRLARKQTLPIYWNRLDERASFLQEGTMDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       +      S+    LTERET CL 
Sbjct: 134 ILSFITSER-ASSDLLLESSPILSWMSNYIFEAAIRVVRFSMMDSAGKDPLTERETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKEVSTGLL 243


>gi|115358865|ref|YP_776003.1| LuxR family transcriptional regulator [Burkholderia ambifaria AMMD]
 gi|13508495|gb|AAK27306.1| AHL receptor [Burkholderia ambifaria]
 gi|115284153|gb|ABI89669.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           AMMD]
          Length = 239

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 40/232 (17%), Positives = 70/232 (30%), Gaps = 11/232 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++ S+ ++       I    K   F        +  P  +  +   + Y           
Sbjct: 10  QQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFNTYPDGWMARYQAQ 69

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +         I+W  +              +         G+A         
Sbjct: 70  NYIEIDSTVRDGAMSTNMIVWPDVDRIDPC-----PLWQDARDYGLSVGVAQSSWAARGA 124

Query: 129 NGYVIFTSEFLMLANEVIIEA----HGACYQVITDFLELFKKRSSAARN--LTERETSCL 182
            G +        L    I       +       +        + S   +  LT RE   L
Sbjct: 125 FGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMLPKLSPESSVTLTAREREVL 184

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +   +G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 185 RWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAIGAGLI 236


>gi|152985537|ref|YP_001348746.1| putative transcriptional regulator [Pseudomonas aeruginosa PA7]
 gi|150960695|gb|ABR82720.1| probable transcriptional regulator [Pseudomonas aeruginosa PA7]
          Length = 237

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 45/232 (19%), Positives = 74/232 (31%), Gaps = 14/232 (6%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
            + ++ +E       I        F  ++  +   FP        L NY  +        
Sbjct: 13  SRITTEEEFFSLALEI---CGNYGFEFFSFGARAPFPLTAPKYHFLSNYPGEWKSRYISE 69

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
             T  D  + H     +P+IW     +       +             G + PVR  +  
Sbjct: 70  DYTSIDPIVRHGLLEYMPLIWNGEDFQEN-----RFFWEEALHHGIRHGWSIPVRGKYGL 124

Query: 129 NGYVIFTSEFLMLANEVIIE----AHGACYQVITDFLELFKKRSSAAR--NLTERETSCL 182
                       +A   I+E           +   F +L   R        LT RET  L
Sbjct: 125 ISMFSLVRSAESIAAAEILEKESFLLWITSMLQATFGDLLAPRIVPESNVRLTARETEML 184

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +    G T  EI   L +   TV  ++ +A  KL++ N+ +A  KA   G +
Sbjct: 185 KWTAVGKTYGEIGLILSIDQRTVKFHIVNAMRKLNSSNKAEATMKAYAIGLL 236


>gi|14586754|gb|AAK70349.1|AF333004_1 N-acyl homoserine lactone transcriptional regulator [Burkholderia
           multivorans ATCC BAA-247]
          Length = 239

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 41/232 (17%), Positives = 69/232 (29%), Gaps = 11/232 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++ S+ ++       I    K   F        +  P  +  +     Y           
Sbjct: 10  QQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPSVAIFDTYPDGWMAHYQAH 69

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +         I+W  + +            +         G+A         
Sbjct: 70  NYIEIDSTVRDGALSTNMIVWPDVDQIAPC-----PLWQDARDFGLSVGVAQSSWAARGA 124

Query: 129 NGYVIFTSEFLMLANEVIIEA----HGACYQVITDFLELFKKRSSAARN--LTERETSCL 182
            G +        L    I       +       +        + S A    LT RE   L
Sbjct: 125 FGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPAAGVTLTAREREVL 184

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               +G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 185 CWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|294340032|emb|CAZ88396.1| autoinducer-binding transcriptional regulator LuxR family
           [Thiomonas sp. 3As]
          Length = 237

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 39/221 (17%), Positives = 74/221 (33%), Gaps = 11/221 (4%)

Query: 20  RLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFH 79
              ++ + + +  F   +    +  P  +  +  L NY     +          D  + H
Sbjct: 21  LFEIVVSMVHSLGFDHCSYGLRMPLPVSRPKVVLLTNYPRAWENRYTEKGYLAVDPTVRH 80

Query: 80  FNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFL 139
               L P++W      +      +             G A   R      G +  +    
Sbjct: 81  GTHSLQPVVWSDAFFAS-----SRDLWEEARSFGLCVGWAQSSRDVNSTMGLLSVSRSGE 135

Query: 140 MLANEVIIE----AHGACYQVITDFLELFKKRSSAA--RNLTERETSCLQLAGDGYTSEE 193
            ++   + +           V      +   +   A    LT+RE   L+   DG T+ E
Sbjct: 136 PISEIELRDKEMQLAWLTQMVHLGMSRILTAKLMPAVTAPLTDREIEVLRWTADGKTASE 195

Query: 194 IAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           IA+ L +S  T N ++ +A  KL A N+  A+ +A   G +
Sbjct: 196 IADILNISERTANFHIANAIAKLHAPNKTAAVIRAGMLGML 236


>gi|170745593|ref|YP_001776815.1| LuxR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170752150|ref|YP_001783296.1| LuxR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170659247|gb|ACB28299.1| transcriptional regulator, LuxR family [Methylobacterium
           radiotolerans JCM 2831]
 gi|170659277|gb|ACB28328.1| transcriptional regulator, LuxR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 248

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 46/233 (19%), Positives = 87/233 (37%), Gaps = 11/233 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLIC-ELHNYDLDSGDIPNI 67
           +++S+  ++      ++       + ++ I      P      C  +  +  + G     
Sbjct: 19  RRASTDVDVYS---ELRRSGAIFGYDVFLIAGLPRAPHENLYDCSLISGWPPEWGRRYQE 75

Query: 68  LIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
               + D  + H      P +WQ   +   +   G + +          G   P      
Sbjct: 76  RRHMHVDPVIRHIRGTTDPFLWQEAVDAQ-VTPEGMVVMEEARAFSLNEGFCVPFHQIDG 134

Query: 128 KNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRS------SAARNLTERETSC 181
               V F  E + L+ +     H      ++    + ++R       +    LT RE  C
Sbjct: 135 TEAGVSFGGEQVRLSQDERAALHLVAIYAMSTAKAIARRRGLSEDDGTPPSPLTGREAEC 194

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           L+ +  G ++ EI   L +S  TV  +LGSA  KL++V R QA+A+A+R   I
Sbjct: 195 LKWSSTGKSAWEIGVILSISTRTVEHHLGSAVRKLNSVTRTQAVAEALRRHII 247


>gi|218661906|ref|ZP_03517836.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli IE4771]
          Length = 245

 Score =  158 bits (401), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 55/220 (25%), Positives = 80/220 (36%), Gaps = 3/220 (1%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++   L  +    + R F +  +        +      L ++  +   + +         
Sbjct: 27  DIFRFLKRVTEAYRCRAFMVLNLPPITSLDLQGS--TVLTSWPAELLALYDQEGLMVDSP 84

Query: 76  FLFHFNSGLLPIIWQSIQEE-TVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
            L    +   P  +   ++     +    L V L           FP        G V F
Sbjct: 85  VLRRLRTSARPFFYDMSRQSWPRDDGKSALVVGLFERFRMMRCAYFPTHEASGLRGAVSF 144

Query: 135 TSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEI 194
             +    +   + E       V     E+    +     LT+RE  CL     G TS EI
Sbjct: 145 AGDREPFSPAEMRELCYIAIHVFDRLAEIRNLDTRVTDALTDREIDCLNWTAAGKTSAEI 204

Query: 195 AEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           AE L LS HTVN YL  AT KLD VNR QA+AKA+R G I
Sbjct: 205 AEILSLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGLI 244


>gi|222106725|ref|YP_002547516.1| DNA-binding HTH domain-containing protein [Agrobacterium vitis S4]
 gi|221737904|gb|ACM38800.1| DNA-binding HTH domain-containing protein [Agrobacterium vitis S4]
          Length = 307

 Score =  158 bits (401), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 85/237 (35%), Gaps = 16/237 (6%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSA-LDFPRRQQLICELHNYDLDSGDIPNIL 68
            + S  E+   +      +  + F+ + + +  L+     +    ++NY  +  +     
Sbjct: 54  AAVSAAEMKAVMESSIKSLGYKYFSYHILQTPVLNATNETRHTFGINNYPEEWVERYASE 113

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
              Y D  +    S   P  W    +   +    +  +          G+  P+     +
Sbjct: 114 RYVYCDPIVGISLSRKTPFRWSDAIDSDKLTEEERCVIEDAAKRGIVNGLTVPLMSRHGE 173

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACY-----------QVITDFLELFKKRSSAARNLTER 177
              +    +      + + EAH                V+ + L    +R      L+ R
Sbjct: 174 LAIMTVIPDEKF--QDSLPEAHLIHIISQFFHSCALPVVMEEHLIGSYRR--RRSFLSAR 229

Query: 178 ETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           E   +     G +S EIA+ LG+S  +V  Y+ S   KL+AVNR QA+ KAI  G I
Sbjct: 230 EKETVIWVSKGKSSWEIAKILGISEKSVEFYMESVKRKLEAVNRTQAVVKAIMLGLI 286


>gi|13474692|ref|NP_106261.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
 gi|14025447|dbj|BAB52047.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
          Length = 243

 Score =  158 bits (401), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 52/230 (22%), Positives = 89/230 (38%), Gaps = 2/230 (0%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
             + + +   +  +L  I +          T+        +Q+    L ++ ++  +   
Sbjct: 13  QLQHAGTAAAVCEKLLGITSDFGLTALMAGTVPQPGTPSEQQKQHVLLCDWPVEWLERYV 72

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                  D  + H      P  W+   +    + S    +   G      G+AFP+    
Sbjct: 73  ARNYVDHDPVVSHMKQLQAPFQWREAAQGISFDKSSGEVMGDAGAFKLRDGLAFPLITLD 132

Query: 127 HKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAAR--NLTERETSCLQL 184
            +   V    E + L+              +   ++L    +       LT RE  CLQ 
Sbjct: 133 GQIVMVSLGGEAMQLSAAEFGLVSLVSTYAVGRAMQLHTMATKTIDHIELTPRERECLQW 192

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           A  G +  EI++ LG+S HT   +L +A  KL AVNR+QA+A+AIR GYI
Sbjct: 193 AAVGKSEWEISQILGISEHTSEKHLLNAKSKLGAVNRVQAVAEAIRRGYI 242


>gi|209548111|ref|YP_002280028.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533867|gb|ACI53802.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 244

 Score =  158 bits (401), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 54/220 (24%), Positives = 82/220 (37%), Gaps = 3/220 (1%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++   L  +    ++R F +  +        +      + ++  +   + +         
Sbjct: 26  DIFRFLKRVTEAYRSRAFLVLNLPPITSLDIQGS--TVITSWPAELLALYDQEGLLVNSP 83

Query: 76  FLFHFNSGLLPIIWQSIQEE-TVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
            L    +   P  +   +E  +  +    L   L        G  FP        G + F
Sbjct: 84  VLRRLRTSARPFFYDMSRENWSRDDGKSILVASLFERFRMMRGAYFPTHEPSGVRGAISF 143

Query: 135 TSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEI 194
             +    +   + E       V     E+    +     LT+RE  CL     G TS EI
Sbjct: 144 AGDREPFSPAEMRELCYISIHVYDRLAEIRNLDTRITDTLTDREIDCLNWTAAGKTSAEI 203

Query: 195 AEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           AE L LS HTVN YL  AT KLD VNR QA+AKA+R G I
Sbjct: 204 AEILTLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGLI 243


>gi|66277254|gb|AAY44558.1| LuxR-like protein [Aeromonas caviae]
          Length = 260

 Score =  158 bits (401), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 48/211 (22%), Positives = 83/211 (39%), Gaps = 9/211 (4%)

Query: 32  NFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQS 91
            +  Y     L    ++  +   +           +      D  +       LPI W  
Sbjct: 34  GYDYYRFALILPMSMQRPKVVLFNQCPDSWVQAYTLNNMLACDPIIQLARRQTLPIYWNR 93

Query: 92  IQE-ETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIE-- 148
           + E    ++      + L        GI+FP+     +NG + F +     ++++++E  
Sbjct: 94  LDEKARFLQEGSMDVMGLAAEFGLRNGISFPLHGAAGENGILSFIT-RERASSDLMLESS 152

Query: 149 --AHGACYQVITDFLELFK---KRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVH 203
                    +    + + +   +       LTERET CL  A +G TS EIA  LG++  
Sbjct: 153 PILSWMSNYIFEAAIRIVRQSMREDDPQEPLTERETECLFWASEGKTSGEIACILGITER 212

Query: 204 TVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 213 TVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|190890568|ref|YP_001977110.1| transcriptional regulator protein, LuxR family [Rhizobium etli CIAT
           652]
 gi|190695847|gb|ACE89932.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli CIAT 652]
          Length = 246

 Score =  158 bits (401), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 53/220 (24%), Positives = 81/220 (36%), Gaps = 3/220 (1%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++   +  +    + R F +  +        +      + ++  +   + +         
Sbjct: 28  DIFRFMKRMTEAYRCRAFMVLNLPPITSLDLQG--NTVITSWPAELLALYDQEGLMVNSP 85

Query: 76  FLFHFNSGLLPIIWQSIQEE-TVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
            L    +   P  +   ++  +  +    L V L           FP        G V F
Sbjct: 86  ILRRLRTSARPFSYDMSRQNWSRDDGKSDLVVGLFERFRMTRCAYFPTHEPSGLRGAVSF 145

Query: 135 TSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEI 194
             +    +   + E       V     E+    +     LT+RE  CL     G TS EI
Sbjct: 146 AGDREPFSPAEMRELCYIAIHVFDRLAEIRNLDTRVTDALTDREIDCLNWTAAGKTSAEI 205

Query: 195 AEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           AE L LS HTVN YL  AT KLD VNR QA+AKA+R G I
Sbjct: 206 AEILVLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGLI 245


>gi|262281348|ref|ZP_06059129.1| transcriptional activator protein phzR [Acinetobacter calcoaceticus
           RUH2202]
 gi|262257174|gb|EEY75911.1| transcriptional activator protein phzR [Acinetobacter calcoaceticus
           RUH2202]
          Length = 238

 Score =  158 bits (401), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 43/210 (20%), Positives = 71/210 (33%), Gaps = 9/210 (4%)

Query: 31  RNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQ 90
             F              +     L+NY                D  + H    L P++W 
Sbjct: 32  LGFDYCAYGMQAPLSIAEPKTIMLNNYPEAWQKRYVKQQYVVVDPTVQHCMLSLQPLVWS 91

Query: 91  SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIE-- 148
           S   ++    S +             G A   R      G +        L+ +      
Sbjct: 92  S---QSANTQSQKDFWEEARSYGLNVGWAQSSRDFIGTRGMLTLARSTDQLSEKEQKAQY 148

Query: 149 --AHGACYQVITDFLELFKKRSSAARNL--TERETSCLQLAGDGYTSEEIAEKLGLSVHT 204
              +     V +   ++      A  NL  T RE   L+   +G TS EIA+ LG++  T
Sbjct: 149 TNMYWLSQTVHSSIAKIVNDAEFAQFNLYLTNREKEVLRWTAEGKTSAEIAQILGVTERT 208

Query: 205 VNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           VN +L ++  KL+  N+I A  +A+  G +
Sbjct: 209 VNFHLCNSMQKLNVNNKISAAIRAVMLGIL 238


>gi|330820206|ref|YP_004349068.1| quorum sensing LuxR family sensor regulator [Burkholderia gladioli
           BSR3]
 gi|327372201|gb|AEA63556.1| quorum sensing LuxR family sensor regulator [Burkholderia gladioli
           BSR3]
          Length = 240

 Score =  158 bits (401), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 45/231 (19%), Positives = 73/231 (31%), Gaps = 14/231 (6%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
            +++ Q+L  ++     R+    F        +  P  Q ++     Y            
Sbjct: 15  AAANEQQLFQQISAYSKRL---GFEYCCYGIRVPQPGTQPVVEIFDTYPAGWMAHYQARN 71

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
               D  +         IIW  +              R         G+A          
Sbjct: 72  YIEVDPTVRDGAMSPNMIIWPDVDTAEDPS-----LWRDARDFGMSVGVAQSAWAARGVF 126

Query: 130 GYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKK------RSSAARNLTERETSCLQ 183
           G +        L    I         +      L  K        +A+  LT+RE   L 
Sbjct: 127 GLLTIARRSDRLTPAEINSLTLQANWLANLSHSLMGKFLVPKLSPAASVTLTKREREVLS 186

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              +G T+ EI E+L +S  TV  ++ +   KL A N++QA+ KAI  G I
Sbjct: 187 WTSEGRTASEIGEQLNISERTVTFHINNILAKLGATNKVQAVVKAIGMGLI 237


>gi|218508993|ref|ZP_03506871.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli Brasil 5]
          Length = 245

 Score =  158 bits (401), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 53/220 (24%), Positives = 81/220 (36%), Gaps = 3/220 (1%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++   +  +    + R F +  +        +      + ++  +   + +         
Sbjct: 27  DIFRFMKRVTEAYRCRAFMVLNLPPITSLDLQG--NTVITSWPAELLALYDQEGLMVNSP 84

Query: 76  FLFHFNSGLLPIIWQSIQEE-TVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
            L    +   P  +   ++  +  +    L V L           FP        G V F
Sbjct: 85  VLRRLRTSARPFSYDMSRQNWSRDDGKSDLVVGLFERFRMTRCAYFPTHEPSGLRGAVSF 144

Query: 135 TSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEI 194
             +    +   + E       V     E+    +     LT+RE  CL     G TS EI
Sbjct: 145 AGDREPFSPAEMRELCYIAIHVFDRLAEIRNLDTRVTDALTDREIDCLNWTAAGKTSAEI 204

Query: 195 AEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           AE L LS HTVN YL  AT KLD VNR QA+AKA+R G I
Sbjct: 205 AEILVLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGLI 244


>gi|116878316|gb|ABK32012.1| transcriptional regulator [Burkholderia vietnamiensis]
 gi|116878319|gb|ABK32014.1| transcriptional regulator [Burkholderia vietnamiensis]
          Length = 237

 Score =  158 bits (401), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 40/231 (17%), Positives = 73/231 (31%), Gaps = 16/231 (6%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           + S  ++          ++A  F   +    +  P  +       NY     +       
Sbjct: 15  AKSEADVFLEFSA---DVRALGFDHCSFGLRIPLPISKPQFMLQSNYPQTWVERYVSQNY 71

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
              D  + H  S + P+IW++  +   ++                 G   P        G
Sbjct: 72  FAVDPTVRHGLSRMSPLIWRADSQTQCVQ-----FWEEADQHGLRHGWCMPSVSRTGAIG 126

Query: 131 YVIFTSEFLMLANEVIIE-------AHGACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
            +        +    + E               ++  L L +        LT RE   LQ
Sbjct: 127 LITMVRSGEPIEERELAEKGYQMSWLANTANYAMSMHL-LQRLVPEYTVELTVREREALQ 185

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +  G T  EI + + +   TV  +L +A  KL+A N+ +A  KA   G +
Sbjct: 186 WSAAGKTYAEIGKIMHVDDRTVKFHLVNAMRKLNAANKTEAAVKATMLGLL 236


>gi|171322367|ref|ZP_02911189.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           MEX-5]
 gi|171092309|gb|EDT37680.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           MEX-5]
          Length = 239

 Score =  158 bits (400), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 40/232 (17%), Positives = 69/232 (29%), Gaps = 11/232 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++ S+ ++       I    K   F        +  P  +  +   + Y           
Sbjct: 10  QQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFNTYPDGWMARYQAQ 69

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +         I+W  +              +         G+A         
Sbjct: 70  NYIEIDSTVRDGALSTNMIVWPDVDRIDPC-----PLWQDARDFGLSVGVAQSSWAARGA 124

Query: 129 NGYVIFTSEFLMLANEVIIEA----HGACYQVITDFLELFKKRSSAARN--LTERETSCL 182
            G +        L    I       +       +        + S   +  LT RE   L
Sbjct: 125 FGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPESSVTLTAREREVL 184

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               +G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 185 CWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAIAAGLI 236


>gi|12620903|gb|AAG61131.1|AF330020_1 AHL receptor [Burkholderia cepacia]
          Length = 239

 Score =  158 bits (400), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 41/232 (17%), Positives = 69/232 (29%), Gaps = 11/232 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++ S+ ++       I    K   F        +  P  +  +   + Y           
Sbjct: 10  QQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFNTYPDGWMAHYQAR 69

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +         I+W  +              +         G+A         
Sbjct: 70  NYIEIDSTVRDGALSTNMIVWPDVDRIDPC-----PLWQDARDFGLSVGVAQSSWAARGA 124

Query: 129 NGYVIFTSEFLMLANEVIIEA----HGACYQVITDFLELFKKRSSAARN--LTERETSCL 182
            G +        L    I       +       +        + S A    LT RE   L
Sbjct: 125 FGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPAAGVTLTAREREVL 184

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               +G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 185 CWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|218673534|ref|ZP_03523203.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli GR56]
          Length = 245

 Score =  158 bits (400), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 53/220 (24%), Positives = 80/220 (36%), Gaps = 3/220 (1%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++   +  +    + R F +  +        +      + ++  +   + +         
Sbjct: 27  DIFRFMKRVTEAYRCRAFMVLNLPPITSLDLQGS--TVITSWPAELLALYDQEGLMVNSP 84

Query: 76  FLFHFNSGLLPIIWQSIQEE-TVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
            L    +   P  +   ++     +    L V L           FP        G V F
Sbjct: 85  VLRRLRTSARPFFYDMSRQNWPRDDGKSALVVGLFERFRMTRCAYFPTHEPSGLRGAVSF 144

Query: 135 TSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEI 194
             +    +   + E       V     E+    +     LT+RE  CL     G TS EI
Sbjct: 145 AGDREPFSPAEMRELCYIAIHVFDRLAEIRNLDTRITDALTDREIDCLNWTAAGKTSAEI 204

Query: 195 AEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           AE L LS HTVN YL  AT KLD VNR QA+AKA+R G I
Sbjct: 205 AEILALSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGLI 244


>gi|7385149|gb|AAF61719.1|AF232769_1 acylhomoserine lactone dependent transcriptional regulator
           [Pseudomonas fluorescens]
          Length = 241

 Score =  158 bits (400), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 44/230 (19%), Positives = 72/230 (31%), Gaps = 10/230 (4%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
           +   LQE +    L++  ++   F  Y        P  +       +Y     +      
Sbjct: 17  EMLKLQESAQVFALLEREVQYLGFDFYAYGIRHSIPFTRPKTEIYGSYPQPWMERYQQQN 76

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
               D  + +       ++W  +         G +            G   P+R      
Sbjct: 77  YAAIDPSILNGLRSTEMVVWNDVLF-----GKGSVLWGEAQDWGLRVGATVPIRTPDGAL 131

Query: 130 GYVIFTSEFLMLANEVI----IEAHGACYQVITDFLELFKKRS-SAARNLTERETSCLQL 184
             +        ++        +              EL    + S  + L+ RE   LQ 
Sbjct: 132 SVLSVARRNTAISAVEREVIRLRLRCIIELAAGRLSELGHSNTQSDPQELSAREREILQW 191

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             DG +S EIA  LG+SV+TVN +L     K  A N+  A A A   G I
Sbjct: 192 TADGKSSGEIALILGISVNTVNFHLKVIQKKFGAANKTLAAAYAAVLGLI 241


>gi|194468906|ref|ZP_03074890.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194455270|gb|EDX44109.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
          Length = 240

 Score =  158 bits (400), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 43/235 (18%), Positives = 77/235 (32%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++ ++ +++   L     R++   F  Y +      P  +  I     Y       
Sbjct: 14  LLRFQEMAAAEDVYTELQYQTQRLE---FDYYALCVRHPVPFTRPKISLRTTYPPAWVTH 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     + W  +          Q             G+   V L
Sbjct: 71  YQSENYFAIDPVLKPENFRQGHLHWDDVLFH-----EAQAMWDAAQRFGLRRGVTQCVML 125

Query: 125 GFHKNGYVIFTSEFLMLAN----EVIIEAHGACYQVITDFLELFKK-RSSAARNLTERET 179
                G++ F+   L  ++    EV +       + ++    L      +     ++RE 
Sbjct: 126 PNRALGFLSFSRSSLRCSSFTYDEVELRLQLLARESLSALTRLEDDMVMAPEMRFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K +A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|49081930|gb|AAT50365.1| PA1898 [synthetic construct]
          Length = 238

 Score =  158 bits (400), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 45/232 (19%), Positives = 75/232 (32%), Gaps = 14/232 (6%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
            + ++ +E    +  I        F  ++  +   FP        L NY  +        
Sbjct: 13  SRITTEEEFFSLVLEI---CGNYGFEFFSFGARAPFPLTAPKYHFLSNYPGEWKSRYISE 69

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
             T  D  + H      P+IW     +       +             G + PVR  +  
Sbjct: 70  DYTSIDPIVRHGLLEYTPLIWNGEDFQEN-----RFFWEEALHHGIRHGWSIPVRGKYGL 124

Query: 129 NGYVIFTSEFLMLANEVIIE----AHGACYQVITDFLELFKKRSSAAR--NLTERETSCL 182
              +        +A   I+E           +   F +L   R        LT RET  L
Sbjct: 125 ISMLSLVRSSESIAATEILEKESFLLWITSMLQATFGDLLAPRIVPESNVRLTARETEML 184

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +    G T  EI   L +   TV  ++ +A  KL++ N+ +A  KA   G +
Sbjct: 185 KWTAVGKTYGEIGLILSIDQRTVKFHIVNAVRKLNSSNKAEATMKAYAIGLL 236


>gi|205352355|ref|YP_002226156.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|205272136|emb|CAR36989.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|326627405|gb|EGE33748.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 9]
          Length = 240

 Score =  158 bits (400), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 76/235 (32%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++ ++ +++   L     R++   F  Y +      P  +  I     Y       
Sbjct: 14  LLRFQEMAAAEDVYTELQYQTQRLE---FDYYALCVRHPVPFTRPKISLRTTYPPAWVTH 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     + W  +          Q             G+   V L
Sbjct: 71  YQSENYFAIDPVLKPENFRQGHLHWDDVLFH-----EEQAMWDAAQRFGLRRGVTQCVML 125

Query: 125 GFHKNGYVIFTSEFLMLAN----EVIIEAHGACYQVITDFLELFKK-RSSAARNLTERET 179
                G++ F+   L  ++    EV +       + ++           +     ++RE 
Sbjct: 126 PNRALGFLSFSRSSLRCSSFTYDEVELRLQLLARESLSALTRFEDDMVMAPEMRFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K +A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|254254249|ref|ZP_04947566.1| DNA-binding HTH domain-containing protein [Burkholderia dolosa
           AUO158]
 gi|12620909|gb|AAG61134.1|AF330023_1 AHL receptor [Burkholderia cepacia]
 gi|124898894|gb|EAY70737.1| DNA-binding HTH domain-containing protein [Burkholderia dolosa
           AUO158]
          Length = 239

 Score =  158 bits (400), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 41/229 (17%), Positives = 67/229 (29%), Gaps = 11/229 (4%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           S+ ++       I    K   F        +  P  +  +     Y              
Sbjct: 13  SAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFDTYPDGWMAHYQAKNYI 72

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  +         I+W  +       +      R         G+A          G 
Sbjct: 73  DIDSTVRDGALSTNMIVWPDVD-----GADSSPLWRDAREFGLSVGVAQSSWAARGAFGL 127

Query: 132 VIFTSEFLMLANEVIIEA----HGACYQVITDFLELFKKRSSAARN--LTERETSCLQLA 185
           +        L    I       +       +        + S   +  LT RE   L   
Sbjct: 128 LSIARRADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPEASVTLTAREREVLCWT 187

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 188 AEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|116250693|ref|YP_766531.1| LuxR/GerE family transcriptional regulator [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115255341|emb|CAK06416.1| putative LuxR/GerE family transcriptional regulator [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 245

 Score =  158 bits (400), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 53/220 (24%), Positives = 83/220 (37%), Gaps = 3/220 (1%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++   +  +    ++R F +  +     F  +      + ++  +   + +         
Sbjct: 27  DIFRFMKRVTEAYRSRAFMVLNLPPITSFDLQGS--TVITSWPAELLALYDQEGLMVNSP 84

Query: 76  FLFHFNSGLLPIIWQSIQEE-TVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
            L    +   P  +   ++  +  +    L   L           FP        G V F
Sbjct: 85  VLRRLRTSARPFFYDMSRQNWSRDDGKSILVASLFERFKMMRCAYFPTHEPSGLRGAVSF 144

Query: 135 TSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEI 194
             +    ++  + E       V     E+    +     LT+RE  CL     G TS EI
Sbjct: 145 AGDREPFSSAEMRELCYIAIHVFDRLAEIRNLDTRMTDTLTDREIDCLNWTAAGKTSAEI 204

Query: 195 AEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           AE L LS HTVN YL  AT KLD VNR QA+AKA+R G I
Sbjct: 205 AEILTLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGLI 244


>gi|66277256|gb|AAY44559.1| LuxR-like protein [Aeromonas caviae]
          Length = 260

 Score =  158 bits (400), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 48/211 (22%), Positives = 83/211 (39%), Gaps = 9/211 (4%)

Query: 32  NFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQS 91
            +  Y     L    ++  +   +           +      D  +       LPI W  
Sbjct: 34  GYDYYRFALILPMSMQRPKVVLFNQCPDSWVQAYTLNNMLACDPIIQLARRQTLPIYWNR 93

Query: 92  IQE-ETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIE-- 148
           + E    ++      + L        GI+FP+     +NG + F +     ++++++E  
Sbjct: 94  LDEKARFLQEGSMDVMGLAAEFGLRNGISFPLHGAAGENGILSFIT-RERASSDLMLESS 152

Query: 149 --AHGACYQVITDFLELFK---KRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVH 203
                    +    + + +   +       LTERET CL  A +G TS EIA  LG++  
Sbjct: 153 PILSWMSNYIFEAAIRIVRQSMREDDPQEPLTERETECLFWASEGKTSGEIACILGITER 212

Query: 204 TVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 213 TVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|241203295|ref|YP_002974391.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857185|gb|ACS54852.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 244

 Score =  158 bits (400), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 51/220 (23%), Positives = 82/220 (37%), Gaps = 3/220 (1%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++   +  +    ++R F +  +     F  +      + ++  +   + +         
Sbjct: 26  DIFRFMKRVTEAYRSRAFMVLNLPPITSFDLQGS--TVITSWPAELLALYDQEGLMVNSP 83

Query: 76  FLFHFNSGLLPIIWQSIQE-ETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
            L    +   P  +   ++  +  +    L   L           FP        G + F
Sbjct: 84  VLRRLRTSARPFFYDMSRQNLSRDDGKSILVASLFERFKMMRCAYFPTHEPSGLRGAISF 143

Query: 135 TSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEI 194
             +    +   + E       +     E+    +     LT+RE  CL     G TS EI
Sbjct: 144 AGDREPFSPAEMRELCYISIHIFDRLAEIRNLDTRMTDTLTDREIDCLNWTAAGKTSAEI 203

Query: 195 AEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           AE L LS HTVN YL  AT KLD VNR QA+AKA+R G I
Sbjct: 204 AEILTLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGLI 243


>gi|16760896|ref|NP_456513.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|29141412|ref|NP_804754.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|213053513|ref|ZP_03346391.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhi str. E00-7866]
 gi|213426356|ref|ZP_03359106.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
 gi|213616131|ref|ZP_03371957.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-2068]
 gi|213650336|ref|ZP_03380389.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhi str. J185]
 gi|289824072|ref|ZP_06543670.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-3139]
 gi|25302436|pir||AH0749 cell-division regulatory protein STY2158 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16503193|emb|CAD05699.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29137039|gb|AAO68603.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
          Length = 240

 Score =  158 bits (400), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 43/235 (18%), Positives = 77/235 (32%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++ ++ +++   L     R++   F  Y +      P  +  I     Y       
Sbjct: 14  LLRFQEMAAAEDVYTELQYQTQRLE---FDYYALCVRHPVPFTRPKISLRTTYPQAWVTH 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     + W  +          Q             G+   V L
Sbjct: 71  YQSENYFAIDPVLKPENFRQGHLHWDDVLFH-----EAQAMWDAAQRFGLRRGVTQCVML 125

Query: 125 GFHKNGYVIFTSEFLMLAN----EVIIEAHGACYQVITDFLELFKK-RSSAARNLTERET 179
                G++ F+   L  ++    EV +       + ++    L      +     ++RE 
Sbjct: 126 PNRALGFLSFSRSSLRCSSFTYDEVELRLQLLARESLSALTRLEDDMVMAPEMRFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K +A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|83859373|ref|ZP_00952894.1| Transcriptional regulatory protein, LuxR family protein
           [Oceanicaulis alexandrii HTCC2633]
 gi|83852820|gb|EAP90673.1| Transcriptional regulatory protein, LuxR family protein
           [Oceanicaulis alexandrii HTCC2633]
          Length = 241

 Score =  158 bits (399), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 52/226 (23%), Positives = 79/226 (34%), Gaps = 3/226 (1%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           S S + L               F    + S  D         E + +     D+      
Sbjct: 15  SDSNEALCHAFKAFVETFGVEAFGYQVLPSPFDAADT-SFDFEYNTFPEAMQDVYFEERL 73

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
              D       + L P  W  +++ T      Q    L        G   PV   +    
Sbjct: 74  YDHDPVTSRAATALQPQFWFDVEQTTPGTRFSQRLFELLRQSGFVDGFTIPVFGPYGLAA 133

Query: 131 YVIFTSEFLM--LANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDG 188
           +V          L    +      C ++ +  + L    + A  +L+ERE   LQ    G
Sbjct: 134 FVACGRFSGAFNLTAIQLRMLQLGCQELYSRTIMLRDYDAPAPPHLSEREVEILQWLARG 193

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            ++  IA  LG+S HTV+  +  A VKL+A NRI A+ KA+R G I
Sbjct: 194 KSNAVIAAILGVSPHTVDTIMRRAFVKLNASNRIAAVLKALRVGLI 239


>gi|166850622|gb|ABY91283.1| transcriptional regulator [Mesorhizobium huakuii]
          Length = 243

 Score =  158 bits (399), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 52/230 (22%), Positives = 90/230 (39%), Gaps = 2/230 (0%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
             + + +   +  +L  I +          T+        +Q+    L ++ ++  +   
Sbjct: 13  QLQHAGTAAAVCEKLLGITSDFGLTALMAGTVPQPGTPSGQQKQHVLLCDWPVEWLERYV 72

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                  D  + H      P  W+   +    + S    +   G      G+AFP+    
Sbjct: 73  ARNYVDHDPVVSHMKQLQAPFQWREAAQGISFDKSSDEVMGDAGAFKLRDGLAFPLITLD 132

Query: 127 HKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAAR--NLTERETSCLQL 184
            +   V    E + L+              +   +++    +S      LT RE  CLQ 
Sbjct: 133 GQIVMVSLGGEAVQLSGAEFGLVSLVSTYAVGRAMQIHTMATSTIDHIELTPRERECLQW 192

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           A  G +  EI++ LG+S HT   +L +A  KL AVNR+QA+A+AIR GYI
Sbjct: 193 AAVGKSEWEISQILGISEHTSEKHLLNAKSKLGAVNRVQAVAEAIRRGYI 242


>gi|14627170|gb|AAK50054.2|AF364058_1 transcriptional activator [Burkholderia multivorans ATCC 17616]
          Length = 239

 Score =  158 bits (399), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 41/229 (17%), Positives = 66/229 (28%), Gaps = 11/229 (4%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           S+ ++       I    K   F        +  P  +  +     Y              
Sbjct: 13  SAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFDTYPDGWMAHYQAQNYI 72

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  +         I+W  + +            R         G+A          G 
Sbjct: 73  EIDSTVRDGALSTNMIVWPDVDKIEPC-----PLWRDARDFGLSVGVAQSSWAARGAFGL 127

Query: 132 VIFTSEFLMLANEVIIEA----HGACYQVITDFLELFKKRSSAARN--LTERETSCLQLA 185
           +        L    I       +       +        + S      LT RE   L   
Sbjct: 128 LSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPETRVALTAREREVLCWT 187

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 188 AEGKTACEIGQILCISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|59940117|gb|AAX12597.1| LuxR-type transcriptional regulator [Aeromonas media]
          Length = 260

 Score =  158 bits (399), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 47/211 (22%), Positives = 84/211 (39%), Gaps = 9/211 (4%)

Query: 32  NFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQS 91
            +  Y     L    ++  +   +           +      D  +    +  LPI W  
Sbjct: 34  GYDYYRFALILPMSMQRPKVVLFNQCPDSWVQAYTVNNMLACDPIIQLARTQTLPIYWNR 93

Query: 92  IQE-ETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIE-- 148
           + E    ++      + L        GI+FP+     +NG + F +     ++++++E  
Sbjct: 94  LDEKARFLQEGSMDVMGLAAEFGLRNGISFPLHGATGENGILSFIT-RERASSDLLLESS 152

Query: 149 --AHGACYQVITDFLELFK---KRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVH 203
                    +    + + +   +       LT+RET CL  A +G TS EIA  LG++  
Sbjct: 153 PILSWMSNYIFEAAIRIVRQSMREEDPQEALTDRETECLFWASEGKTSGEIACILGITER 212

Query: 204 TVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 213 TVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|221196069|ref|ZP_03569116.1| N-acyl homoserine lactone transcriptional regulator [Burkholderia
           multivorans CGD2M]
 gi|221202743|ref|ZP_03575762.1| N-acyl homoserine lactone transcriptional regulator [Burkholderia
           multivorans CGD2]
 gi|221176677|gb|EEE09105.1| N-acyl homoserine lactone transcriptional regulator [Burkholderia
           multivorans CGD2]
 gi|221182623|gb|EEE15023.1| N-acyl homoserine lactone transcriptional regulator [Burkholderia
           multivorans CGD2M]
          Length = 239

 Score =  158 bits (399), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 41/229 (17%), Positives = 66/229 (28%), Gaps = 11/229 (4%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           S+ ++       I    K   F        +  P  +  +     Y              
Sbjct: 13  SAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFDTYPDGWMAHYQAQNYI 72

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  +         I+W  + +            R         G+A          G 
Sbjct: 73  EIDSTVRDGTLSTNMIVWPDVDKIEPC-----PLWRDARDFGLSVGVAQSSWAARGAFGL 127

Query: 132 VIFTSEFLMLANEVIIEA----HGACYQVITDFLELFKKRSSAARN--LTERETSCLQLA 185
           +        L    I       +       +        + S      LT RE   L   
Sbjct: 128 LSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPEARVTLTAREREVLCWT 187

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 188 AEGKTACEIGQILSISERTVNFHVNNILEKLGASNKVQAVVKAISAGLI 236


>gi|161613489|ref|YP_001587454.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|168244797|ref|ZP_02669729.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168462512|ref|ZP_02696443.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|168822990|ref|ZP_02834990.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194445102|ref|YP_002041215.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194448751|ref|YP_002046001.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|197250905|ref|YP_002146073.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|204931037|ref|ZP_03221863.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|207856536|ref|YP_002243187.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|238912477|ref|ZP_04656314.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
 gi|161362853|gb|ABX66621.1| hypothetical protein SPAB_01206 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403765|gb|ACF63987.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194407055|gb|ACF67274.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|195634505|gb|EDX52857.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197214608|gb|ACH52005.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|204320081|gb|EDZ05286.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205336361|gb|EDZ23125.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205340659|gb|EDZ27423.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|206708339|emb|CAR32642.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|320085432|emb|CBY95213.1| Regulatory protein sdiA [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
          Length = 240

 Score =  158 bits (399), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 76/235 (32%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++ ++ +++   L     R++   F  Y +      P  +  I     Y       
Sbjct: 14  LLRFQEMAAAEDVYTELQYQTQRLE---FDYYALCVRHPVPFTRPKISLRTTYPPAWVTH 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     + W  +          Q             G+   V L
Sbjct: 71  YQSENYFAIDPVLKPENFRQGHLHWDDVLFH-----EAQAMWDAAQRFGLRRGVTQCVML 125

Query: 125 GFHKNGYVIFTSEFLMLAN----EVIIEAHGACYQVITDFLELFKK-RSSAARNLTERET 179
                G++ F+   L  ++    EV +       + ++           +     ++RE 
Sbjct: 126 PNRALGFLSFSRSSLRCSSFTYDEVELRLQLLARESLSALTRFEDDMVMAPEMRFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K +A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|261340314|ref|ZP_05968172.1| regulatory protein SdiA [Enterobacter cancerogenus ATCC 35316]
 gi|288317405|gb|EFC56343.1| regulatory protein SdiA [Enterobacter cancerogenus ATCC 35316]
          Length = 240

 Score =  158 bits (399), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 75/235 (31%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++ +   E+      +Q + +A  F  +++      P  +  I    +Y       
Sbjct: 14  FLRFQELTCADEVY---QELQQQTQALEFDYFSLCVRHPVPFTRPKISVHSSYPDRWMAQ 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L          I   +     + +  Q             GI   + L
Sbjct: 71  YKSENYFAVDPVLK-----PENFIQGHLPWTDELFADAQELWGGAQDHGIRKGITQCLML 125

Query: 125 GFHKNGYVIFTSEFLMLAN----EVIIEAHGACYQVITDFLELF-KKRSSAARNLTERET 179
             H  G++  +   L        E+ +         +T  L    +         ++RE 
Sbjct: 126 PNHALGFLSVSRTSLRENAIHHEEIELRLQMLVQMALTSLLRFEHETVMPPEMKFSKRER 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K +A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSAEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|59940111|gb|AAX12594.1| LuxR-type transcriptional regulator [Aeromonas veronii bv. sobria]
          Length = 260

 Score =  158 bits (399), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 88/231 (38%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI   +    +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRSLPGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|296101736|ref|YP_003611882.1| DNA-binding transcriptional activator SdiA [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
 gi|295056195|gb|ADF60933.1| DNA-binding transcriptional activator SdiA [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
          Length = 240

 Score =  157 bits (398), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 74/235 (31%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  +  +S  E+      +Q + +A  F  Y +      P  +  I     Y       
Sbjct: 14  FLRFQALTSASEVY---QELQRQTQALEFDYYALCLRHPVPFTRPRISVHATYPQRWMAQ 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L          I   +     + +  +             GI   + L
Sbjct: 71  YQSENYFAIDPVLK-----PENFIQGHLPWTDELFADAEALWNGARDHGLRKGITQCLML 125

Query: 125 GFHKNGYVIFT----SEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
             H  G++  +        + + E+ +         +T  L    +         ++RE 
Sbjct: 126 PNHALGFLSVSCTSVQAGAVTSEELELRLQMLLQMALTSLLRFEDEMVMPPEMKFSKRER 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K +A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSAEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|161520519|ref|YP_001583946.1| LuxR family transcriptional regulator [Burkholderia multivorans
           ATCC 17616]
 gi|189353291|ref|YP_001948918.1| LuxR family transcriptional regulator [Burkholderia multivorans
           ATCC 17616]
 gi|221209754|ref|ZP_03582735.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           multivorans CGD1]
 gi|160344569|gb|ABX17654.1| transcriptional regulator, LuxR family [Burkholderia multivorans
           ATCC 17616]
 gi|189337313|dbj|BAG46382.1| LuxR family transcriptional regulator [Burkholderia multivorans
           ATCC 17616]
 gi|221170442|gb|EEE02908.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           multivorans CGD1]
          Length = 239

 Score =  157 bits (398), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 41/229 (17%), Positives = 66/229 (28%), Gaps = 11/229 (4%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           S+ ++       I    K   F        +  P  +  +     Y              
Sbjct: 13  SAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFDTYPDGWMAHYQAQNYI 72

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  +         I+W  + +            R         G+A          G 
Sbjct: 73  EIDSTVRDGALSTNMIVWPDVDKIEPC-----PLWRDARDFGLSVGVAQSSWAARGAFGL 127

Query: 132 VIFTSEFLMLANEVIIEA----HGACYQVITDFLELFKKRSSAARN--LTERETSCLQLA 185
           +        L    I       +       +        + S      LT RE   L   
Sbjct: 128 LSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPEARVALTAREREVLCWT 187

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 188 AEGKTACEIGQILCISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|59940043|gb|AAX12560.1| LuxR-type transcriptional regulator [Aeromonas sobria]
          Length = 258

 Score =  157 bits (398), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 52/243 (21%), Positives = 96/243 (39%), Gaps = 11/243 (4%)

Query: 1   MSENTL--TGKKSSSLQELSPRLHLIQNRIKAR-NFALYTINSALDFPRRQQLICELHNY 57
           M ++ L    +  +++ +   RL  +  R      +  Y     +    ++  +   +  
Sbjct: 1   MKQDELFEYLEHLTTVTD-GDRLAGLIGRFTVDMGYDYYGFTLIIPMSMQRPKVVLFNQC 59

Query: 58  DLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEE-TVIESSGQLSVRLEGGLLPFA 116
            +              D  +       LPI W  + E  + ++      + L        
Sbjct: 60  PVSWVQTYTDNNMLACDPVIQLARKQTLPIYWNRLDERASFLQEGTMDVMGLAAEFGLRN 119

Query: 117 GIAFPVRLGFHKNGYVIFTSEFLMLANEVIIE----AHGACYQVITDFLEL-FKKRSSAA 171
           GI+FP+     + G + F +     ++++++E           +    + +   + S   
Sbjct: 120 GISFPLHGAAGETGILSFITSER-ASSDLLLESSPILSWMANYIFEAAIRVVRLRDSDQH 178

Query: 172 RNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRF 231
             LT+RET CL  A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK I  
Sbjct: 179 AALTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISS 238

Query: 232 GYI 234
           G +
Sbjct: 239 GIL 241


>gi|172063602|ref|YP_001811253.1| LuxR family transcriptional regulator [Burkholderia ambifaria
           MC40-6]
 gi|171996119|gb|ACB67037.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           MC40-6]
          Length = 239

 Score =  157 bits (398), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 40/232 (17%), Positives = 69/232 (29%), Gaps = 11/232 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++ S+ ++       I    K   F        +  P  +  +   + Y           
Sbjct: 10  QQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFNTYPDGWMARYQAQ 69

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +         I+W  +              +         G+A         
Sbjct: 70  NYIEIDSTVRDGALSTNMIVWPDVDRIDPC-----PLWQDARDYGLSVGVAQSSWAARGA 124

Query: 129 NGYVIFTSEFLMLANEVIIEA----HGACYQVITDFLELFKKRSSAARN--LTERETSCL 182
            G +        L    I       +       +        + S   +  LT RE   L
Sbjct: 125 FGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPESSVTLTAREREVL 184

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               +G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 185 CWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAIGAGLI 236


>gi|59940089|gb|AAX12583.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
          Length = 260

 Score =  157 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTPGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPVLSWMSNYIFEATIRIVRVSLRDDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|167572684|ref|ZP_02365558.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia oklahomensis C6786]
          Length = 239

 Score =  157 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 73/238 (30%), Gaps = 14/238 (5%)

Query: 3   ENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSG 62
           +  L    + + Q+L  ++     R+    F        +  P  +  +     Y     
Sbjct: 7   DAYLQFSAAENEQQLFRQIAAYSKRL---GFEYCCYGIRVPLPISKPAVAIFDTYPNGWM 63

Query: 63  DIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPV 122
           +    +     D  +         I+W                           G+A   
Sbjct: 64  ERYQEMNYLEVDPTVRDGALSTNMIVWPEASRSDGTT-----LWNDARDHGLAVGVAQSS 118

Query: 123 RLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKK------RSSAARNLTE 176
                  G +        L +  I +       +      L  +         +   LT 
Sbjct: 119 WAPRGVFGLLTIARHTDRLTSAEINQLTLQANWLANMSHSLMSRFLVPKLAPESGVALTH 178

Query: 177 RETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           RE   L   G+G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 179 REREVLCWTGEGKTACEIGQILSISERTVNFHVNNILDKLGATNKVQAVVKAIAMGLI 236


>gi|56413135|ref|YP_150210.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|197362061|ref|YP_002141698.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|56127392|gb|AAV76898.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197093538|emb|CAR59000.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
          Length = 240

 Score =  157 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 76/235 (32%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++ ++ +++   L     R++   F  Y +      P  +  I     Y       
Sbjct: 14  LLRFQEMAAAEDVYTELQYQTQRLE---FDYYALCVRHPVPFTRPKISLRTTYPQAWVTH 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     + W  +          Q             G+   V L
Sbjct: 71  YQSENYFAIDPVLKPENFRQGHLHWDDVLFH-----EAQAMWDAAQRFGLRRGVTQCVML 125

Query: 125 GFHKNGYVIFTSEFLMLAN----EVIIEAHGACYQVITDFLELFKK-RSSAARNLTERET 179
                G++ F+   L  ++    EV +       + ++           +     ++RE 
Sbjct: 126 PNRALGFLSFSRSSLRCSSFTYDEVELRLQLLARESLSALTRFEDDMVMAPEMRFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K +A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|121663600|emb|CAM12358.1| quorum sensing LuxR family sensor regulator [Burkholderia glumae]
          Length = 239

 Score =  157 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 44/229 (19%), Positives = 70/229 (30%), Gaps = 11/229 (4%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           ++ +      H +    K   F        +  P  Q L+     Y              
Sbjct: 13  NTAENEQQLFHQVSAYSKRLGFEYCCYGIRVPQPGSQPLVEIFDTYPPGWMAHYQARNYI 72

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  +    +    IIW                 R         G+A          G 
Sbjct: 73  EIDPTVRDGAASPNMIIWPDADAAEQPS-----LWRDARDFGMSVGVAQSSWAARGVFGL 127

Query: 132 VIFTSEFLMLANEVIIEAHGACYQVITDFLELFKK------RSSAARNLTERETSCLQLA 185
           +        L    I         +      L  +        +A+ +LT+RE   L   
Sbjct: 128 LTIARRSDRLTPAEINSLTLQANWLANLSHSLMGRFLVPKLSPAASISLTKREREVLSWT 187

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +G T+ EI E+L +S  TV  ++ +   KL A N++QA+ KAI  G I
Sbjct: 188 SEGRTASEIGEQLNISERTVTFHINNILAKLGAANKVQAVVKAIGMGLI 236


>gi|16765288|ref|NP_460903.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|167993519|ref|ZP_02574613.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|2992525|gb|AAC08299.1| SdiA [Salmonella enterica subsp. enterica serovar Typhimurium]
 gi|16420484|gb|AAL20862.1| transcriptional regulator of ftsQAZ gene cluster [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|205328435|gb|EDZ15199.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|261247116|emb|CBG24939.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267993936|gb|ACY88821.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301158464|emb|CBW17974.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312912940|dbj|BAJ36914.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhimurium str. T000240]
 gi|321224593|gb|EFX49656.1| N-3-oxohexanoyl-L-homoserine lactone quorum-sensing transcriptional
           activator [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|323130228|gb|ADX17658.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
 gi|332988839|gb|AEF07822.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 240

 Score =  157 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 41/235 (17%), Positives = 76/235 (32%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++ ++ +++   L     R++   F  Y +      P  +  I     Y       
Sbjct: 14  LLRFQEMAAAEDVYTELQYQTQRLE---FDYYALCVRHPVPFTRPKISLRTTYPPAWVTH 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     + W  +          +             G+   V L
Sbjct: 71  YQSENYFAIDPVLKPENFRQGHLHWDDVLFH-----EAKAMWDAAQRFGLRRGVTQCVML 125

Query: 125 GFHKNGYVIFTSEFLMLAN----EVIIEAHGACYQVITDFLELFKK-RSSAARNLTERET 179
                G++ F+   L  ++    EV +       + ++           +     ++RE 
Sbjct: 126 PNRALGFLSFSRSSLRCSSFTYDEVELRLQLLARESLSALTRFEDDMVMAPEMRFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K +A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|260551305|ref|ZP_05825506.1| transcriptional activator protein phzR [Acinetobacter sp. RUH2624]
 gi|260405619|gb|EEW99110.1| transcriptional activator protein phzR [Acinetobacter sp. RUH2624]
          Length = 238

 Score =  157 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 44/227 (19%), Positives = 74/227 (32%), Gaps = 14/227 (6%)

Query: 15  QELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGD 74
            EL   +    +++    F              +     L+NY                D
Sbjct: 19  DELFEVVKSTASKL---GFDYCAYGMQSPLSIAEPKTIMLNNYPQAWQKRYIEQRYVKVD 75

Query: 75  DFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
             + H    L P++W S   +       +             G A   R      G +  
Sbjct: 76  PTVQHCMVSLQPLVWSS---QNAKTQEEKDFWEEARSYGLNVGWAQSSRDFIGTRGMLTL 132

Query: 135 TSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARN-------LTERETSCLQLAGD 187
                 L+ E   +A       +T  L     +             LT RE   L+   +
Sbjct: 133 ARSTDQLS-EKEQKAQYTNMYWLTQTLHSSIAKIVNDVEFSQFNLYLTNREKEALRWTAE 191

Query: 188 GYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           G TS EIA+ +G++  TVN +L ++  KL+  N+I A  +A+  G +
Sbjct: 192 GKTSAEIAQIIGVTERTVNFHLCNSMQKLNVNNKISAAIRAVMLGLL 238


>gi|170700319|ref|ZP_02891331.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           IOP40-10]
 gi|170134753|gb|EDT03069.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           IOP40-10]
          Length = 239

 Score =  157 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 41/232 (17%), Positives = 69/232 (29%), Gaps = 11/232 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++ S+ ++       I    K   F        +  P  +  +   + Y           
Sbjct: 10  QQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFNTYPDGWMARYQAQ 69

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +         I+W  I              +         G+A         
Sbjct: 70  NYIEIDSTVRDGALSTNMIVWPDIDRIDPC-----PLWQDARDYGLSVGVAQSSWAARGA 124

Query: 129 NGYVIFTSEFLMLANEVIIEA----HGACYQVITDFLELFKKRSSAARN--LTERETSCL 182
            G +        L    I       +       +        + S   +  LT RE   L
Sbjct: 125 FGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPESSVTLTAREREVL 184

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               +G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 185 CWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAIGAGLI 236


>gi|126740492|ref|ZP_01756179.1| autoinducer-binding transcriptional regulator LuxR [Roseobacter sp.
           SK209-2-6]
 gi|126718293|gb|EBA15008.1| autoinducer-binding transcriptional regulator LuxR [Roseobacter sp.
           SK209-2-6]
          Length = 239

 Score =  157 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 44/229 (19%), Positives = 71/229 (31%), Gaps = 17/229 (7%)

Query: 13  SLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETY 72
           SL  L   +  +       +   + ++SA D             Y               
Sbjct: 19  SLDGLQSIIEEVCQAFGVDDAMYHWVDSAGDQ-------YGCGTYKQAWIQRYLDKGYVR 71

Query: 73  GDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLP-FAGIAFPVRLGFHKNGY 131
            D  +        P+ W+ +          +              G + P+R    +   
Sbjct: 72  SDPVIAGCYQRFHPVDWRRLDW---TTRQAKEFRSDAQNYGVGNQGYSVPIRGPNGQFAL 128

Query: 132 VIFTSEFLMLANEVIIE-----AHGACYQVITDFLELFKKRSSAA-RNLTERETSCLQLA 185
              +        +  I+          +      LE   KR       L+ RE   L L 
Sbjct: 129 FTVSHSCNDANWDEFIDTFSQELILVGHYFNRKALEFEPKRKPEHTPPLSPREMDALTLL 188

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             GY   ++A+ L +S HT+  Y+ SA  KL A+N   AIA+AI  G I
Sbjct: 189 AIGYNRAQVAKTLSISEHTLRVYIESARFKLGALNTTHAIARAISCGLI 237


>gi|59940033|gb|AAX12555.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
          Length = 260

 Score =  157 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 50/244 (20%), Positives = 92/244 (37%), Gaps = 11/244 (4%)

Query: 1   MSENTLT--GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYD 58
           M ++ L    +  +++ +      LI        +  Y     +    ++  +   +   
Sbjct: 1   MKQDQLLEYLEHLTTVTDEDRLAELISRFTLGMGYDYYRFAVIIPMSMQRPKVVLFNQCP 60

Query: 59  LDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAG 117
                          D  +       LPI W  + E    ++      + L        G
Sbjct: 61  DSWVQAYTANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNG 120

Query: 118 IAFPVRLGFHKNGYVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSA 170
           I+FP+     +NG + F +     ++++++E           +       + +  +    
Sbjct: 121 ISFPLHGAAGENGILSFITAER-ASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDP 179

Query: 171 ARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIR 230
              LT+RET CL  A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK + 
Sbjct: 180 QEALTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVS 239

Query: 231 FGYI 234
            G +
Sbjct: 240 SGIL 243


>gi|78061902|ref|YP_371810.1| LuxR family transcriptional regulator [Burkholderia sp. 383]
 gi|77969787|gb|ABB11166.1| transcriptional regulator, LuxR family [Burkholderia sp. 383]
          Length = 239

 Score =  157 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 40/232 (17%), Positives = 69/232 (29%), Gaps = 11/232 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++ S+ ++       I    K   F        +  P  +  +   + Y           
Sbjct: 10  QQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFNTYPDGWMAHYQAQ 69

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +         I+W  +              +         G+A         
Sbjct: 70  NYIEIDSTVRDGALSTNMIVWPDVDRIEPC-----PLWQDARDYGLSVGVAQSSWAARGA 124

Query: 129 NGYVIFTSEFLMLANEVIIEA----HGACYQVITDFLELFKKRSSAARN--LTERETSCL 182
            G +        L    I       +       +        + + A    LT RE   L
Sbjct: 125 FGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFVVPKLAPAAGVTLTAREREVL 184

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               +G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 185 CWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|206563716|ref|YP_002234479.1| N-acylhomoserine lactone dependent regulatory protein CepR
           [Burkholderia cenocepacia J2315]
 gi|198039756|emb|CAR55726.1| N-acylhomoserine lactone dependent regulatory protein CepR
           [Burkholderia cenocepacia J2315]
          Length = 239

 Score =  157 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 41/232 (17%), Positives = 68/232 (29%), Gaps = 11/232 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++ S+ ++       I    K   F        +  P  +  +     Y           
Sbjct: 10  QQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFDTYPDGWMAHYQAQ 69

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +         I+W  +              +         G+A         
Sbjct: 70  NYIEIDSTVRDGALNTNMIVWPDVDRIDPC-----PLWQDARDFGLSVGVAQSSWAARGA 124

Query: 129 NGYVIFTSEFLMLANEVIIEA----HGACYQVITDFLELFKKRSSAARN--LTERETSCL 182
            G +        L    I       +       +        + S A    LT RE   L
Sbjct: 125 FGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPAAGVTLTAREREVL 184

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               +G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 185 CWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|168239186|ref|ZP_02664244.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|194735895|ref|YP_002114983.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|198243442|ref|YP_002215136.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|194711397|gb|ACF90618.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197288026|gb|EDY27413.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197937958|gb|ACH75291.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|322616943|gb|EFY13851.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315996572]
 gi|322618183|gb|EFY15075.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-1]
 gi|322625853|gb|EFY22672.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-3]
 gi|322626305|gb|EFY23115.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-4]
 gi|322632720|gb|EFY29465.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-1]
 gi|322639062|gb|EFY35755.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-2]
 gi|322640503|gb|EFY37156.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322645988|gb|EFY42505.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322649891|gb|EFY46312.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. OH_2009072675]
 gi|322655499|gb|EFY51807.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322660277|gb|EFY56515.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|322662958|gb|EFY59165.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 81038-01]
 gi|322668143|gb|EFY64302.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674097|gb|EFY70191.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 414877]
 gi|322675550|gb|EFY71624.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 366867]
 gi|322683038|gb|EFY79054.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 413180]
 gi|322686732|gb|EFY82710.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 446600]
 gi|323195379|gb|EFZ80559.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609458-1]
 gi|323199270|gb|EFZ84365.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556150-1]
 gi|323204435|gb|EFZ89441.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609460]
 gi|323207525|gb|EFZ92473.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 507440-20]
 gi|323211850|gb|EFZ96681.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556152]
 gi|323217510|gb|EGA02229.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB101509-0077]
 gi|323219586|gb|EGA04070.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB102109-0047]
 gi|323223588|gb|EGA07903.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB110209-0055]
 gi|323231532|gb|EGA15645.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB111609-0052]
 gi|323235975|gb|EGA20054.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009083312]
 gi|323240545|gb|EGA24588.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009085258]
 gi|323245437|gb|EGA29437.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315731156]
 gi|323250207|gb|EGA34099.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2009159199]
 gi|323253982|gb|EGA37806.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008282]
 gi|323255491|gb|EGA39252.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008283]
 gi|323262088|gb|EGA45651.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008284]
 gi|323266211|gb|EGA49701.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008285]
 gi|323270680|gb|EGA54121.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008287]
 gi|326622885|gb|EGE29230.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 240

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 76/235 (32%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++ ++ +++   L     R++   F  Y +      P  +  I     Y       
Sbjct: 14  LLRFQEMAAAEDVYTELQYQTQRLE---FDYYALCVRHPVPFTRPKISLRTTYPPAWVTH 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     + W  +          Q             G+   V L
Sbjct: 71  YQSENYFAIDPVLKPENFRQGHLHWDDMLFH-----EAQAMWDAAQRFGLRRGVTQCVML 125

Query: 125 GFHKNGYVIFTSEFLMLAN----EVIIEAHGACYQVITDFLELFKK-RSSAARNLTERET 179
                G++ F+   L  ++    EV +       + ++           +     ++RE 
Sbjct: 126 PNRALGFLSFSRSSLRCSSFTYDEVELRLQLLARESLSALTRFEDDMVMAPEMRFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K +A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|59940119|gb|AAX12598.1| LuxR-type transcriptional regulator [Aeromonas veronii]
          Length = 258

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 52/230 (22%), Positives = 91/230 (39%), Gaps = 9/230 (3%)

Query: 12  SSLQELSPRLHLIQNRIKAR-NFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           +S+ +   RL  +  R      +  Y     +    ++  +   +   +           
Sbjct: 14  TSVTD-GDRLAGLIGRFTVDMGYDYYGFTLIIPMSMQRPKVVLFNQCPISWVQTYTDNNM 72

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
              D  +       LPI W  + E    ++      + L        GI+FP+     +N
Sbjct: 73  LACDPVIQLARKQTLPIYWNRLDERARFLQEGSMDVMGLAAEFGLRNGISFPLHGAAGEN 132

Query: 130 GYVIFTSEFLMLANEVIIE----AHGACYQVITDFLEL-FKKRSSAARNLTERETSCLQL 184
           G + F +     ++++++E           +    + +   + S     LT+RET CL  
Sbjct: 133 GILSFITSER-ASSDLLLESSPILSWMANYIFEAAIRVVRLRDSDQQAALTDRETECLFW 191

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK I  G +
Sbjct: 192 ASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGIL 241


>gi|59940109|gb|AAX12593.1| LuxR-type transcriptional regulator [Aeromonas sp. AN-46]
          Length = 260

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTPGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|66736599|gb|AAY54303.1| quorum sensing trancriptional regulator [Aeromonas veronii]
          Length = 258

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 52/230 (22%), Positives = 91/230 (39%), Gaps = 9/230 (3%)

Query: 12  SSLQELSPRLHLIQNRIKAR-NFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           +S+ +   RL  +  R      +  Y     +    ++  +   +   +           
Sbjct: 14  TSVTD-GDRLAGLIGRFTVDMGYDYYGFTLIIPMSMQRPKVVLFNQCPISWVQTYTDNNM 72

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
              D  +       LPI W  + E    ++      + L        GI+FP+     +N
Sbjct: 73  LACDPVIQLARKQTLPIYWNRLDERARFLQEGSMDVMGLAAEFGLRNGISFPLHGAAGEN 132

Query: 130 GYVIFTSEFLMLANEVIIE----AHGACYQVITDFLEL-FKKRSSAARNLTERETSCLQL 184
           G + F +     ++++++E           +    + +   + S     LT+RET CL  
Sbjct: 133 GILSFITSER-ASSDLLLESSPILSWMANYIFEAAIRVVRLRDSDQQAALTDRETECLFW 191

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK I  G +
Sbjct: 192 ASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGIL 241


>gi|12620905|gb|AAG61132.1|AF330021_1 AHL receptor [Burkholderia stabilis]
          Length = 239

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 41/232 (17%), Positives = 68/232 (29%), Gaps = 11/232 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++ S+ ++       I    K   F        +  P  +  +     Y           
Sbjct: 10  QQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPSVAIFDTYPDGWMARYQAQ 69

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +         I+W  +              +         G+A         
Sbjct: 70  NYIEIDSTVRDGALSTNMIVWPDVDRSDP-----GPLWQDAREFGLSVGVAQSSWAARGA 124

Query: 129 NGYVIFTSEFLMLANEVIIEA----HGACYQVITDFLELFKKRSSAARN--LTERETSCL 182
            G +        L    I       +       +        + S A    LT RE   L
Sbjct: 125 FGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPAAGVTLTAREREVL 184

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               +G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 185 CWTAEGKTACEIGQILSISGRTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|255264823|ref|ZP_05344165.1| autoinducer-binding transcriptional regulator LuxR [Thalassiobium
           sp. R2A62]
 gi|255107158|gb|EET49832.1| autoinducer-binding transcriptional regulator LuxR [Thalassiobium
           sp. R2A62]
          Length = 258

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 43/233 (18%), Positives = 81/233 (34%), Gaps = 17/233 (7%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++++SL  L   +  +++  K  +   + ++S  +             YD          
Sbjct: 13  EQATSLNHLQDSISDLRDLYKIDHIVYHWVSSDGEQ-------YGCGTYDRSWVQRYVEQ 65

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +        P+ W+ +   +    +           +   G + P+R    +
Sbjct: 66  DYLRIDPVVVGCFQRFHPVDWKRLDWSSKAART--FQAEAIEAGVGIQGYSIPIRGPNGQ 123

Query: 129 NGYVIFTSEFLMLAN------EVIIEAHGACYQVITDFLELFKKRSS-AARNLTERETSC 181
                  S                 +     +      LE  K R   AA+ L+ RE   
Sbjct: 124 FALFS-ASHNCDDDWWANWTEANRRDLILIAHTFNQKGLEFEKNRVPEAAKGLSPREVDA 182

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +     GY+  ++A  L +S HT+ AY+ SA  KL A+N   A+A+A+  G I
Sbjct: 183 MTFLAMGYSRAQVANTLSISEHTLRAYIESARFKLGALNTTHAVARAMAHGLI 235


>gi|220920328|ref|YP_002495629.1| LuxR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219944934|gb|ACL55326.1| transcriptional regulator, LuxR family [Methylobacterium nodulans
           ORS 2060]
          Length = 246

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 47/225 (20%), Positives = 74/225 (32%), Gaps = 5/225 (2%)

Query: 11  SSSLQELSPRLHLIQN---RIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNI 67
             +L E+             I+   F  +TI        R       + +  D     + 
Sbjct: 16  IDALDEVRDPFEAQTRIFEHIQHVGFTSFTITRLPRPSDRLGPNMLFNMWPKDWLTHYDR 75

Query: 68  LIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
           +     D  +        P  W  +  +       +  +          G   PV     
Sbjct: 76  VGHYRFDPVVRQCYRTTEPFAWSEVPFDADQPDRARRVMDEAAAFGLGFGFCIPVHDALG 135

Query: 128 KNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLEL--FKKRSSAARNLTERETSCLQLA 185
             G V    E + L+ ++    H                ++RS   R L+ RE   L  A
Sbjct: 136 FQGGVSLAGERIDLSPKIRRGLHMLGLYAWGAATRTTEDRRRSEPGRLLSARERDVLSWA 195

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIR 230
             G T EEIA  LG+S  TV  +L SA +K+ A N  Q + +A+R
Sbjct: 196 AMGRTREEIATILGVSHETVATHLKSARIKIGARNTTQTVVEALR 240


>gi|15889561|ref|NP_355242.1| LuxR family transcriptional regulator [Agrobacterium tumefaciens
           str. C58]
 gi|15157444|gb|AAK88027.1| transcriptional regulator, LuxR family [Agrobacterium tumefaciens
           str. C58]
          Length = 238

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 55/227 (24%), Positives = 84/227 (37%), Gaps = 2/227 (0%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           +  S+  + S  L  +Q  + A  +A  T+           L   + +            
Sbjct: 12  RDLSAAADKSQWLEALQEVMHAFGYAHVTLLRLPGGQNAFALPLVVESSLPVWVVNAMTK 71

Query: 69  IETYGD-DFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
               GD   +    S ++P  W     E    S       + G +   +G+  PV     
Sbjct: 72  DGALGDCPVIKRGASSMMPQYWSLEDPEMACGSLVDAVNSV-GSMGITSGLMVPVNGMSG 130

Query: 128 KNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGD 187
               + F  +   L    + E        +  +  L +  S     LT+RE   ++    
Sbjct: 131 NRHLMNFAGDRDTLPQASLNELCMIALHALETYDRLCRVASKGPSPLTKRELDVVRWTAQ 190

Query: 188 GYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           G TS EIAE L +S HTVN Y+ +A  KLD VNR Q +AK IR   I
Sbjct: 191 GKTSVEIAELLSISEHTVNTYMNNAMRKLDCVNRTQLVAKTIRLRLI 237


>gi|238024809|ref|YP_002909041.1| AHL receptor [Burkholderia glumae BGR1]
 gi|55509000|gb|AAV52804.1| AHL receptor [Burkholderia glumae BGR1]
 gi|237879474|gb|ACR31806.1| AHL receptor [Burkholderia glumae BGR1]
          Length = 239

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 44/229 (19%), Positives = 70/229 (30%), Gaps = 11/229 (4%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           ++ +      H +    K   F        +  P  Q L+     Y              
Sbjct: 13  NTAENEQQLFHQVSAYSKRLGFEYCCYGIRVPQPGSQPLVEIFDTYPPGWMAHYQARNYI 72

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  +    +    IIW                 R         G+A          G 
Sbjct: 73  EIDPTVRDGAASPNMIIWPDADAAEQPS-----LWRDARDFGMSVGVAQSSWAARGVFGL 127

Query: 132 VIFTSEFLMLANEVIIEAHGACYQVITDFLELFKK------RSSAARNLTERETSCLQLA 185
           +        L    I         +      L  +        +A+ +LT+RE   L   
Sbjct: 128 LTIARRSDRLTPAEINSLTLQANWLANLSHSLMGRFLVPKLSPAASISLTKREREVLSWT 187

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +G T+ EI E+L +S  TV  ++ +   KL A N++QA+ KAI  G I
Sbjct: 188 SEGRTASEIGEQLNISERTVTFHINNILAKLGAANKVQAVVKAIGMGLI 236


>gi|75674825|ref|YP_317246.1| LuxR family transcriptional regulator [Nitrobacter winogradskyi
           Nb-255]
 gi|74419695|gb|ABA03894.1| Transcriptional regulatory protein, LuxR family [Nitrobacter
           winogradskyi Nb-255]
          Length = 241

 Score =  156 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 42/225 (18%), Positives = 76/225 (33%), Gaps = 2/225 (0%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
           K+S+  E++  +  +   +   +     I        +Q     LH +     +      
Sbjct: 18  KASTPAEIADAVVDVARPLGFSHVLAGIIPIPGMTAEQQISNVVLHRWPKAWSERYFTKG 77

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
             + D  +   N+   P +W  ++       +    +          G   P+     + 
Sbjct: 78  YLFDDPTIQRVNTSTEPFLWSELEPTYRNTPAPTRVMGEAREFNLGCGFTVPMITLNGQT 137

Query: 130 GYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGY 189
                 SE   + + +  +              L +K   A  NLT RE   LQ   +G 
Sbjct: 138 AGFSLASERAEVPSILRGQLQLIAMYAFAR--ALGQKYKPAPVNLTPREMDILQWMAEGK 195

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +  EI+  L +S H V+        KL+A NR Q +A A+R   I
Sbjct: 196 SDWEISVILKVSEHLVDKIARQLRAKLNATNRTQTVAVALRHNLI 240


>gi|218681045|ref|ZP_03528942.1| transcriptional regulator, LuxR family protein [Rhizobium etli CIAT
           894]
          Length = 244

 Score =  156 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 55/220 (25%), Positives = 82/220 (37%), Gaps = 3/220 (1%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++   L  +    ++R F +  +        +      + ++  +   + +         
Sbjct: 26  DIFRFLKRVTEAYRSRAFMVLNLPPITSLDIQGS--TVITSWPAELLALYDQEGLLVNSP 83

Query: 76  FLFHFNSGLLPIIWQ-SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
            L    +   P  +  S    +  +    L   L        G  FP        G V F
Sbjct: 84  VLRRLRTSARPFSYDMSRDNWSRDDGKSVLVTALFERFRMMRGAYFPTHEPSGLRGAVSF 143

Query: 135 TSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEI 194
           + +    +   + E       V     E+    +     LT+RE  CL     G TS EI
Sbjct: 144 SGDRETFSPAEMRELCYIAVHVYDRLAEIRNLDARITDTLTDREIDCLNWTAAGKTSAEI 203

Query: 195 AEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           AE L LS HTVN YL  AT KLD VNR QA+AKA+R G I
Sbjct: 204 AEILTLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGLI 243


>gi|59940065|gb|AAX12571.1| LuxR-type transcriptional regulator [Aeromonas veronii]
          Length = 258

 Score =  156 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 52/230 (22%), Positives = 91/230 (39%), Gaps = 9/230 (3%)

Query: 12  SSLQELSPRLHLIQNRIKAR-NFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           +S+ +   RL  +  R      +  Y     +    ++  +   +   +           
Sbjct: 14  TSVTD-GDRLAGLIGRFTVDMGYDYYGFTLIIPMSMQRPKVVLFNQCPISWVQTYTDNNM 72

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
              D  +       LPI W  + E    ++      + L        GI+FP+     +N
Sbjct: 73  LACDPVIQLARKQTLPIYWNRLDERARFLQEGSMDVMGLAAEFGLRNGISFPLHGAAGEN 132

Query: 130 GYVIFTSEFLMLANEVIIE----AHGACYQVITDFLEL-FKKRSSAARNLTERETSCLQL 184
           G + F +     ++++++E           +    + +   + S     LT+RET CL  
Sbjct: 133 GILSFITSER-ASSDLLLESSPILSWMANYIFEAAIRVVRLRDSDQQAALTDRETECLFW 191

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK I  G +
Sbjct: 192 ASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGIL 241


>gi|66277284|gb|AAY44573.1| LuxR-like protein [Aeromonas veronii bv. sobria]
          Length = 258

 Score =  156 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 52/230 (22%), Positives = 91/230 (39%), Gaps = 9/230 (3%)

Query: 12  SSLQELSPRLHLIQNRIKAR-NFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           +S+ +   RL  +  R      +  Y     +    ++  +   +   +           
Sbjct: 14  TSVTD-GDRLAGLIGRFTVDMGYDYYGFTLIIPMSMQRPKVVLFNQCPISWVQTYTDNNM 72

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
              D  +       LPI W  + E    ++      + L        GI+FP+     +N
Sbjct: 73  LACDPVIQLARKQTLPIYWNRLDERARFLQEGSMDVMGLAAEFGLRNGISFPLHGAAGEN 132

Query: 130 GYVIFTSEFLMLANEVIIE----AHGACYQVITDFLEL-FKKRSSAARNLTERETSCLQL 184
           G + F +     ++++++E           +    + +   + S     LT+RET CL  
Sbjct: 133 GILSFITSER-ASSDLLLESSPILSWMANYIFEAAIRVVRLRDSDQQAALTDRETECLFW 191

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK I  G +
Sbjct: 192 ASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGIL 241


>gi|134291839|ref|YP_001115608.1| LuxR family transcriptional regulator [Burkholderia vietnamiensis
           G4]
 gi|134135028|gb|ABO59353.1| transcriptional regulator, LuxR family [Burkholderia vietnamiensis
           G4]
          Length = 239

 Score =  156 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 42/234 (17%), Positives = 76/234 (32%), Gaps = 15/234 (6%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
           + +++ +  +       +   ++A  F  +     +  P  +    E +N+         
Sbjct: 11  SMEQAETASDAFD---GLAPAVRALGFEYHAYVLRVTIPITRPASMEWNNFPQAWRAHYA 67

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                + D  L +  +   P+ W          +      R         G +  +R   
Sbjct: 68  QKRYQHADPVLHYGQACTRPMPW------PGPLAGHDAFWRDAADFGLRHGWSQTLRDHR 121

Query: 127 HKNGYVIFTSEFLMLANEVII----EAHGACYQVITDF--LELFKKRSSAARNLTERETS 180
              G          ++ E +     E    C  V      L +     S A  L+ RE  
Sbjct: 122 GAMGTFSLVRGGPPISPEELRRTEPEMIWLCQFVHATMSNLIVSDVMPSGAMRLSLREKE 181

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            L    +G T+ E+A  L L+   V  ++ +A  KLDA N+  A  KA   G I
Sbjct: 182 VLHWTAEGKTAAEVAAILQLTERNVGFHIQNAMDKLDATNKTHATVKAAMLGLI 235


>gi|126725039|ref|ZP_01740882.1| autoinducer-binding transcriptional regulator LuxR [Rhodobacterales
           bacterium HTCC2150]
 gi|126706203|gb|EBA05293.1| autoinducer-binding transcriptional regulator LuxR [Rhodobacterales
           bacterium HTCC2150]
          Length = 226

 Score =  156 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 46/238 (19%), Positives = 86/238 (36%), Gaps = 27/238 (11%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           +++ +L +L   +  I++     +   +++ S  +          +  Y  +        
Sbjct: 2   QQAKTLDDLQNVILGIRDLYDVEHLVYHSVKSTGEQ-------YGVLTYTDEWTQHYVEQ 54

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESS------------GQLSVRLEGGLLPFA 116
                D  +        P+ W+ +   +                   LSV + G    FA
Sbjct: 55  NYERIDPVVLGCFQSFQPVTWKELDWSSKGSRRFLGEALDNGVGNQGLSVPIRGPAGQFA 114

Query: 117 GIAFPVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTE 176
              F V        +  FT+E      ++I+ AH    + +        K  S  + L+ 
Sbjct: 115 --LFTVNDNCKDGCWAKFTAEH---HRQMILIAHYLNNKALEIE---HGKLMSPVKALSP 166

Query: 177 RETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           RE+  L L   GY+    A+ L +S HT+  Y+ +A  KL + N   A+A A+  G I
Sbjct: 167 RESDSLTLLAMGYSRAHAADTLKISEHTLRVYIEAARFKLGSANTTHAVAAALSRGLI 224


>gi|167565578|ref|ZP_02358494.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia oklahomensis EO147]
          Length = 239

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 73/238 (30%), Gaps = 14/238 (5%)

Query: 3   ENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSG 62
           +  L    + + Q+L  ++     R+    F        +  P  +  +     Y     
Sbjct: 7   DAYLQFSAAENEQQLFRQIAAYSKRL---GFEYCCYGIRVPLPISKPAVAIFDTYPNGWM 63

Query: 63  DIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPV 122
           +    +     D  +         I+W                           G+A   
Sbjct: 64  ERYQEMNYLEVDPTVRDGALSTNMIVWPEASRSDETT-----LWNDARDHGLAVGVAQSS 118

Query: 123 RLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKK------RSSAARNLTE 176
                  G +        L +  I +       +      L  +         +   LT 
Sbjct: 119 WAPRGVFGLLTIARHTDRLTSAEINQLTLQANWLANMSHSLMSRFLVPKLAPESGVALTH 178

Query: 177 RETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           RE   L   G+G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 179 REREVLCWTGEGKTACEIGQILSISERTVNFHVNNILDKLGATNKVQAVVKAIAMGLI 236


>gi|319943176|ref|ZP_08017459.1| autoinducer-binding transcriptional regulator [Lautropia mirabilis
           ATCC 51599]
 gi|319743718|gb|EFV96122.1| autoinducer-binding transcriptional regulator [Lautropia mirabilis
           ATCC 51599]
          Length = 237

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 45/236 (19%), Positives = 77/236 (32%), Gaps = 10/236 (4%)

Query: 4   NTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGD 63
             L    +    ++      I+    A  F           P  +  I  + NY      
Sbjct: 6   EELIRHHADESTDMRTVFSTIEKAAHALAFDHVAYCYQASLPASKPRITLIDNYPKAWRA 65

Query: 64  IPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVR 123
                     D  L        PI+W       V         R         G +  V+
Sbjct: 66  RYLEAGYLEQDPRLQCGARSQRPIMWTDELFSEVPA-----LWRDSHEHGLCHGWSQSVQ 120

Query: 124 LGFHKNGYVIFTSEFLMLANEVIIE----AHGACYQVITDFLEL-FKKRSSAARNLTERE 178
            G    G    +     L+   + E             T    +   + ++  R+LT RE
Sbjct: 121 DGPGGMGMTSLSRTLPALSAHELNEKYDRMQWLAQMTHTLLSRIIRSQNAARVRHLTSRE 180

Query: 179 TSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              L+   DG +S++IA+ L LS +TV+ ++ +   KL+  N+  A+ +A+  G I
Sbjct: 181 IEVLKWTADGKSSQDIADILTLSKNTVDFHIKNTVQKLNVPNKTAAVVQAVLLGLI 236


>gi|66277262|gb|AAY44562.1| LuxR-like protein [Aeromonas sp. SF6-7]
          Length = 260

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 52/229 (22%), Positives = 84/229 (36%), Gaps = 9/229 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     L    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALILPMSMQRPKVVLFNQCPDSWVQAYTDNHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    +       + L        GI+FP+     +NG
Sbjct: 74  ACDPVIPLARKQTLPIYWNRLDERARFLPEGTMDVMGLAAEFGLRNGISFPLHGATGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       +      S     LTERET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPILSWMSNYIFEAAIRMVRFSLMDSDPKDPLTERETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFG 232
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G
Sbjct: 193 WASEGKTSSEIACILGITERTVNYHLNHVTRKTGSMNRYQAIAKGVSTG 241


>gi|86750432|ref|YP_486928.1| LuxR family transcriptional regulator [Rhodopseudomonas palustris
           HaA2]
 gi|86573460|gb|ABD08017.1| transcriptional regulator, LuxR family [Rhodopseudomonas palustris
           HaA2]
          Length = 240

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 49/236 (20%), Positives = 89/236 (37%), Gaps = 7/236 (2%)

Query: 3   ENTLT----GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYD 58
           E+TLT      ++++   ++ +L  +             I +     ++Q     LH + 
Sbjct: 7   EDTLTFVAALDRANTPDIVADKLLGVVRPFGYSQVLAGIIPTPRTSVKQQIANVVLHRWP 66

Query: 59  LDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGI 118
           L   +        + D  +   ++   P +W  +  +   ++     +R  G      G 
Sbjct: 67  LRWSERYFSRGYLFEDPTIRRVSTSSEPFVWSEL--QVGPDARANEIMREAGEFGLGCGF 124

Query: 119 AFPVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERE 178
             P+     ++  +    +   L                   L+L +K + A   LT+RE
Sbjct: 125 TVPMITLDGQSAGLSIAGDRAELPPSHRGMVQLVAMYAFLRSLKLGEKPTPAI-TLTKRE 183

Query: 179 TSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              L    +G T  EI++ L +S H V+        KL AVNRIQA+A A+R G I
Sbjct: 184 ADVLHWIAEGKTDWEISKILRVSEHLVDKMARQIRTKLGAVNRIQAVALAMRSGII 239


>gi|66277258|gb|AAY44560.1| LuxR-like protein [Aeromonas veronii]
          Length = 258

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 52/230 (22%), Positives = 91/230 (39%), Gaps = 9/230 (3%)

Query: 12  SSLQELSPRLHLIQNRIKAR-NFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           +S+ +   RL  +  R      +  Y     +    ++  +   +   +           
Sbjct: 14  TSVTD-GDRLAGLIGRFTVDMGYDYYGFTLIIPMSMQRPKVVLFNQCPISWVQTYTDNNM 72

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
              D  +       LPI W  + E    ++      + L        GI+FP+     +N
Sbjct: 73  LACDPVIQLARKQTLPIYWNRLDERARFLQEGSMDVMGLAAEFGLRNGISFPLHGAAGEN 132

Query: 130 GYVIFTSEFLMLANEVIIE----AHGACYQVITDFLEL-FKKRSSAARNLTERETSCLQL 184
           G + F +     ++++++E           +    + +   + S     LT+RET CL  
Sbjct: 133 GILSFITSER-ASSDLLLESSPILSWMANYIFEAAIRVVRLRDSDQQAALTDRETECLFW 191

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK I  G +
Sbjct: 192 ASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGIL 241


>gi|66277260|gb|AAY44561.1| LuxR-like protein [Aeromonas veronii]
          Length = 258

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 52/230 (22%), Positives = 91/230 (39%), Gaps = 9/230 (3%)

Query: 12  SSLQELSPRLHLIQNRIKAR-NFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           +S+ +   RL  +  R      +  Y     +    ++  +   +   +           
Sbjct: 14  TSVTD-GDRLAGLIGRFTVDMGYDYYGFTLIIPMSMQRPKVVLFNQCPISWVQTYTDNNM 72

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
              D  +       LPI W  + E    ++      + L        GI+FP+     +N
Sbjct: 73  LACDPVIQLARKQTLPIYWNRLDERARFLQEGSMDVMGLAAEFGLRNGISFPLHGAAGEN 132

Query: 130 GYVIFTSEFLMLANEVIIE----AHGACYQVITDFLEL-FKKRSSAARNLTERETSCLQL 184
           G + F +     ++++++E           +    + +   + S     LT+RET CL  
Sbjct: 133 GILSFITSER-ASSDLLLESSPILSWMANYIFEAAIRVVRLRDSDQQAALTDRETECLFW 191

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK I  G +
Sbjct: 192 ASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGIL 241


>gi|59940151|gb|AAX12614.1| LuxR-type transcriptional regulator [Aeromonas sp. 11m]
          Length = 260

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|66277280|gb|AAY44571.1| LuxR-like protein [Aeromonas caviae]
          Length = 258

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 52/230 (22%), Positives = 91/230 (39%), Gaps = 9/230 (3%)

Query: 12  SSLQELSPRLHLIQNRIKAR-NFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           +S+ +   RL  +  R      +  Y     +    ++  +   +   +           
Sbjct: 14  TSVTD-GDRLAGLIGRFTVDMGYDYYGFTLIIPMSMQRPKVVLFNQCPISWVQTYTDNNM 72

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
              D  +       LPI W  + E    ++      + L        GI+FP+     +N
Sbjct: 73  LACDPVIQLARKQTLPIYWNRLDERARFLQEGSMDVMGLAAEFGLRNGISFPLHGAPGEN 132

Query: 130 GYVIFTSEFLMLANEVIIE----AHGACYQVITDFLEL-FKKRSSAARNLTERETSCLQL 184
           G + F +     ++++++E           +    + +   + S     LT+RET CL  
Sbjct: 133 GILSFITSER-ASSDLLLESSPILSWMANYIFEAAIRVVRLRDSDQQAALTDRETECLFW 191

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK I  G +
Sbjct: 192 ASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGIL 241


>gi|14586760|gb|AAK70352.1|AF333007_1 N-acyl homoserine lactone transcriptional regulator [Burkholderia
           vietnamiensis]
          Length = 239

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 41/229 (17%), Positives = 66/229 (28%), Gaps = 11/229 (4%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           S+ ++       I    K   F        +  P  +  +     Y              
Sbjct: 13  SAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFDTYPDGWMAHYQAQNYI 72

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  +         I+W  +              +         G+A          G 
Sbjct: 73  EIDSTVRDGALNTNMIVWPDVDRIDPC-----PLWQDARDFGLSVGVAQSSWAARGAFGL 127

Query: 132 VIFTSEFLMLANEVIIEA----HGACYQVITDFLELFKKRSSAARN--LTERETSCLQLA 185
           +        L    I       +       +        + S A    LT RE   L   
Sbjct: 128 LSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPAAGVTLTAREREVLCWT 187

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 188 AEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|198283772|ref|YP_002220093.1| LuxR family transcriptional regulator [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218665417|ref|YP_002426403.1| autoinducer-binding transcriptional regulator, LuxR family
           [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|71044540|gb|AAV53702.2| AfeR [Acidithiobacillus ferrooxidans]
 gi|198248293|gb|ACH83886.1| transcriptional regulator, LuxR family [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218517630|gb|ACK78216.1| autoinducer-binding transcriptional regulator, LuxR family
           [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 237

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 42/223 (18%), Positives = 71/223 (31%), Gaps = 11/223 (4%)

Query: 18  SPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFL 77
              L +     +   F        +  P  +       NY                D  +
Sbjct: 19  RQVLAMASEMARKLEFDYCAYGLRMPLPLVRPKTVLFSNYPAVWQARYQAQEYQAIDPTV 78

Query: 78  FHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSE 137
            H      P++W             +            AG+A   R      G +     
Sbjct: 79  RHAMRSPSPVVWSDDLFA-----PARELWEEARSFGLRAGLAHTCRDAGGMGGMLTLARA 133

Query: 138 -FLMLANEVIIEAHGACYQVITDFLELFKKRSSAARN-----LTERETSCLQLAGDGYTS 191
              +   E   +A    + V    L + +  +   +      L+ RE   L+  G+G TS
Sbjct: 134 GETVTTAEWQAKACHILWLVQAVHLSMIRVIAPKLQPEIAVQLSCREVEVLRWTGEGKTS 193

Query: 192 EEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            EIA  L ++  TVN ++  A  KL+AVN+  A+ +A   G +
Sbjct: 194 GEIANILNITERTVNFHISKAMAKLNAVNKTAAVLQAAMLGLL 236


>gi|59940103|gb|AAX12590.1| LuxR-type transcriptional regulator [Aeromonas sp. AN-30]
 gi|59940105|gb|AAX12591.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
          Length = 260

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940029|gb|AAX12553.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
          Length = 261

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 50/244 (20%), Positives = 92/244 (37%), Gaps = 10/244 (4%)

Query: 1   MSENTLT--GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYD 58
           M ++ L    +  +S+ +      LI        +  Y     +    +++ +   +   
Sbjct: 1   MKQDQLLEYLEHLTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRRKVVLFNQCP 60

Query: 59  LDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAG 117
                          D  +       LPI W  + E    ++      + L        G
Sbjct: 61  DSWVQAYTANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNG 120

Query: 118 IAFPVRLGFHKNGYVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSA 170
           I+FP+     +NG ++        ++++++E           +       + +  +    
Sbjct: 121 ISFPLHGAAGENGIILSFITAERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDP 180

Query: 171 ARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIR 230
              LT+RET CL  A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK + 
Sbjct: 181 QEALTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVS 240

Query: 231 FGYI 234
            G +
Sbjct: 241 SGIL 244


>gi|167552822|ref|ZP_02346573.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205322659|gb|EDZ10498.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 240

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 41/235 (17%), Positives = 75/235 (31%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++ ++ +++   L     R++   F  Y +      P  +  I     Y       
Sbjct: 14  LLRFQEMAAAEDVYTELQYQTQRLE---FDYYALCVRHPVPFTRPKISLRTTYPPAWVTH 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     + W  +          Q             G+   V L
Sbjct: 71  YQSENYFAIDPVLKPENFRQGHLHWDDVLFH-----EAQAMWDAAQRFGLRRGVTQCVML 125

Query: 125 GFHKNGYVIFTSEFLMLAN----EVIIEAHGACYQVITDFLELFKK-RSSAARNLTERET 179
                G++  +   L  ++    EV +       + ++           +     ++RE 
Sbjct: 126 PNRALGFLSISRSSLRCSSFTYDEVELRLQLLARESLSALTRFEDDMVMAPEMRFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K +A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|12620901|gb|AAG61130.1|AF330019_1 AHL receptor [Burkholderia multivorans]
          Length = 239

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 43/229 (18%), Positives = 67/229 (29%), Gaps = 11/229 (4%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           S+ ++       I    K   F        +  P  +  +     Y              
Sbjct: 13  SAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFDTYPDGWMTHYQAQNYI 72

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  +         I+W  + +            R      P  G+A          G 
Sbjct: 73  EIDSTVRDGALSTNMIVWPDVDKIEPC-----PLWRDARDFGPSVGVAQSSWAARGAFGL 127

Query: 132 VIFTSEFLMLANEVIIEAHGACYQVITDFLELFKK------RSSAARNLTERETSCLQLA 185
           +        L    I         +      L  +         A   LT RE   L   
Sbjct: 128 LSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFVVPKLSPEARVALTAREREVLCWT 187

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 188 AEGKTACEIGQILCISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|66277274|gb|AAY44568.1| LuxR-like protein [Aeromonas sp. CCRC 13880]
          Length = 260

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 50/231 (21%), Positives = 88/231 (38%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E        C  +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPVLSWMCNYIFEAAIRIVRVSLRDDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|299771984|ref|YP_003734010.1| Transcriptional activator protein phzR [Acinetobacter sp. DR1]
 gi|284158686|gb|ADB80058.1| AqsR [Acinetobacter sp. DR1]
 gi|298702072|gb|ADI92637.1| Transcriptional activator protein [Acinetobacter sp. DR1]
          Length = 238

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 43/210 (20%), Positives = 71/210 (33%), Gaps = 9/210 (4%)

Query: 31  RNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQ 90
             F              +     L+NY                D  + H    L P++W 
Sbjct: 32  LGFDYCAYGMQSPLSIAEPKTIMLNNYPEAWQKRYVKQQYVRVDPTVQHCMLSLQPLVWS 91

Query: 91  SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIEAH 150
           S   ++    S +             G A   R      G +        L  +     +
Sbjct: 92  S---QSANTQSQKDFWEEARSYGLNVGWAQSSRDFIGTRGMLTLARSTDQLLEKEQKAQY 148

Query: 151 ----GACYQVITDFLELFKKRSSAARNL--TERETSCLQLAGDGYTSEEIAEKLGLSVHT 204
                    V +   ++  +   A  NL  T RE   L+   +G TS EIA+ LG++  T
Sbjct: 149 TNMFWLSQTVHSSIAKIVNETEFAQFNLYLTNREKEVLRWTAEGKTSAEIAQILGVTERT 208

Query: 205 VNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           VN +L ++  KL+  N+I A  +A+  G +
Sbjct: 209 VNFHLCNSMQKLNVNNKISAAIRAVMLGIL 238


>gi|66277278|gb|AAY44570.1| LuxR-like protein [Aeromonas sp. CCRC 13980]
          Length = 260

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940049|gb|AAX12563.1| LuxR-type transcriptional regulator [Aeromonas veronii bv. veronii]
          Length = 260

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSGEIACILGITERTVNYHLNHVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940071|gb|AAX12574.1| LuxR-type transcriptional regulator [Aeromonas caviae]
 gi|59940073|gb|AAX12575.1| LuxR-type transcriptional regulator [Aeromonas veronii bv. sobria]
 gi|59940077|gb|AAX12577.1| LuxR-type transcriptional regulator [Aeromonas enteropelogenes]
 gi|59940085|gb|AAX12581.1| LuxR-type transcriptional regulator [Aeromonas sp. AE-51]
 gi|59940087|gb|AAX12582.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
 gi|59940099|gb|AAX12588.1| LuxR-type transcriptional regulator [Aeromonas sp. AN-24]
 gi|59940113|gb|AAX12595.1| LuxR-type transcriptional regulator [Aeromonas jandaei]
          Length = 260

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940091|gb|AAX12584.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
 gi|59940093|gb|AAX12585.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
          Length = 260

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940081|gb|AAX12579.1| LuxR-type transcriptional regulator [Aeromonas veronii bv. sobria]
 gi|59940101|gb|AAX12589.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
 gi|59940163|gb|AAX12620.1| LuxR-type transcriptional regulator [Aeromonas sp. 26m]
          Length = 260

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|227821019|ref|YP_002824989.1| putative LuxR/GerE family transcriptional regulator [Sinorhizobium
           fredii NGR234]
 gi|227340018|gb|ACP24236.1| putative LuxR/GerE family transcriptional regulator [Sinorhizobium
           fredii NGR234]
          Length = 257

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 58/230 (25%), Positives = 82/230 (35%), Gaps = 3/230 (1%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQ-QLICELHNYDLDSGDIPN 66
             + + L+     +  ++       F  + I S       +      + N   +  +  +
Sbjct: 27  ASEIAKLETQFDIIRYMRRITHIFGFKTFLICSIPPIDMERLSAATVISNMPAELLNKYD 86

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEET--VIESSGQLSVRLEGGLLPFAGIAFPVRL 124
            L        +        P        E+      S    + +      F    FPV  
Sbjct: 87  SLSMLRFSTGVRRLRETTTPFQITLEDWESEGGTPDSAADYIVMLRENGIFQANYFPVHD 146

Query: 125 GFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQL 184
                G VI       L     +E       V     E+     S++  L+ERE  CL  
Sbjct: 147 AEGGRGAVILMGPEADLPMTAAMELQMIAIHVYNRLAEIGSVWKSSSTTLSEREIQCLSW 206

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              G TS EIA  LGLS HTVN YL   T KLDAVNR QA+ KA++ GYI
Sbjct: 207 TAAGKTSAEIAGILGLSEHTVNHYLNHVTKKLDAVNRTQAVVKAMKKGYI 256


>gi|168259766|ref|ZP_02681739.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|200391066|ref|ZP_03217677.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|199603511|gb|EDZ02057.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205351245|gb|EDZ37876.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
          Length = 240

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 41/235 (17%), Positives = 75/235 (31%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++ ++ +++   L     R++   F  Y +      P  +  I     Y       
Sbjct: 14  LLRFQEMAAAEDVYTELQYQTQRLE---FDYYALCVRHPVPFTRPKISLRTTYPPAWVTH 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     + W  +          Q             G+   V L
Sbjct: 71  YQSENYFAIDPVLKPENFRQGHLHWDDVLFH-----EAQAMWDAAQRFGLRRGVTQCVML 125

Query: 125 GFHKNGYVIFTSEFLMLAN----EVIIEAHGACYQVITDFLELFKK-RSSAARNLTERET 179
                G++  +   L  ++    EV +       + ++           +     ++RE 
Sbjct: 126 PNRALGFLSVSRSSLRCSSFTYDEVELRLQLLARESLSALTRFEDDMVMAPEMRFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K +A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|161502928|ref|YP_001570040.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160864275|gb|ABX20898.1| hypothetical protein SARI_00987 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 251

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 41/235 (17%), Positives = 75/235 (31%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++ ++ + +   L     R++   F  Y++      P  +  I     Y       
Sbjct: 25  LLRFQEMATAEGVYTELQYQTQRLE---FDYYSLCVRHPVPFTRPKISLRTTYPQAWVTH 81

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L              +  + V+    Q             G+   V L
Sbjct: 82  YQAENYIAIDPVLK-----PENFREGHLHWDNVLFHEAQAMWDAAQRFGLRRGVTQSVML 136

Query: 125 GFHKNGYVIFTSEFLMLAN----EVIIEAHGACYQVITDFLELFKKRSS-AARNLTERET 179
                G++  +   L  ++    EV +       + ++    L            ++RE 
Sbjct: 137 PNRAVGFLSVSRGSLGCSSFTYDEVELRLQLLARESLSALTRLEDDIVMVPEMRFSKREK 196

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K +A N+ Q    A   G I
Sbjct: 197 EILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 251


>gi|13488404|ref|NP_109411.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
 gi|14028158|dbj|BAB54750.1| probable transcriptional regulator [Mesorhizobium loti MAFF303099]
          Length = 242

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 38/222 (17%), Positives = 75/222 (33%), Gaps = 4/222 (1%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           + S   +         R    NF +  +        ++++      +  +          
Sbjct: 19  ARSADAILQEFRFTMERYGLHNFLITGLPVPHGTDWQREI--LADGWSPEWHHRYVTEAY 76

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
              D  +        P  W  +    ++    +L +          GI  P+ +     G
Sbjct: 77  FLHDPCVAQCRHSPEPFRWGELPVARLV-PRAKLVMDEAAEFGMKEGICIPIHVPLAGPG 135

Query: 131 YVIFTSEFLMLANEVIIEAHGACYQVITDFLELF-KKRSSAARNLTERETSCLQLAGDGY 189
            V   S+ + +    +      C         L      +    LT RE   L+ +  G 
Sbjct: 136 VVTMASDRMEVPPSAMPLIETLCVHTFRSLSALGTPGDGNEPTPLTARERELLEWSAQGK 195

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRF 231
           ++++IA  LG++ +TV ++  +   KLDA+N   AI KA+R 
Sbjct: 196 STDDIACILGVTRNTVESHQRNIRGKLDAINVAHAIVKALRR 237


>gi|66277270|gb|AAY44566.1| LuxR-like protein [Aeromonas sp. ym3]
          Length = 260

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940095|gb|AAX12586.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
 gi|59940097|gb|AAX12587.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
 gi|89027173|gb|ABD59317.1| AhyR [Aeromonas hydrophila]
          Length = 260

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940157|gb|AAX12617.1| LuxR-type transcriptional regulator [Aeromonas sp. 15m]
          Length = 260

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYEYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940107|gb|AAX12592.1| LuxR-type transcriptional regulator [Aeromonas enteropelogenes]
          Length = 258

 Score =  155 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 48/209 (22%), Positives = 83/209 (39%), Gaps = 7/209 (3%)

Query: 32  NFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQS 91
            +  Y     +    ++  +   +   +              D  +       LPI W  
Sbjct: 34  GYDYYGFTLIIPMSMQRPKVVLFNQCPISWVQTYTDNNMLACDPVIQLARKQTLPIYWNR 93

Query: 92  IQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIE-- 148
           + E    ++      + L        GI+FP+     +NG + F +     ++++++E  
Sbjct: 94  LDERARFLQEGSMDVMGLAAEFGLRNGISFPLHGAAGENGILSFITSER-ASSDLLLESS 152

Query: 149 --AHGACYQVITDFLEL-FKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTV 205
                    +    + +   + S     LT+RET CL  A +G TS EIA  LG++  TV
Sbjct: 153 PILSWMANYIFEAAIRVVRLRDSDQQAALTDRETECLFWASEGKTSGEIACILGITERTV 212

Query: 206 NAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           N +L   T K  ++NR QAIAK I  G +
Sbjct: 213 NYHLNQVTRKTGSMNRYQAIAKGISSGIL 241


>gi|59940045|gb|AAX12561.1| LuxR-type transcriptional regulator [Aeromonas veronii bv. sobria]
 gi|59940125|gb|AAX12601.1| LuxR-type transcriptional regulator [Aeromonas salmonicida subsp.
           salmonicida]
 gi|59940159|gb|AAX12618.1| LuxR-type transcriptional regulator [Aeromonas sp. 17m]
          Length = 260

 Score =  155 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|117618881|ref|YP_855090.1| transcriptional activator protein AhyR [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117560288|gb|ABK37236.1| transcriptional activator protein AhyR [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 261

 Score =  155 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 48/231 (20%), Positives = 86/231 (37%), Gaps = 8/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            ++        ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 IILSFITAERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTDRETECLF 193

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 194 WASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 244


>gi|59940133|gb|AAX12605.1| LuxR-type transcriptional regulator [Aeromonas bestiarum]
          Length = 260

 Score =  155 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|238027315|ref|YP_002911546.1| Autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia glumae BGR1]
 gi|237876509|gb|ACR28842.1| Autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia glumae BGR1]
          Length = 234

 Score =  155 bits (393), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 41/215 (19%), Positives = 64/215 (29%), Gaps = 9/215 (4%)

Query: 24  IQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSG 83
           +        +           P        + NY     +    L     D      N+ 
Sbjct: 25  LSRVAAILGYEFVAYGIRRPLPLSNPPSLTVSNYPARWQERYQGLRLAEIDPVARAANAS 84

Query: 84  LLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLAN 143
             P++W S   ++      Q   +         G +   R      G +        +  
Sbjct: 85  DRPVVWSSQGNDS-----DQAFWQEASSFGLMHGWSSATRGAEGTLGVLSLARGGDAIDE 139

Query: 144 EVI----IEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLG 199
                     H                      NLT RET  L+   DG T+ EI+  L 
Sbjct: 140 VERDRNEFIVHWLANVAHAALAPFLPAAGEPEANLTSRETDVLKWTADGKTAYEISRILS 199

Query: 200 LSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +S  TVN ++ +   KL   N+IQA+AKA   G +
Sbjct: 200 ISESTVNFHVKNIMSKLGTSNKIQAVAKAALTGML 234


>gi|66277266|gb|AAY44564.1| LuxR-like protein [Aeromonas sp. ym1]
          Length = 260

 Score =  155 bits (393), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 49/229 (21%), Positives = 84/229 (36%), Gaps = 9/229 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     L    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALILPMSMQRPKVVLFNQCPDSWVQAYTDNHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPVIRLARKQTLPIYWNRLDERARFLQEGTLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       +      +     LT+RET CL 
Sbjct: 134 ILSFITSER-ASSDLLLESSPILSWMSNYIFEAAIRMVRFSLMDNDPKDPLTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFG 232
            A +G TS EIA  LG++  TVN +L   T K  ++NR  AIAK +  G
Sbjct: 193 WASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYHAIAKGVSTG 241


>gi|59940127|gb|AAX12602.1| LuxR-type transcriptional regulator [Aeromonas sp. Manipal A1]
 gi|59940139|gb|AAX12608.1| LuxR-type transcriptional regulator [Aeromonas caviae]
 gi|59940153|gb|AAX12615.1| LuxR-type transcriptional regulator [Aeromonas sp. 12m]
 gi|59940161|gb|AAX12619.1| LuxR-type transcriptional regulator [Aeromonas sp. 19m]
          Length = 260

 Score =  155 bits (393), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940149|gb|AAX12613.1| LuxR-type transcriptional regulator [Aeromonas sp. 1m]
          Length = 260

 Score =  155 bits (393), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDEPQEALTDRETECLV 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940047|gb|AAX12562.1| LuxR-type transcriptional regulator [Aeromonas jandaei]
 gi|59940057|gb|AAX12567.1| LuxR-type transcriptional regulator [Aeromonas enteropelogenes]
 gi|59940079|gb|AAX12578.1| LuxR-type transcriptional regulator [Aeromonas caviae]
 gi|59940147|gb|AAX12612.1| LuxR-type transcriptional regulator [Aeromonas sp. QM 70363]
          Length = 260

 Score =  155 bits (393), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|145300631|ref|YP_001143472.1| transcriptional activator AsaR [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|61218504|sp|P0A3J5|AHYR_AERHY RecName: Full=Transcriptional activator protein AhyR/AsaR
 gi|61218505|sp|P0A3J6|AHYR_AERSA RecName: Full=Transcriptional activator protein AhyR/AsaR
 gi|899145|emb|CAA61654.1| AhyR [Aeromonas hydrophila]
 gi|1519237|gb|AAB70018.1| transcriptional activator [Aeromonas salmonicida]
 gi|142853403|gb|ABO91724.1| transcriptional activator AsaR [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 260

 Score =  155 bits (393), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|134293938|ref|YP_001117674.1| LuxR family transcriptional regulator [Burkholderia vietnamiensis
           G4]
 gi|134137095|gb|ABO58209.1| transcriptional regulator, LuxR family [Burkholderia vietnamiensis
           G4]
          Length = 239

 Score =  155 bits (393), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 43/233 (18%), Positives = 73/233 (31%), Gaps = 13/233 (5%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++ S+ ++       I    K   F        +  P  +  +     Y           
Sbjct: 10  QQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFDTYPDGWMAHYQAR 69

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +         I+W  +                        G+A         
Sbjct: 70  NYIEIDSTVREGALSTNMIVWPDVDRIDPC-----PLWEDARDFGLAVGVAQSSWAARGA 124

Query: 129 NGYVIFTSEFLMLANEVIIEAHG-------ACYQVITDFLELFKKRSSAARNLTERETSC 181
            G +  +     L    I              + +++ F+ L K   +A   LT RE   
Sbjct: 125 FGLLSISRHADRLTPAEINMLTLQTNWLANLSHSLMSRFM-LPKLSPAAGVTLTAREREV 183

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           L    +G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 184 LCWTAEGKTACEIGQILSISERTVNFHVNNILEKLAATNKVQAVVKAIAAGLI 236


>gi|283832684|ref|ZP_06352425.1| regulatory protein SdiA [Citrobacter youngae ATCC 29220]
 gi|291072359|gb|EFE10468.1| regulatory protein SdiA [Citrobacter youngae ATCC 29220]
          Length = 240

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 36/235 (15%), Positives = 71/235 (30%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++ ++ +++   L      ++   F  Y +      P  +        Y       
Sbjct: 14  LLRFQEMATAEDVYNELQQQTQHLE---FDFYALCVRHPVPFTRPKTSLYTTYPKAWVAH 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L              +     +    Q             G+   + L
Sbjct: 71  YQSENYFAIDPVLK-----PENFSQGHLPWSDTLFRDAQPLWDAARNHGLRKGMTQCLML 125

Query: 125 GFHKNGYVIFTSEFLMLAN----EVIIEAHGACYQVITDFLELFKKRSS-AARNLTERET 179
                G++  +   +  +     EV +       + ++  + L            ++RE 
Sbjct: 126 PNRALGFLSVSRANIRNSRLANDEVELRMQLLVRESLSVLMRLEDDMVMVPEMRFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K +A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|86747544|ref|YP_484040.1| LuxR family transcriptional regulator [Rhodopseudomonas palustris
           HaA2]
 gi|86570572|gb|ABD05129.1| transcriptional regulator, LuxR family [Rhodopseudomonas palustris
           HaA2]
          Length = 242

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 45/239 (18%), Positives = 80/239 (33%), Gaps = 8/239 (3%)

Query: 2   SENTLTGKKSSSLQELSPRLHL------IQNRIKARNFALYTINSALDFPRRQQLICELH 55
            E+ L G+++    + + RL         ++ I +  F+ Y + +          +   +
Sbjct: 4   GESHLWGRRALEFVDAADRLDAPSLVRQFESHIASAGFSAYIMAALPAPGAGLAELTLAN 63

Query: 56  NYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPF 115
            +     ++         D    H  + + P  W     +   + +    +         
Sbjct: 64  GWPRGWFELYVGRNYMAVDPVPRHGAATVQPFEWSDAPYDRKRDRAAHQVMTDAAEFGLV 123

Query: 116 AGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLT 175
            G   P+         +    E   L                     L  +     R LT
Sbjct: 124 RGYCIPLHYDDGG-AMISMAGEAPDLDPTAKGAMQLIGVYAHNRLRSLN-RPKPQRRLLT 181

Query: 176 ERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            RE   L  A  G T+ EI+  L ++  TV  +L  A+ KL+AVNR  A+AKA+  G I
Sbjct: 182 SRECEILSWAAQGKTAWEISMILRIAERTVKFHLIEASRKLNAVNRTAAVAKALSLGLI 240


>gi|306021776|gb|ADM80305.1| LuxR [Aeromonas sobria]
          Length = 237

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 51/223 (22%), Positives = 87/223 (39%), Gaps = 8/223 (3%)

Query: 19  PRLHLIQNRIKAR-NFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFL 77
            RL  +  R      +  Y     +    ++  +   +   +              D  +
Sbjct: 2   DRLAGLIGRFTVDMGYDYYGFTLIIPMSMQRPKVVLFNQCPISWVQTYTDNNMLACDPVI 61

Query: 78  FHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTS 136
                  LPI W  + E    ++      + L        GI+FP+     +NG + F +
Sbjct: 62  QLARKQTLPIYWNRLDERARFLQEGSMDVMGLAAEFGLRNGISFPLHGAAGENGILSFIT 121

Query: 137 EFLMLANEVIIE----AHGACYQVITDFLEL-FKKRSSAARNLTERETSCLQLAGDGYTS 191
                ++++++E           +    + +   + S     LT+RET CL  A +G TS
Sbjct: 122 SER-ASSDLLLESSPILSWMANYIFEAAIRVVRLRDSDQQAALTDRETECLFWASEGKTS 180

Query: 192 EEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            EIA  LG++  TVN +L   T K  ++NR QAIAK I  G +
Sbjct: 181 GEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGIL 223


>gi|56695286|ref|YP_165634.1| autoinducer-binding transcriptional regulator LuxR [Ruegeria
           pomeroyi DSS-3]
 gi|56677023|gb|AAV93689.1| autoinducer-binding transcriptional regulator LuxR [Ruegeria
           pomeroyi DSS-3]
          Length = 239

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 43/234 (18%), Positives = 80/234 (34%), Gaps = 15/234 (6%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
               +S+L++L      +++ ++  +   + ++SA D             Y     +   
Sbjct: 13  DLDATSALEDLERVTIKLRDTLEIDHIVYHWVDSAGDQ-------YGCATYPKAWQERYL 65

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                  D  +        P+ W+ +     +  +           +   G + P+R   
Sbjct: 66  ERNYHRIDPVILGCFQRFHPVDWKRLDWSGKVAKA--FLQDALKHGVGNQGYSIPIRGPN 123

Query: 127 HKNGYVIFTSEFLMLANEVI-----IEAHGACYQVITDFLELFKKRSS-AARNLTERETS 180
            +             A          +     +      LE  + R     RNL+ RE  
Sbjct: 124 GQFALFTVNHVCDDQAWSEFTEIYGRDLILIAHFFNRKALEFERSRQPDQPRNLSPREVD 183

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            + L   GY+  ++A  L +S HT+  Y+ SA  KL A+N   AIA A+  G I
Sbjct: 184 AMTLLALGYSRAQVAHSLSISEHTLRVYIESARFKLGALNTTHAIATAMSRGLI 237


>gi|66277276|gb|AAY44569.1| LuxR-like protein [Aeromonas sp. CCRC 13881]
          Length = 260

 Score =  155 bits (392), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPILSWMSNYIFEAAIRIVRVSLRDDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|62180524|ref|YP_216941.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|224583549|ref|YP_002637347.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|62128157|gb|AAX65860.1| transcriptional regulator of ftsQAZ gene cluster (LuxR/UhpA family)
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|224468076|gb|ACN45906.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|322715000|gb|EFZ06571.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
          Length = 240

 Score =  155 bits (392), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 41/235 (17%), Positives = 74/235 (31%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++ ++ ++    L     R++   F  Y +      P  +  I     Y       
Sbjct: 14  LLRFQEMAAAEDFYTELQYQTQRLE---FDYYALCVRHPVPFTRPKISLRTTYPPAWVTH 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     + W  +          Q             G+   V L
Sbjct: 71  YQSENYFAIDPVLKPENFRQGHLHWDDVLFH-----EAQAMWDAAQRFGLRRGVTQCVML 125

Query: 125 GFHKNGYVIFTSEFLMLAN----EVIIEAHGACYQVITDFLELFKK-RSSAARNLTERET 179
                G++  +   L  ++    EV +       + ++           +     ++RE 
Sbjct: 126 PNRALGFLSVSRSSLRCSSFTYDEVELRLQLLARESLSALTRFEDDMVMAPEMRFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K +A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|14586749|gb|AAK70347.1|AF333002_1 N-acyl homoserine lactone transcriptional regulator [Burkholderia
           cepacia]
          Length = 239

 Score =  155 bits (392), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 40/229 (17%), Positives = 67/229 (29%), Gaps = 11/229 (4%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           S+ ++       I    K   F        +  P  +  +     Y              
Sbjct: 13  SAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFDTYPDGWMAHYQAQNYI 72

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  +         I+W  + +            R         G+A          G 
Sbjct: 73  EIDSTVRDGALSTNMIVWPDVDKIEPC-----PLWRDARDFGLSVGVAQSSWAARGAFGL 127

Query: 132 VIFTSEFLMLANEVIIEA----HGACYQVITDFLELFKKRSSAARNLTE--RETSCLQLA 185
           +        L    I       +       +        + S    +T+  RE   L   
Sbjct: 128 LSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPEARVTQTAREREVLCWT 187

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 188 AEGKTACEIGQILSISERTVNFHVNNILEKLGASNKVQAVVKAISAGLI 236


>gi|14993797|gb|AAK73190.1| transcriptional activator CsaR [Pseudomonas chlororaphis subsp.
           aureofaciens]
          Length = 241

 Score =  155 bits (391), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 43/225 (19%), Positives = 74/225 (32%), Gaps = 10/225 (4%)

Query: 15  QELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGD 74
           QE +    L++  +++  F  Y        P  +  I    +Y     +          D
Sbjct: 22  QESAQVFALLEREVRSLGFDFYAYGVRHSIPFTRPKIDIYGSYPQAWVERYQQQNYAAID 81

Query: 75  DFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
             + +       ++W              +            G   P+         +  
Sbjct: 82  PTILNGLRSTEMVVWSDALF-----GKSSVLWGEAREWGLRVGATLPIHTPDSALSVLSV 136

Query: 135 TSEFLMLANEVIIEAHGACYQVIT-DFLELFKKRSSAARN----LTERETSCLQLAGDGY 189
             E   ++   + E       +I    + L +    +++     L+ RE   LQ   DG 
Sbjct: 137 ARECTAISAVELEEIRLRLRCIIELATMRLGELGHPSSQAEQLELSAREREILQWTADGK 196

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +S EIA  LG+SV+TVN +L     K  A N+  A A A   G I
Sbjct: 197 SSGEIALILGISVNTVNFHLKVIQKKFGAANKTLAAAYAAVLGLI 241


>gi|260467388|ref|ZP_05813560.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
 gi|259028848|gb|EEW30152.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
          Length = 242

 Score =  155 bits (391), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 40/222 (18%), Positives = 78/222 (35%), Gaps = 4/222 (1%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           + S + +     L   R   RNF +  +        ++++      +  +          
Sbjct: 19  ARSAEAILHEFRLAMERYGLRNFLITGLPVPHGTDWQREI--LADGWSPEWHHRYVSEEY 76

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
              D  +        P  W  +    ++ +  +L +          GI  P+ +     G
Sbjct: 77  FLHDPCVAQCRHSPEPFRWAELPAARLV-ARAKLVMDEAAEFGMKEGICVPIHVPLAGPG 135

Query: 131 YVIFTSEFLMLANEVIIEAHGACYQVITDFLELF-KKRSSAARNLTERETSCLQLAGDGY 189
            V   S+ + +    +      C         L           LT RE   L+ +  G 
Sbjct: 136 VVTMASDRMDVPPSAMPLIETLCVHTFRSLSGLGTPGDGYEPTPLTARERELLEWSAQGK 195

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRF 231
           ++++IA  LG++ +TV ++  +   KLDA+N   AI KA+R 
Sbjct: 196 STDDIACILGVTRNTVESHQRNIRAKLDAINVAHAIVKALRR 237


>gi|59940031|gb|AAX12554.1| LuxR-type transcriptional regulator [Aeromonas bestiarum]
          Length = 260

 Score =  155 bits (391), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 50/244 (20%), Positives = 93/244 (38%), Gaps = 11/244 (4%)

Query: 1   MSENTLT--GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYD 58
           M ++ L    +  +S+ +      LI        +  Y     +    +++ +   +   
Sbjct: 1   MKQDQLLEYLEHLTSVTDEDRLAELIGRFTLGMGYDYYRFAVIIPMSMQRRKVVLFNQCP 60

Query: 59  LDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQ-EETVIESSGQLSVRLEGGLLPFAG 117
                          D  +       LPI W  ++     ++      + L        G
Sbjct: 61  DSWVQAYTANHMLACDPIIQLARKQTLPIYWNRLEGRARFLQEGSLDVMGLAAEFGLRNG 120

Query: 118 IAFPVRLGFHKNGYVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSA 170
           I+FP+     +NG + F +     ++++++E           +       + +  +    
Sbjct: 121 ISFPLHGAAGENGILSFITAER-ASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDP 179

Query: 171 ARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIR 230
              LT+RET CL  A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK + 
Sbjct: 180 QEALTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVS 239

Query: 231 FGYI 234
            G +
Sbjct: 240 SGIL 243


>gi|320191891|gb|EFW66538.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 str. EC1212]
          Length = 240

 Score =  155 bits (391), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 43/235 (18%), Positives = 85/235 (36%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++   F  Y++      P  +  +    NY       
Sbjct: 14  LLRFQRMETAEEVYHEIELQAQQLE---FDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSY 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W          +  Q             G+   + L
Sbjct: 71  YQAKNFLAIDPVLNPENFSQGHLMWNDDLF-----NEAQPLWEAARAHGLRRGVTQYLML 125

Query: 125 GFHKNGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F      E  +L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 126 PNRALGFLSFSRCSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 186 EILRWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|163758577|ref|ZP_02165664.1| probable transcriptional regulator protein, LuxR family [Hoeflea
           phototrophica DFL-43]
 gi|162283867|gb|EDQ34151.1| probable transcriptional regulator protein, LuxR family [Hoeflea
           phototrophica DFL-43]
          Length = 237

 Score =  155 bits (391), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 54/227 (23%), Positives = 86/227 (37%), Gaps = 3/227 (1%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           K +++  EL+  L  + +    R F+++  +    F  R      L N   +  +  + L
Sbjct: 12  KTATTEHELAVSLQALTSEFDFRFFSIF--DIPATFSDRLSKHIRLSNLPSEYIEEYDSL 69

Query: 69  IETYGDDFLFHFNSGLLPI-IWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
                            P+  +  +  +       Q+   +        G+ FPV     
Sbjct: 70  NLLSNSSVFAMLRQSTAPMTRFLDLAVKERPTEEQQVMRAVFEKHNMTMGVYFPVHGSNG 129

Query: 128 KNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGD 187
           +   + F      L+                 + ++  K  + A  +T RE   L  A +
Sbjct: 130 RRAAMAFYGTRPALSFAETGVLGLCVLHAFDAYSKMTNKTGTKANGITTRELEVLHWAAN 189

Query: 188 GYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           G TS EIA  L LS HTVN Y+ SA  KLD VNR Q +AKA+R   I
Sbjct: 190 GKTSTEIAAILSLSDHTVNTYMNSAMRKLDCVNRTQLVAKALRLHLI 236


>gi|59940135|gb|AAX12606.1| LuxR-type transcriptional regulator [Aeromonas bestiarum]
          Length = 260

 Score =  155 bits (391), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|53717160|ref|YP_105961.1| N-acyl homoserine lactone transcriptional regulator [Burkholderia
           mallei ATCC 23344]
 gi|53721911|ref|YP_110896.1| N-acylhomoserine lactone dependent regulatory protein [Burkholderia
           pseudomallei K96243]
 gi|67643283|ref|ZP_00442030.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei GB8 horse 4]
 gi|76818142|ref|YP_337635.1| BpsR [Burkholderia pseudomallei 1710b]
 gi|121598108|ref|YP_989940.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei SAVP1]
 gi|124382764|ref|YP_001024423.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei NCTC 10229]
 gi|126442328|ref|YP_001062292.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 668]
 gi|126445689|ref|YP_001078154.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei NCTC 10247]
 gi|126458533|ref|YP_001075258.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 1106a]
 gi|134278985|ref|ZP_01765698.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 305]
 gi|167000171|ref|ZP_02265991.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei PRL-20]
 gi|167723232|ref|ZP_02406468.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei DM98]
 gi|167742204|ref|ZP_02414978.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 14]
 gi|167819378|ref|ZP_02451058.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 91]
 gi|167827752|ref|ZP_02459223.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 9]
 gi|167849226|ref|ZP_02474734.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei B7210]
 gi|167906168|ref|ZP_02493373.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei NCTC 13177]
 gi|167914491|ref|ZP_02501582.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 112]
 gi|167922390|ref|ZP_02509481.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei BCC215]
 gi|217418339|ref|ZP_03449846.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 576]
 gi|226197543|ref|ZP_03793118.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei Pakistan 9]
 gi|237507418|ref|ZP_04520133.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei MSHR346]
 gi|242313785|ref|ZP_04812802.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 1106b]
 gi|254174155|ref|ZP_04880817.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei ATCC 10399]
 gi|254183341|ref|ZP_04889933.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 1655]
 gi|254193094|ref|ZP_04899529.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei S13]
 gi|254200806|ref|ZP_04907171.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei FMH]
 gi|254204776|ref|ZP_04911129.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei JHU]
 gi|254263057|ref|ZP_04953922.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 1710a]
 gi|254300240|ref|ZP_04967686.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 406e]
 gi|254357025|ref|ZP_04973300.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei 2002721280]
 gi|37223137|gb|AAQ90167.1| transcriptional activator [Burkholderia pseudomallei]
 gi|40646736|gb|AAR88244.1| BpsR [Burkholderia pseudomallei]
 gi|43469096|gb|AAS46624.1| BpsR [Burkholderia pseudomallei]
 gi|52212325|emb|CAH38349.1| N-acylhomoserine lactone dependent regulatory protein [Burkholderia
           pseudomallei K96243]
 gi|52423130|gb|AAU46700.1| N-acyl homoserine lactone transcriptional regulator [Burkholderia
           mallei ATCC 23344]
 gi|76582615|gb|ABA52089.1| BpsR [Burkholderia pseudomallei 1710b]
 gi|121225906|gb|ABM49437.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei SAVP1]
 gi|124290784|gb|ABN00054.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei NCTC 10229]
 gi|126221819|gb|ABN85324.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 668]
 gi|126232301|gb|ABN95714.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 1106a]
 gi|126238543|gb|ABO01655.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei NCTC 10247]
 gi|134249404|gb|EBA49485.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 305]
 gi|147748418|gb|EDK55493.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei FMH]
 gi|147754362|gb|EDK61426.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei JHU]
 gi|148026052|gb|EDK84175.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei 2002721280]
 gi|157809975|gb|EDO87145.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 406e]
 gi|160695201|gb|EDP85171.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei ATCC 10399]
 gi|169649848|gb|EDS82541.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei S13]
 gi|184213874|gb|EDU10917.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 1655]
 gi|217397643|gb|EEC37658.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 576]
 gi|225930152|gb|EEH26164.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei Pakistan 9]
 gi|234999623|gb|EEP49047.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei MSHR346]
 gi|238524594|gb|EEP88026.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei GB8 horse 4]
 gi|242137024|gb|EES23427.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 1106b]
 gi|243063823|gb|EES46009.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei PRL-20]
 gi|254214059|gb|EET03444.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 1710a]
          Length = 239

 Score =  155 bits (391), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 76/238 (31%), Gaps = 14/238 (5%)

Query: 3   ENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSG 62
           +  L    + + Q+L  ++     R+    F        +  P  + ++     Y     
Sbjct: 7   DAYLQFSAAENEQQLFQQIAAYTKRL---GFEYCCYGIRVPLPISKPVVAIFDTYPNGWM 63

Query: 63  DIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPV 122
           +    +     D  +         I+W                           G+A   
Sbjct: 64  ERYQEMNYLEVDPTVREGALSSNMIVWPEASASDATT-----LWSDARDHGLAVGVAQSS 118

Query: 123 RLGFHKNGYVIFTSEFLMLANEVI----IEAHGACYQVITDFLELFKKRSSAAR--NLTE 176
                  G +        L +  I    ++A+       +        + +      LT 
Sbjct: 119 WASRGVFGLLTIARHTDRLTSAEINHLTLQANWLANMSHSLMSRFLVPKLAPESGVALTH 178

Query: 177 RETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           RE   L   G+G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 179 REREVLCWTGEGKTACEIGQILSISERTVNFHVNNILDKLGATNKVQAVVKAIAMGLI 236


>gi|66277264|gb|AAY44563.1| LuxR-like protein [Aeromonas sp. SF8-170]
          Length = 260

 Score =  155 bits (391), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|170743557|ref|YP_001772212.1| LuxR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168197831|gb|ACA19778.1| transcriptional regulator, LuxR family [Methylobacterium sp. 4-46]
          Length = 245

 Score =  154 bits (390), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 43/226 (19%), Positives = 76/226 (33%), Gaps = 1/226 (0%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
           ++++ + +  +L      +   +  L T+      P  ++       Y  +         
Sbjct: 19  RTATPENVRDQLLRTLAGVGVEHVLLATLRICDAVPCDRRPTVFAGTYPDEWARRYYARD 78

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
               D  +           W         + + +  +   G      G   P+       
Sbjct: 79  YILHDPVVRGVGERGSGFAWSDPGLCAPDDRAARRVLDEAGEFGLREGFTLPLLTLEGDT 138

Query: 130 GYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSA-ARNLTERETSCLQLAGDG 188
             V F  E L L+  V           +   L L K  +   A  L+ RE   LQ A DG
Sbjct: 139 AGVSFVGEKLDLSPAVRGMLTLVGTYALGQVLLLAKGETGPLAEPLSPRERESLQWAADG 198

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            + +EIA+ +G+S H    +L +   KL   +R  A+A  +R G I
Sbjct: 199 KSDQEIADAMGISAHGAIRHLRAVRRKLGTTSRAHAVALGLRLGII 244


>gi|167897824|ref|ZP_02485226.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 7894]
          Length = 239

 Score =  154 bits (390), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 76/238 (31%), Gaps = 14/238 (5%)

Query: 3   ENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSG 62
           +  L    + + Q+L  ++     R+    F        +  P  + ++     Y     
Sbjct: 7   DAYLQFSAAENEQQLFQQIAAYTKRL---GFEYCCYGIRVPLPISKPVVAIFDTYPNGWM 63

Query: 63  DIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPV 122
           +    +     D  +         I+W                           G+A   
Sbjct: 64  ERYEEMNYLEVDPTVREGALSSNMIVWPEASASDATT-----LWSDARDHGLAVGVAQSS 118

Query: 123 RLGFHKNGYVIFTSEFLMLANEVI----IEAHGACYQVITDFLELFKKRSSAAR--NLTE 176
                  G +        L +  I    ++A+       +        + +      LT 
Sbjct: 119 WASRGVFGLLTIARHTDRLTSAEINHLTLQANWLANMSHSLMSRFLVPKLAPESGVALTH 178

Query: 177 RETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           RE   L   G+G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 179 REREVLCWTGEGKTACEIGQILSISERTVNFHVNNILDKLGATNKVQAVVKAIAMGLI 236


>gi|48375112|gb|AAT42219.1| PcoR [Pseudomonas fluorescens]
          Length = 234

 Score =  154 bits (390), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 46/230 (20%), Positives = 82/230 (35%), Gaps = 15/230 (6%)

Query: 13  SLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETY 72
           +L   S  L  +       +  L+ +   +  P     I  + NY        +      
Sbjct: 10  TLDAWSQVLFSLAKDCGFSS-VLFGVKPTISTPFSSSTI--ISNYSKSWRAFYDSNACYE 66

Query: 73  GDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYV 132
            D  +FH  +  LP++W     E  I                 +G+  P+     + G +
Sbjct: 67  VDPVVFHCLNSSLPLVWTK---ENFINPPELQLYEAASASGVRSGLCMPIHGPRGEFGML 123

Query: 133 IFTSEFLMLANEVIIEAHGACYQVITDFL--------ELFKKRSSAARNLTERETSCLQL 184
            F ++      ++I       + ++ D+L           +K       LT RE  CL+ 
Sbjct: 124 NFITDEKSP-ADLINAQGLPQFALMRDYLIESFQKLQNASEKEFETPPXLTARELECLKW 182

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              G TS EI+  L  +  TVN ++ +   K +A +R  A+   IR G +
Sbjct: 183 VAAGKTSWEISRILSCAEVTVNYHVTNFMRKFNAESRQHAVISGIRSGLV 232


>gi|59940035|gb|AAX12556.1| LuxR-type transcriptional regulator [Aeromonas caviae]
          Length = 260

 Score =  154 bits (390), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 47/234 (20%), Positives = 89/234 (38%), Gaps = 9/234 (3%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           +  +++ +      LI        +  Y     +    +++ +   +             
Sbjct: 11  EHLTTVTDEDRLAELISRFTLGMGYDYYRFAVIIPMSMQRRKVVLFNQCPDSWVQAYTAN 70

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQ-EETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
                D  +       LPI W  ++     ++      + L        GI+FP+     
Sbjct: 71  HMLACDPIIQLARKQTLPIYWNRLEGRARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAG 130

Query: 128 KNGYVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETS 180
           +NG + F +     ++++++E           +       + +  +       LT+RET 
Sbjct: 131 ENGILSFITAER-ASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTDRETE 189

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           CL  A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 190 CLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|254511393|ref|ZP_05123460.1| autoinducer-binding transcriptional regulator LuxR
           [Rhodobacteraceae bacterium KLH11]
 gi|221535104|gb|EEE38092.1| autoinducer-binding transcriptional regulator LuxR
           [Rhodobacteraceae bacterium KLH11]
          Length = 239

 Score =  154 bits (390), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 46/240 (19%), Positives = 85/240 (35%), Gaps = 15/240 (6%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLD 60
           +S+     + +++L EL+     +++R++  +   + ++ A D             Y   
Sbjct: 7   LSQILEDLENTNTLDELTSVSVQLRDRLQIDHITYHWVDGAGDQ-------YGFTTYSDA 59

Query: 61  SGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAF 120
                        D  +         + W+ +                +   +   G + 
Sbjct: 60  WDARYREKNYHRIDPVILGCFQRFHAVDWKQLNWSGKA--VRAFLQDAQDHGVGNQGYSI 117

Query: 121 PVRLGFHKNGYVIFTSEFLMLANEVII-----EAHGACYQVITDFLELFKKRSS-AARNL 174
           P+R    +       S    +A +  I     +     Y +    LE  + R     R L
Sbjct: 118 PLRGPSGQFALFTVNSTCDDVAWQAFITNYGRDLILVAYFLNRKALEFAQNRQPETTRAL 177

Query: 175 TERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           + RE   + L   GY+  ++A  L +S HT+ AY+ SA  KL A N   AIA A+  G I
Sbjct: 178 SPREIDAMTLLALGYSRAQVAHSLSISEHTLRAYIESARSKLGAQNTTHAIATALSRGLI 237


>gi|167584437|ref|ZP_02376825.1| transcriptional regulator, LuxR family protein [Burkholderia
           ubonensis Bu]
          Length = 239

 Score =  154 bits (390), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 40/229 (17%), Positives = 66/229 (28%), Gaps = 11/229 (4%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           S+ ++       I    K   F        +  P  +  +     Y              
Sbjct: 13  SAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFDTYPDGWMAHYQEQNYI 72

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  +         I+W         ++                G+A          G 
Sbjct: 73  DIDSTVRDGALSTNLIVWPDAD-----KAGASPLWADARASGLAVGVAQSSWAARGAFGL 127

Query: 132 VIFTSEFLMLANEVIIEA----HGACYQVITDFLELFKKRSSAARN--LTERETSCLQLA 185
           +        L    I       +       +        + +   N  LT RE   L   
Sbjct: 128 LSIARHADRLTPAEINMLTLQTNWLANLSHSLMSGFMVPKLAPEANVVLTAREREVLCWT 187

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 188 AEGKTACEIGQILNISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|4103042|gb|AAD12726.1| transcriptional activator [Burkholderia cepacia]
          Length = 239

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 40/232 (17%), Positives = 68/232 (29%), Gaps = 11/232 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++ S+ ++       I    K   F        +  P  +  +     Y           
Sbjct: 10  QQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFDTYPDGWMAHYQAQ 69

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +         I+W  +              +         G+A         
Sbjct: 70  NYIEIDSTVRDGALNTNMIVWPDVDRIDPC-----PLWQDARDFGLSVGVAQSSWAARGA 124

Query: 129 NGYVIFTSEFLMLANEVIIEA----HGACYQVITDFLELFKKRSSAARN--LTERETSCL 182
            G +        L    I       +       +        + S A    LT R+   L
Sbjct: 125 FGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPAAGVTLTARDREVL 184

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               +G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 185 CWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|91974882|ref|YP_567541.1| regulatory protein, LuxR [Rhodopseudomonas palustris BisB5]
 gi|91681338|gb|ABE37640.1| transcriptional regulator, LuxR family [Rhodopseudomonas palustris
           BisB5]
          Length = 242

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 45/242 (18%), Positives = 78/242 (32%), Gaps = 10/242 (4%)

Query: 1   MSENT--LTGKKSSSLQELSPRLH------LIQNRIKARNFALYTINSALDFPRRQQLIC 52
           MS +     G+++    + + RL         +  I +  F+ Y +            + 
Sbjct: 1   MSADEGNQWGRRALEFVDAADRLDGPSLIRQFETHIASGGFSAYIMAGLPSPGAGLADLT 60

Query: 53  ELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGL 112
             + +     ++         D    H  + + P  W     +     +    +      
Sbjct: 61  LANGWPRGWFELYVRENYIAVDPVPRHGATTVQPFEWSEAPYDRKQNRAAHKVMTHATEF 120

Query: 113 LPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAAR 172
               G   P+         +    +   L                     L  +     R
Sbjct: 121 GLVRGYCIPLHYDEGGAV-ISMAGDQPDLDPVAKGAMQLIGVYAHNRIRSL-HRPKPQRR 178

Query: 173 NLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFG 232
            LT RE   L  A  G T+ EI+  L ++  TV  +L  A+ KL+AVNR  A+AKA+ FG
Sbjct: 179 LLTSRECEILLWAAHGKTAWEISIILHIAERTVKFHLIEASKKLNAVNRTAAVAKALAFG 238

Query: 233 YI 234
            I
Sbjct: 239 LI 240


>gi|15964582|ref|NP_384935.1| putative transcription regulator protein [Sinorhizobium meliloti
           1021]
 gi|307309328|ref|ZP_07588991.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
 gi|307320064|ref|ZP_07599485.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|15073760|emb|CAC45401.1| Putative transcriptional regulator [Sinorhizobium meliloti 1021]
 gi|306894279|gb|EFN25044.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|306900197|gb|EFN30815.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
          Length = 277

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 57/230 (24%), Positives = 80/230 (34%), Gaps = 3/230 (1%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQ-QLICELHNYDLDSGDIPN 66
             + + L+     +  ++   +   F  + I S       +      + N   +  +  +
Sbjct: 47  ASEIARLETQFDIIRYMRRITQIFGFKTFLICSIPAVEVERLSATTVISNMPAELLNKYD 106

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEET--VIESSGQLSVRLEGGLLPFAGIAFPVRL 124
            L        +        P        E       S    + +      F    FPV  
Sbjct: 107 SLSMLRFSTGVRRLRETTTPFQVMLEDWEREGGKPDSAADYIAMLRENGIFQANYFPVHD 166

Query: 125 GFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQL 184
                G VI       L     +E       V     E+     +    L+ERE  CL  
Sbjct: 167 AEGGRGAVILMGPEAELPMTAAMELQMIAIHVYNRLAEIGSVWKNTNTVLSEREIQCLSW 226

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              G TS EIA  LGLS HTVN YL   T KLDAVNR QA+ KA++ GYI
Sbjct: 227 TAAGKTSSEIAGILGLSEHTVNHYLNHVTKKLDAVNRTQAVVKAMKKGYI 276


>gi|59940067|gb|AAX12572.1| LuxR-type transcriptional regulator [Aeromonas veronii]
          Length = 260

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 48/231 (20%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQ-EETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  ++     ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLEGRARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940145|gb|AAX12611.1| LuxR-type transcriptional regulator [Aeromonas sp. QM 21725]
          Length = 260

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVITDF---LELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPVLSWMSNYIFQAAIRNVRVSLRDDEPQGALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|83716915|ref|YP_439706.1| ATP-dependent transcription regulator LuxR [Burkholderia
           thailandensis E264]
 gi|167578146|ref|ZP_02371020.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia thailandensis TXDOH]
 gi|167616276|ref|ZP_02384911.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia thailandensis Bt4]
 gi|257142845|ref|ZP_05591107.1| ATP-dependent transcription regulator LuxR [Burkholderia
           thailandensis E264]
 gi|83650740|gb|ABC34804.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia thailandensis E264]
          Length = 239

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 76/238 (31%), Gaps = 14/238 (5%)

Query: 3   ENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSG 62
           +  L    + + Q+L  ++     R+    F        +  P  + ++     Y     
Sbjct: 7   DAYLQFSAAENEQQLFQQIAAYTKRL---GFEYCCYGIRVPLPISKPVVAIFDTYPNGWM 63

Query: 63  DIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPV 122
           +    +     D  +         I+W                           G+A   
Sbjct: 64  ERYQEMNYLEVDPTVRDGALSSNMIVWPEASANDATT-----LWSDARDHGLAVGVAQSS 118

Query: 123 RLGFHKNGYVIFTSEFLMLANEVI----IEAHGACYQVITDFLELFKKRSSAAR--NLTE 176
                  G +        L +  I    ++A+       +        + +      LT 
Sbjct: 119 WASRGVFGLLTIARHTDRLTSAEINHLTLQANWLANMSHSLMSRFLVPKLAPESGVALTH 178

Query: 177 RETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           RE   L   G+G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 179 REREVLCWTGEGKTACEIGQILSISERTVNFHVNNILDKLGATNKVQAVVKAIAMGLI 236


>gi|59940075|gb|AAX12576.1| LuxR-type transcriptional regulator [Aeromonas caviae]
          Length = 260

 Score =  153 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 48/231 (20%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQ-EETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  ++     ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLEGRARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940123|gb|AAX12600.1| LuxR-type transcriptional regulator [Aeromonas bestiarum]
 gi|59940137|gb|AAX12607.1| LuxR-type transcriptional regulator [Aeromonas bestiarum]
          Length = 260

 Score =  153 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 48/231 (20%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQ-EETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  ++     ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLEGRARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|71057001|emb|CAI51628.1| eR transcriptional regulator [Acidithiobacillus ferrooxidans]
          Length = 214

 Score =  153 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 41/208 (19%), Positives = 68/208 (32%), Gaps = 11/208 (5%)

Query: 33  FALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSI 92
           F        +  P  +       NY                D  + H      P++W   
Sbjct: 11  FDYCAYGLRMPLPLVRPKTVLFSNYPAVWQARYQAQEYQAIDPTVRHAMRSPSPVVWSDD 70

Query: 93  QEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSE-FLMLANEVIIEAHG 151
                     +            AG+A   R      G +        +   E   +A  
Sbjct: 71  LFA-----PARELWEEARSFGLRAGLAHTCRDAGGMGGMLTLARAGETVTTAEWQAKACH 125

Query: 152 ACYQVITDFLELFKKRSSAARN-----LTERETSCLQLAGDGYTSEEIAEKLGLSVHTVN 206
             + V    L + +  +   +      L+ RE   L+  G+G TS EIA  L ++  TVN
Sbjct: 126 ILWLVQAVHLSMIRVIAPKLQPEIAVQLSCREVEVLRWTGEGKTSGEIANILNITERTVN 185

Query: 207 AYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            ++  A  KL+AVN+  A+ +A   G +
Sbjct: 186 FHISKAMAKLNAVNKTAAVLQAAMLGLL 213


>gi|66277272|gb|AAY44567.1| LuxR-like protein [Aeromonas sp. ym4]
          Length = 260

 Score =  153 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 86/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGTLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +          LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPILSWMSNYIFEAAIRIVRVSLLEDDPQDALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940129|gb|AAX12603.1| LuxR-type transcriptional regulator [Aeromonas sp. ABJ]
          Length = 260

 Score =  153 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 47/225 (20%), Positives = 83/225 (36%), Gaps = 13/225 (5%)

Query: 22  HLIQNRIKAR----NFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFL 77
             +   I        +  Y     +    ++  +   +                  D  +
Sbjct: 20  DRLAELIGRFTLGMGYDYYRFALIIPTSMQRPKVVLFNQCPDSWVQAYTANHMLACDPII 79

Query: 78  FHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTS 136
                  LPI W  + E    ++      + L        GI+FP+     +NG + F +
Sbjct: 80  QLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENGILSFIT 139

Query: 137 EFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQLAGDGY 189
                ++++++E           +       + +  +       LT+RET CL  A +G 
Sbjct: 140 AER-ASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALTDRETECLFWASEGK 198

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 199 TSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSCGIL 243


>gi|59940061|gb|AAX12569.1| LuxR-type transcriptional regulator [Aeromonas encheleia]
 gi|59940121|gb|AAX12599.1| LuxR-type transcriptional regulator [Aeromonas bestiarum]
          Length = 260

 Score =  153 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 48/231 (20%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQ-EETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  ++     ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLEGRARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|46371737|gb|AAS90557.1| transcriptional activator [Burkholderia pseudomallei]
          Length = 239

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 76/238 (31%), Gaps = 14/238 (5%)

Query: 3   ENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSG 62
           +  L    + + Q+L  ++     R+    F        +  P  + ++     Y     
Sbjct: 7   DAYLQFSAAENEQQLFQQIAAYTKRL---GFEYCCYGIRVPLPISKPVVAIFDTYPNGWM 63

Query: 63  DIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPV 122
           +    +     D  +         I+W                           G+A   
Sbjct: 64  ERYQEMNYLEVDPTVREGALSSNMIVWPEASASDATT-----LWSDARDHGLAVGVAQSS 118

Query: 123 RLGFHKNGYVIFTSEFLMLANEVI----IEAHGACYQVITDFLELFKKRSSAAR--NLTE 176
                  G +        L +  I    ++A+       +        + +      LT 
Sbjct: 119 WASRGVFGLLTIARHTDRLTSAEINHLTLQANWLANMSHSLMSRFLVPKLAPESGVALTH 178

Query: 177 RETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           RE   L   G+G T+ EI + L +S  TVN ++ +   KL A N++QA+ KAI  G I
Sbjct: 179 RERKVLCWTGEGKTACEIGQILSISERTVNFHVNNILDKLGATNKVQAVVKAIAMGLI 236


>gi|15802351|ref|NP_288377.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 EDL933]
 gi|15831908|ref|NP_310681.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 str. Sakai]
 gi|168751842|ref|ZP_02776864.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4113]
 gi|168758227|ref|ZP_02783234.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4401]
 gi|168771520|ref|ZP_02796527.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4486]
 gi|168777340|ref|ZP_02802347.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4196]
 gi|168790328|ref|ZP_02815335.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC869]
 gi|168802260|ref|ZP_02827267.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC508]
 gi|195939220|ref|ZP_03084602.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 str. EC4024]
 gi|208810274|ref|ZP_03252150.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4206]
 gi|208816575|ref|ZP_03257695.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4045]
 gi|208820421|ref|ZP_03260741.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4042]
 gi|209399275|ref|YP_002271030.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4115]
 gi|217329032|ref|ZP_03445113.1| regulatory protein SdiA [Escherichia coli O157:H7 str. TW14588]
 gi|254793566|ref|YP_003078403.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 str. TW14359]
 gi|261227589|ref|ZP_05941870.1| DNA-binding transcriptional activator [Escherichia coli O157:H7
           str. FRIK2000]
 gi|261255819|ref|ZP_05948352.1| DNA-binding transcriptional activator [Escherichia coli O157:H7
           str. FRIK966]
 gi|291283093|ref|YP_003499911.1| DNA-binding transcriptional activator [Escherichia coli O55:H7 str.
           CB9615]
 gi|12516014|gb|AAG56931.1|AE005414_8 transcriptional regulator of ftsQAZ gene cluster [Escherichia coli
           O157:H7 str. EDL933]
 gi|13362122|dbj|BAB36077.1| transcriptional regulator of ftsQAZ gene cluster [Escherichia coli
           O157:H7 str. Sakai]
 gi|187767387|gb|EDU31231.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4196]
 gi|188014167|gb|EDU52289.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4113]
 gi|189354905|gb|EDU73324.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4401]
 gi|189359736|gb|EDU78155.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4486]
 gi|189370214|gb|EDU88630.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC869]
 gi|189375707|gb|EDU94123.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC508]
 gi|208724790|gb|EDZ74497.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4206]
 gi|208730918|gb|EDZ79607.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4045]
 gi|208740544|gb|EDZ88226.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4042]
 gi|209160675|gb|ACI38108.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4115]
 gi|209767028|gb|ACI81826.1| transcriptional regulator of ftsQAZ gene cluster [Escherichia coli]
 gi|209767030|gb|ACI81827.1| transcriptional regulator of ftsQAZ gene cluster [Escherichia coli]
 gi|209767032|gb|ACI81828.1| transcriptional regulator of ftsQAZ gene cluster [Escherichia coli]
 gi|209767034|gb|ACI81829.1| transcriptional regulator of ftsQAZ gene cluster [Escherichia coli]
 gi|209767036|gb|ACI81830.1| transcriptional regulator of ftsQAZ gene cluster [Escherichia coli]
 gi|217318379|gb|EEC26806.1| regulatory protein SdiA [Escherichia coli O157:H7 str. TW14588]
 gi|254592966|gb|ACT72327.1| DNA-binding transcriptional activator [Escherichia coli O157:H7
           str. TW14359]
 gi|290762966|gb|ADD56927.1| DNA-binding transcriptional activator [Escherichia coli O55:H7 str.
           CB9615]
 gi|320647124|gb|EFX15957.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H- str. 493-89]
 gi|320658009|gb|EFX25771.1| DNA-binding transcriptional activator SdiA [Escherichia coli O55:H7
           str. 3256-97 TW 07815]
 gi|320658581|gb|EFX26275.1| DNA-binding transcriptional activator SdiA [Escherichia coli O55:H7
           str. USDA 5905]
 gi|320668479|gb|EFX35306.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 str. LSU-61]
 gi|326342324|gb|EGD66105.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 str. 1044]
 gi|326344831|gb|EGD68578.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 str. 1125]
          Length = 240

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 85/235 (36%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++   +  Y++      P  +  +    NY       
Sbjct: 14  LLRFQRMETAEEVYHEIELQAQQLE---YDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSY 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W          +  Q             G+   + L
Sbjct: 71  YQAKNFLAIDPVLNPENFSQGHLMWNDDLF-----NEAQPLWEAARAHGLRRGVTQYLML 125

Query: 125 GFHKNGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F      E  +L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 126 PNRALGFLSFSRCSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 186 EILRWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|59940115|gb|AAX12596.1| LuxR-type transcriptional regulator [Aeromonas veronii]
          Length = 260

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 48/231 (20%), Positives = 87/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQ-EETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  ++     ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLEGRARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940039|gb|AAX12558.1| LuxR-type transcriptional regulator [Aeromonas media]
          Length = 260

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 49/211 (23%), Positives = 85/211 (40%), Gaps = 9/211 (4%)

Query: 32  NFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQS 91
            +  Y     L    +++ +   +           +      D  +    +  LPI W  
Sbjct: 34  GYDYYRFALILPTSMQRRKVVLFNQCPDSWVQAYTVNNMLACDPIIQLARTQTLPIYWNR 93

Query: 92  IQE-ETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIE-- 148
           + E    ++      + L        GI+FP+     +NG + F +     ++++++E  
Sbjct: 94  LDEKARFLQEGSMDVMGLAAEFGLRNGISFPLHGAAGENGILSFIT-RERASSDLLLESS 152

Query: 149 --AHGACYQVITDFLELFK---KRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVH 203
                    +    + + +   +       LTERET CL  A DG TS EIA  LG++  
Sbjct: 153 PILSWMSNYIFEAAIRIVRQSMREDDPQEALTERETECLFWASDGKTSGEIACILGITER 212

Query: 204 TVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 213 TVNYHLNQVTRKTGSMNRYQAIAKRVSSGIL 243


>gi|256022426|ref|ZP_05436291.1| DNA-binding transcriptional activator SdiA [Escherichia sp.
           4_1_40B]
          Length = 240

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 85/235 (36%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++   +  Y++      P  +  +    NY       
Sbjct: 14  LLRFQRMETAEEVYHEIELQAQQLE---YDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSY 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W          +  Q             G+   + L
Sbjct: 71  YQAKNFLAIDPVLNPENFSQGHLMWNDDLF-----NEAQPLWEAARAHGLRRGVTQYLML 125

Query: 125 GFHKNGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F      E  +L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 126 PNRALGFLSFSRCSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|172064983|ref|YP_001815695.1| LuxR family transcriptional regulator [Burkholderia ambifaria
           MC40-6]
 gi|171997225|gb|ACB68142.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           MC40-6]
          Length = 239

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 47/234 (20%), Positives = 73/234 (31%), Gaps = 15/234 (6%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
           + ++  +  E       +   ++A  F  Y     +  P  +  I    NY         
Sbjct: 11  SLEQVKTASEAFD---NLAPAVRALGFEYYAYVLRITIPITRPAIMGWSNYPEAWRTHYT 67

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                + D  L +  +   P+ W                 R         G +   R   
Sbjct: 68  QRDYQHADPVLHYGQACTRPMPW------PGPLPGYDAFWRDAAAFGLCYGWSQTTRDHR 121

Query: 127 HKNGYVIFTSEFLMLANEVII----EAHGACYQVITDF--LELFKKRSSAARNLTERETS 180
              G V        +A + +     E    C  V      L +     S A  L+ RE  
Sbjct: 122 GAMGTVSLVRGGPPIAPDELRRTEPEMIWFCQFVHATMSNLIVSDVMPSGAMRLSLREKQ 181

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            L    +G T+ E+A  L LS   V  ++ +A  KLDA N+  A  KA   G I
Sbjct: 182 VLHWTAEGKTAAEVAVILQLSERNVGFHIQNAIDKLDAANKTHATVKAAMLGLI 235


>gi|16129863|ref|NP_416426.1| quorum-sensing transcriptional activator [Escherichia coli str.
           K-12 substr. MG1655]
 gi|89108751|ref|AP_002531.1| DNA-binding transcriptional activator [Escherichia coli str. K-12
           substr. W3110]
 gi|170081564|ref|YP_001730884.1| DNA-binding transcriptional activator [Escherichia coli str. K-12
           substr. DH10B]
 gi|238901125|ref|YP_002926921.1| DNA-binding transcriptional activator [Escherichia coli BW2952]
 gi|253773131|ref|YP_003035962.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|2506570|sp|P07026|SDIA_ECOLI RecName: Full=Regulatory protein SdiA
 gi|1736575|dbj|BAA15736.1| DNA-binding transcriptional activator [Escherichia coli str. K12
           substr. W3110]
 gi|1788224|gb|AAC74983.1| quorum-sensing transcriptional activator [Escherichia coli str.
           K-12 substr. MG1655]
 gi|169889399|gb|ACB03106.1| DNA-binding transcriptional activator [Escherichia coli str. K-12
           substr. DH10B]
 gi|238860878|gb|ACR62876.1| DNA-binding transcriptional activator [Escherichia coli BW2952]
 gi|253324175|gb|ACT28777.1| transcriptional regulator, LuxR family [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|260448967|gb|ACX39389.1| transcriptional regulator, LuxR family [Escherichia coli DH1]
 gi|315136553|dbj|BAJ43712.1| DNA-binding transcriptional activator SdiA [Escherichia coli DH1]
          Length = 240

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 84/235 (35%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++   +  Y++      P  +  +    NY       
Sbjct: 14  LLRFQRMETAEEVYHEIELQAQQLE---YDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSY 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W             Q             G+   + L
Sbjct: 71  YQAKNFLAIDPVLNPENFSQGHLMWNDDLFS-----EAQPLWEAARAHGLRRGVTQYLML 125

Query: 125 GFHKNGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F      E  +L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 126 PNRALGFLSFSRCSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 186 EILRWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|109896689|ref|YP_659944.1| LuxR family transcriptional regulator [Pseudoalteromonas atlantica
           T6c]
 gi|109698970|gb|ABG38890.1| transcriptional regulator, LuxR family [Pseudoalteromonas atlantica
           T6c]
          Length = 248

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 55/239 (23%), Positives = 91/239 (38%), Gaps = 10/239 (4%)

Query: 3   ENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSG 62
           E   +  +SSS+  L          I    + L  I     +      I  + NY     
Sbjct: 9   ELLESVDESSSIDALKETCERFCQLIDIPFYLLGVIGQTSSYS---PTIRVISNYPEKWL 65

Query: 63  DIPNILIETYGDDFLFHFNSGLLPIIWQSI-QEETVIESSGQLSVRLEGGLLPFAGIAFP 121
           +      E   D  + +      PI W  + + +    + G L          + G++ P
Sbjct: 66  EFYFKESEQQNDPVVKYIFEKQSPIRWDKLVEYQDFSSTKGLLVFEKAAAYGLYNGLSIP 125

Query: 122 VRLGFHKNGYVIFTSEFLMLANEVIIEAHGACY----QVITDFLELFKKRSSAARN--LT 175
           +R             +    AN V+  A   C+     +   ++ L    S       LT
Sbjct: 126 IRSTSENIAVFSVAIDERSDANRVLDNAQMFCHTFATHLFERYVLLEISASDETDRRELT 185

Query: 176 ERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +RE  CL  A +G T+ EI++ + +S  TV  +LG++  KL A+NR  A+A AI+ G I
Sbjct: 186 KRELECLFWACEGKTAWEISQIINVSERTVLFHLGNSNTKLGAINRQHAVALAIKKGII 244


>gi|237731962|ref|ZP_04562443.1| DNA-binding transcriptional activator SdiA [Citrobacter sp. 30_2]
 gi|226907501|gb|EEH93419.1| DNA-binding transcriptional activator SdiA [Citrobacter sp. 30_2]
          Length = 240

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 36/235 (15%), Positives = 72/235 (30%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++ ++ +++   L      ++   F  Y +      P  +        Y       
Sbjct: 14  LLRFQEMATAEDVYTELQQQTQHLE---FDFYALCVRHPVPFTRPKTSLHTTYPKAWVAH 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L              +     +    Q             G+   + L
Sbjct: 71  YQSENYFAIDPVLK-----PENFSQGHLPWNDTLFRDAQPLWDAARNHGLRKGMTQCLML 125

Query: 125 GFHKNGYVIFTSEFLM----LANEVIIEAHGACYQVITDFLELFKK-RSSAARNLTERET 179
                G++  +   +      ++EV +       + ++    L      +     ++RE 
Sbjct: 126 PNRALGFLSVSRASIRNSRLASDEVELRMQLLVRESLSVLTRLEDDMVMAPEMRFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K +A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|254465085|ref|ZP_05078496.1| autoinducer-binding transcriptional regulator LuxR [Rhodobacterales
           bacterium Y4I]
 gi|206685993|gb|EDZ46475.1| autoinducer-binding transcriptional regulator LuxR [Rhodobacterales
           bacterium Y4I]
          Length = 251

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 43/228 (18%), Positives = 80/228 (35%), Gaps = 15/228 (6%)

Query: 13  SLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETY 72
           +L+ L   +  +       +     + +A +             Y             + 
Sbjct: 31  TLEGLQLIVEQVCEVFGVDHAMYLWVETAGNH-------YYFGTYSEAWTGRYLDKAYSR 83

Query: 73  GDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYV 132
            D  +        P+ W+ +      + + +         +   G A P+R    +    
Sbjct: 84  VDPVVVGCYQRFHPVDWKRLDW--NPKPAREFLKDAMEHGVGNQGYAIPIRGPNGQFALF 141

Query: 133 IFTSEFLMLANEVI-----IEAHGACYQVITDFLELFKKRSSA-ARNLTERETSCLQLAG 186
             +      A E +      +     +      LEL   R++  A+ L+ RE   L L  
Sbjct: 142 TLSHNCGDAAWEKLVAKYNRDFILVAHYFNRKVLELEPSRTAEHAQPLSPREVDALTLLA 201

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            GY+  ++A+ L +S HT+  Y+ SA  KL A+N   AIA+A+  G I
Sbjct: 202 IGYSRAQVAQTLAISEHTLRVYIESARFKLGAINTTHAIARAVSLGLI 249


>gi|325496964|gb|EGC94823.1| DNA-binding transcriptional activator SdiA [Escherichia fergusonii
           ECD227]
          Length = 240

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 79/231 (34%), Gaps = 13/231 (5%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++ +S +++   L L   +++   F  Y++      P  +  +     Y           
Sbjct: 18  QEMASAEDVFQELQLQTQKLE---FDYYSLCVRHPVPFTRPKVAYYSTYPEAWVSYYQQH 74

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  L   N     ++W             Q             G+   + L    
Sbjct: 75  NFLAIDPVLKPENFSQGHLLWDDALFS-----EAQPLWDAARAHGLRRGVTQYLMLSNRA 129

Query: 129 NGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERETSCLQ 183
            G++        E  +  +E+ ++      + +     L  +   + A   ++RET  L+
Sbjct: 130 LGFLSLSRMSAREGPIAHDELELKLQLLVRESLNVLARLQHEMVMTPAMRFSKRETEILR 189

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              +G TS EIA  L +S +TVN +  +   K +A N+ Q    A   G I
Sbjct: 190 WTAEGKTSAEIAMILSISENTVNFHQKNMQKKFNAPNKTQVACYAAATGII 240


>gi|92109564|ref|YP_571851.1| LuxR family transcriptional regulator [Nitrobacter hamburgensis
           X14]
 gi|91802646|gb|ABE65019.1| transcriptional regulator, LuxR family [Nitrobacter hamburgensis
           X14]
          Length = 231

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 44/227 (19%), Positives = 78/227 (34%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNI 67
            +++ +  E+   L  +             + +        +       +     D  + 
Sbjct: 4   VEQTRTAAEIEDCLLGLAAEFGFTGLFGGIVPTRPAPLAELRSRILFQRFPAQWLDRYSR 63

Query: 68  LIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
               + D  + H      P  W    +     S+ +L            G   P+     
Sbjct: 64  KGYVFRDPIIQHLFHERTPFTWHEGYKSCPQRSNVRLIQGEAAEFGLRDGYVVPISTIDG 123

Query: 128 KNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGD 187
           +   + F     + A+  +   + A    +   L           NLT RE  CL  AG+
Sbjct: 124 EIVSLSFGGPGTLPASADLSVLNFAASYALGRHLHRIATWRRVNSNLTAREWDCLLWAGE 183

Query: 188 GYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           G T+ EI+  LG+S  TV  ++ +A  KL AV++  AIA AIR   +
Sbjct: 184 GKTNWEISAILGISKSTVTKHIMAARAKLGAVSKAHAIAMAIRTKLL 230


>gi|296114148|ref|ZP_06832803.1| LuxR family transcriptional regulator [Gluconacetobacter hansenii
           ATCC 23769]
 gi|295979224|gb|EFG85947.1| LuxR family transcriptional regulator [Gluconacetobacter hansenii
           ATCC 23769]
          Length = 237

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 45/227 (19%), Positives = 83/227 (36%), Gaps = 8/227 (3%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           + S ++ +L+     I  ++  ++F        +   R  +       Y  D        
Sbjct: 16  QNSENINQLNAEFRSILTKL--KHFVHTA--GLVHKTRVTECYLIDSTYPDDWMQHYIDN 71

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +       LP  W S+      + +    ++    +   +G A P+ +    
Sbjct: 72  CYQNIDPVIATARHEFLPYGWGSVGVRNKSQKN---MMQEFQDIGFRSGYAVPLPVSPSM 128

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAAR-NLTERETSCLQLAGD 187
              V   S    +          A  Q    ++++    +S    +L++RE  CL     
Sbjct: 129 LLLVGMASNDKEINFRDRTILQIAINQYHACYMQITNGGTSKEDCSLSDRERECLLWVAQ 188

Query: 188 GYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           G  + EI+  L +S +TV  +L +   KL A NRIQA+ +AI  G I
Sbjct: 189 GKNTLEISSILNISDNTVKYHLKNIMQKLGAHNRIQAVVQAINLGLI 235


>gi|6572977|gb|AAF17494.1|AF195615_2 transcriptional activator PhzR [Pseudomonas chlororaphis]
          Length = 241

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 43/226 (19%), Positives = 75/226 (33%), Gaps = 13/226 (5%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++     +    ++   F  +        P  +   C   NY  D             D 
Sbjct: 22  DMQEFTAVTLRVLRELRFDFFAYGMCSVTPFMRPRTCMYGNYPEDWVQRYQAANYAVIDP 81

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
            + H      PI+W +       +                 G+A P      + G +   
Sbjct: 82  TVKHSKVSSAPILWSNELFRGCPD-----LWSEANDSNLCHGLAQPSFNAQGRVGMLSLA 136

Query: 136 SEFLMLANEVIIEAHGACYQVITDF-------LELFKKRSSAARNLTERETSCLQLAGDG 188
            +   ++ +   EA     +            LE   +  +     + RE   L+   DG
Sbjct: 137 RKDNPISLQE-FEALKLMTKAFAAAIHEKISELESDVRVFNTDVEFSGRECDVLRWTADG 195

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            TSEEI   +G+   TVN +  +   K+ A NR+QA++ A+  GYI
Sbjct: 196 KTSEEIGVIMGVCTDTVNYHHRNIQRKIGASNRVQAVSYAVAMGYI 241


>gi|167564011|ref|ZP_02356927.1| transcriptional regulator, LuxR family protein [Burkholderia
           oklahomensis EO147]
 gi|167571156|ref|ZP_02364030.1| transcriptional regulator, LuxR family protein [Burkholderia
           oklahomensis C6786]
          Length = 238

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 46/244 (18%), Positives = 85/244 (34%), Gaps = 16/244 (6%)

Query: 1   MSENTLTGKKSSSLQ-ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDL 59
           M+++ L    S+  + ++   L  I  R+    F  +   +  D  + +  +  + NY +
Sbjct: 1   MTQDILDQTSSAKTERDIHDILSRIAARL---GFDYFFYGTLSDMRKPENPVKTVSNYPM 57

Query: 60  DSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIA 119
              +          D  + H    L+P+ W         + +    +    G    AG +
Sbjct: 58  AWQEKYKSSGYIRIDPVVRHCGHRLIPLQWNDGICHCREQRN---FMEDARGHGLVAGAS 114

Query: 120 FPVRLGFHKNGYVIFTS-------EFLMLANEVIIEAHGACYQVITDFLELFKKRSS--A 170
           FPV     +   +   S                           + + +E    R     
Sbjct: 115 FPVHSRHGEVSILSLASRSAGGTTSLSAKHAPATFAQGALAAAFVREGMERISNRPDHEP 174

Query: 171 ARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIR 230
           +  LT RE  CL+    G +S EIA  LG+S + V  ++     K D  +R  A+ KA+ 
Sbjct: 175 SAPLTHRELECLKWIAAGKSSWEIAMILGISENGVLYHVKKLMAKFDVQSRHLAVLKAMA 234

Query: 231 FGYI 234
            G +
Sbjct: 235 SGVV 238


>gi|241206852|ref|YP_002977948.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860742|gb|ACS58409.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 251

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 80/237 (33%), Gaps = 11/237 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFAL-YTINSALDFPRRQQLICEL-HNYDLDSGDIPN 66
           ++ S+ + +   L  I        + L + +  +      +     L   +      I  
Sbjct: 14  EECSNPEAVITELEQILRGCGFEYYGLPHHLPQSPLQQNPEPWAAALAGRWPEQWPQIYA 73

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRL---EGGLLPFAGIAFPVR 123
                  D  + +      P  W+        ++  +   ++     G     G  FP+ 
Sbjct: 74  AKKYALIDPMVRYLAHAQRPFRWREAMAAFRKDAYHRRMEQMMVDAFGHGLEDGYIFPIH 133

Query: 124 LGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELF------KKRSSAARNLTER 177
                 G +    + + L+   I        +     L+L       +    A   LT R
Sbjct: 134 GRSGILGSLSLAGKPIELSPVEIALLEAVARKAFWRLLDLKGEAQALETVLPADTPLTRR 193

Query: 178 ETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           E   L    +G TS EI++ L +S HTV+ Y+     KL A NR  A+A A R G I
Sbjct: 194 EMEILHYLAEGMTSMEISKMLKISNHTVDWYMNGLQDKLKAKNRQHAVALAFRHGLI 250


>gi|218548547|ref|YP_002382338.1| DNA-binding transcriptional activator SdiA [Escherichia fergusonii
           ATCC 35469]
 gi|218356088|emb|CAQ88705.1| DNA-binding transcriptional activator [Escherichia fergusonii ATCC
           35469]
          Length = 251

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 40/231 (17%), Positives = 78/231 (33%), Gaps = 13/231 (5%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++ +S +++   L     +++   F  Y++      P  +  +     Y           
Sbjct: 29  QEMASAEDVFQELQFQTQKLE---FDYYSLCVRHPVPFTRPKVAYYSTYPEAWVSYYQQH 85

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  L   N     ++W             Q             G+   + L    
Sbjct: 86  NFLAIDPVLKPENFSQGHLLWDDALFS-----EAQPLWDAARAHGLRRGVTQYLMLSNRA 140

Query: 129 NGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERETSCLQ 183
            G++        E  +  +E+ ++      + +     L  +   + A   ++RET  L+
Sbjct: 141 LGFLSLSRMSAREGPIAHDELELKLQLLVRESLNVLARLQHEMVMTPAMRFSKRETEILR 200

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              +G TS EIA  L +S +TVN +  +   K +A N+ Q    A   G I
Sbjct: 201 WTAEGKTSAEIAMILSISENTVNFHQKNMQKKFNAPNKTQVACYAAATGII 251


>gi|59940053|gb|AAX12565.1| LuxR-type transcriptional regulator [Aeromonas schubertii]
          Length = 260

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 50/231 (21%), Positives = 86/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y          ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIFPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  ++E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLEERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +   A   LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDAQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A  G TS EIA  LG++  TVN +L   T K  ++NR QAIA  I  G +
Sbjct: 193 WASRGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAMGISNGIL 243


>gi|220921758|ref|YP_002497059.1| LuxR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219946364|gb|ACL56756.1| transcriptional regulator, LuxR family [Methylobacterium nodulans
           ORS 2060]
          Length = 244

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 43/233 (18%), Positives = 77/233 (33%), Gaps = 1/233 (0%)

Query: 3   ENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSG 62
           E   +  ++++ + +  +L      +   +  L T+      P  ++    +  Y  +  
Sbjct: 11  ELLQSIHRTATPENVRDQLLKKLAGVGVEHVLLATLRICDAVPCDRRPTVFIGTYPDEWA 70

Query: 63  DIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPV 122
                      D  +           W         +   +  +   G      G   P+
Sbjct: 71  RRYYARNYILHDPVVRGVAERASGFAWTDPDLIASDDREARRVLDEAGEFGLHEGFTLPL 130

Query: 123 RLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSA-ARNLTERETSC 181
                    V F  E L L+  V           +   L L   ++ A +  L+ RE   
Sbjct: 131 LTLEGDTAGVSFVGERLDLSPAVRGMLTLVGTYALGQVLLLANGQAEALSEPLSPRERES 190

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           LQ A DG +  EI E +G+S H    +L +   KL   +R  A+A  +R G I
Sbjct: 191 LQWAADGKSDWEIGEAMGISEHGAIRHLRAVRRKLGTTSRAHAVALGLRLGII 243


>gi|222350143|emb|CAX32456.1| LuxR-type regulator [Rhizobium leguminosarum]
          Length = 251

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 45/237 (18%), Positives = 76/237 (32%), Gaps = 11/237 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQL--ICELHNYDLDSGDIPN 66
           ++ S+ + +   L  I +      + L          +  +         +      I  
Sbjct: 14  EECSNPEAVVTELEQILHGCGFEYYGLLRHLPQNPVQQNPESWAAALAGRWPEHWPRIYA 73

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEE---TVIESSGQLSVRLEGGLLPFAGIAFPVR 123
                  D  + +      P  W+           +   +  +    G     G  FP+ 
Sbjct: 74  AKKYALIDPMVRYLGHAQRPFRWREAMAAFHKDAHQRRMEQMMVDAFGHGLEDGYIFPIH 133

Query: 124 LGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELF------KKRSSAARNLTER 177
                   +    + + L+   I        +     L+L       +    A   LT R
Sbjct: 134 GRNGTLASLSLAGKPIELSPVEIALLEAVARKAFWRLLDLKGEAPALETVLPADTPLTRR 193

Query: 178 ETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           E   L    +G TS EI++ L +S HTV+ Y+     KL A NR QA+A A R G I
Sbjct: 194 EMEILHYLAEGMTSMEISKMLKISNHTVDWYMNGLQDKLKAKNRQQAVALAFRHGLI 250


>gi|197263477|ref|ZP_03163551.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197241732|gb|EDY24352.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
          Length = 240

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 40/235 (17%), Positives = 74/235 (31%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++ ++ +++   L     R++   F  Y +      P  +  I     Y       
Sbjct: 14  LLRFQEMAAAEDVYTELQYQTQRLE---FDYYALCVRHPVPFTRPKISLRTTYPQAWVTH 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     + W  +          Q             G+   V L
Sbjct: 71  YQSENYFAIDPVLKPENFRQGHLHWDDVLFH-----EAQAMWDAAQRFGLRRGVTQCVML 125

Query: 125 GFHKNGYVIFTSEFLMLAN----EVIIEAHGACYQVITDFLELFKK-RSSAARNLTERET 179
                G++  +   L  ++    EV +       + ++           +     ++RE 
Sbjct: 126 PNRALGFLSVSRSSLRCSSFTYDEVELRLQLLARESLSALTRFEDDMVMAPEMRFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K +  N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNPPNKTQIACYAAATGLI 240


>gi|76057938|emb|CAJ30486.1| PlaR protein [Burkholderia plantarii]
          Length = 240

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 44/230 (19%), Positives = 70/230 (30%), Gaps = 12/230 (5%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           ++ +      H +    K   F        +  P  Q L+     Y              
Sbjct: 13  NTAENEQQLFHQVSAYSKRLGFEYCCYGIRVPQPGSQPLVEIFDTYPPGWMAHYQARNYI 72

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  +    +    IIW                 R         G+A          G 
Sbjct: 73  EIDPTVRDGAASPNMIIWPDADAAEQPS-----LWRDARDFGMSVGVAQSSWAARGVFGL 127

Query: 132 VIFTSEFLMLANEVIIEAHGACYQVITDFLELFKK------RSSAARNLTERETSCLQLA 185
           +        L    I         +      L  +        +A+ +LT+RE   L   
Sbjct: 128 LTIARRSDRLTPAEINSLTLQANWLANLSHSLMGRFLVPKLSPAASISLTKREREVLSWT 187

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQA-IAKAIRFGYI 234
            +G T+ EI E+L +S  TV  ++ +   KL A N++QA + KAI  G I
Sbjct: 188 SEGRTASEIGEQLNISERTVTFHINNILAKLGAANKVQAVVVKAIGMGLI 237


>gi|193066393|ref|ZP_03047441.1| regulatory protein SdiA [Escherichia coli E22]
 gi|192925978|gb|EDV80624.1| regulatory protein SdiA [Escherichia coli E22]
          Length = 240

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 43/235 (18%), Positives = 85/235 (36%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++   +  Y++      P  +  +    NY       
Sbjct: 14  LLRFQRMEAAEEVYHEIELQAQQLE---YDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSY 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W             Q             G+   + L
Sbjct: 71  YQAKNFLAIDPVLNPENFSQGHLMWNDDLFS-----EAQPLWEAARAHGLRRGVTQYLML 125

Query: 125 GFHKNGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F    T E  +L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 126 PNRALGFLSFSRCSTREIPILSDELQLKMQLLVCESLMALMRLNDEIVMTPEMNFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|13474964|ref|NP_106527.1| hypothetical protein mll8752 [Mesorhizobium loti MAFF303099]
 gi|14025713|dbj|BAB52313.1| mll8752 [Mesorhizobium loti MAFF303099]
          Length = 248

 Score =  152 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 43/228 (18%), Positives = 76/228 (33%), Gaps = 13/228 (5%)

Query: 15  QELSPRLHLIQNRIKARNFALYTINSALDFPRR------QQLICELHNYDLDSGDIPNIL 68
           ++L   L        A NF    I      P +      Q     + NY  +  +    +
Sbjct: 24  EQLFDLLSAF-----ALNFDCPWIAYGPLAPAQKVLKPAQADSAIMLNYPNEWKERYFKM 78

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +     G+  I W  + ++     + +  +         +G+  P+      
Sbjct: 79  GYDKIDPIIKKSRKGVGAIRWSEVYKDASTTDNERRVLDEAATFGLKSGVTVPLHGPAGS 138

Query: 129 NGYVIFTSE-FLMLANEVIIEAHGACYQVITDFLE-LFKKRSSAARNLTERETSCLQLAG 186
              + F         N  +     A         +          ++L+ RE  C+    
Sbjct: 139 FTIMSFAQPWDREFQNRTVTYLQLAALHFHVRVTKGTSSNALKQVQDLSLREKECILWIA 198

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            G +S EI + LG+S +TVN +L +A  KLD  +R  A  KA   G +
Sbjct: 199 RGKSSWEIGKILGISGNTVNFHLKNAMRKLDTASRTVAAIKATSLGIV 246


>gi|163758001|ref|ZP_02165089.1| putative LuxR family transcriptional regulator [Hoeflea
           phototrophica DFL-43]
 gi|162284290|gb|EDQ34573.1| putative LuxR family transcriptional regulator [Hoeflea
           phototrophica DFL-43]
          Length = 253

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 78/224 (34%), Positives = 110/224 (49%), Gaps = 6/224 (2%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           + S  +L P+L  +Q +  A  FA+ +             I            +   L++
Sbjct: 35  AGSTADLFPKLVAMQRQCAAAGFAVMSAREQTLLAAGNLDITMKS---PGCDAMAGPLLK 91

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
           +     L H +S   PI++ +  +           ++ E G      + FPV LG   NG
Sbjct: 92  SQMGFLLRHLDSSPRPILYAANSDAVPSPPPALPLMQTEEG---RTDLLFPVSLGAMGNG 148

Query: 131 YVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYT 190
           Y+ F      + +E++I+ H     ++ + L L    +  A  L ERE  CLQL G+G  
Sbjct: 149 YIGFFGVDGAIDSELLIDLHRKSLAMMRETLRLAFGAAPVADKLNEREIECLQLVGNGMK 208

Query: 191 SEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           SE I E+L LSVHTVNAYLGSAT KLDAVNRIQAIAK+IR G I
Sbjct: 209 SEAIGERLNLSVHTVNAYLGSATTKLDAVNRIQAIAKSIRLGII 252


>gi|144900185|emb|CAM77049.1| regulatory protein, LuxR:Autoinducer-binding [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 242

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 44/227 (19%), Positives = 79/227 (34%), Gaps = 5/227 (2%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
           ++ +   L   L          + A               +   + +Y  +         
Sbjct: 17  RADTAPALMSELKSALVHWGFPHMACGAFGEPERPLDDMSVPAVVVDYPEEWQKYYFEKN 76

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
               D  +       +P  W  +++   + +  +   +         GI  PV       
Sbjct: 77  YVTIDPVITRACQAYVPYRWDQLRD---LTNPQKRMFKEATEAGLRHGITVPVHGPNGSI 133

Query: 130 GYVIFTSEFLMLAN-EVIIEAHGACYQVITDFLELFKKRSSAAR-NLTERETSCLQLAGD 187
                 S    + +   +  A+    QV +  + +    + +A  +LT RE  CL  +  
Sbjct: 134 FVASVASPHTDIDHLRSLSVANVLVTQVYSVLVGMRHPGAPSAPVSLTARERECLIWSAR 193

Query: 188 GYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           G +S +I   L +S +TVN +L +A  KL A  R+ AI KAIR G I
Sbjct: 194 GKSSWDIGVILNISDNTVNFHLKNAMGKLKASTRVLAIVKAIRMGLI 240


>gi|320198610|gb|EFW73210.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           EC4100B]
          Length = 240

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 85/235 (36%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++   +  Y++      P  +  +    NY     + 
Sbjct: 14  LLRFQRMETAEEVYHEIELQAQQLE---YDYYSLCVRHPVPFTRPKVAFYTNYPEAWVNY 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W             Q             G+   + L
Sbjct: 71  YQAKNFLAIDPVLNPENFSQGHLMWNDDLFS-----EAQPLWEAARAHGLRRGVTQYLML 125

Query: 125 GFHKNGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F      E  +L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 126 PNRALGFLSFSRCSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|306850701|gb|ADN06870.1| transcriptional activator PhzR [Pseudomonas sp. CMR12a]
          Length = 241

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 46/232 (19%), Positives = 72/232 (31%), Gaps = 14/232 (6%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
            ++S  +E           +    FA  T +     P  +       NY           
Sbjct: 18  SQASDTEEFKGIAMGALQELDFDFFAYGTCSVT---PFMRPKTSIYSNYPEPWVQRYQAQ 74

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  + H      PI+W +       +                 G+A P      +
Sbjct: 75  NYALIDPTVKHSKLSSAPILWGNELFRECPQ-----LWSEARDSNLCHGLAQPSFNAQGR 129

Query: 129 NGYVIFTSEFLMLANEVIIEAH----GACYQVITDFLELFKKRSS--AARNLTERETSCL 182
            G +        ++ E                     EL    SS       + RE   L
Sbjct: 130 VGLLSLARRNKAISAEEFEALKPVTKAFAMAAHEKLSELENDDSSLNVQVEFSGRECDVL 189

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +   DG TSEEI   +G+   TVN +  +   K+ A NR+QA++ A+  GYI
Sbjct: 190 RWTADGKTSEEIGVIMGVCTDTVNYHHRNIQRKIGASNRVQAVSYAVALGYI 241


>gi|325293644|ref|YP_004279508.1| transcriptional regulator, LuxR family [Agrobacterium sp. H13-3]
 gi|325061497|gb|ADY65188.1| transcriptional regulator, LuxR family [Agrobacterium sp. H13-3]
          Length = 238

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 53/220 (24%), Positives = 88/220 (40%), Gaps = 2/220 (0%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGD- 74
           +    L  +Q  ++A +++  T+           L   + +                 D 
Sbjct: 19  DRPQWLAALQQVMQAFSYSYVTLLKLPSIRNAYALPIVVESSLPVWVVNAMTRDGELADC 78

Query: 75  DFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
             +    S ++P  W    ++    S  ++S  L G +   +G+  PV         + F
Sbjct: 79  PVIKRGASSMMPQYWSLDDKDINCGSLLEVSTLLRG-MGITSGLLVPVNGMDGNRHLMNF 137

Query: 135 TSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEI 194
             +  +L+   + E        +  +  L +  S     LT+RE   ++    G TS EI
Sbjct: 138 AGDCDVLSQGSLNELCMIALHALEAYDRLCRAGSKLPSPLTKRELDVVRWTAQGKTSVEI 197

Query: 195 AEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           AE L +S HTVN Y+ +A  KLD VNR Q +AK IR G I
Sbjct: 198 AELLSISEHTVNTYMNNAIRKLDCVNRAQLVAKTIRLGLI 237


>gi|66277268|gb|AAY44565.1| LuxR-like protein [Aeromonas sp. ym2]
          Length = 260

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 48/231 (20%), Positives = 86/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTDNHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGTLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +          LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPILSWMSNYIFEAAIRIVRVSLLEDDPQDALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS +IA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSGDIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSRGIL 243


>gi|330811856|ref|YP_004356318.1| response regulator, NarL family [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379964|gb|AEA71314.1| putative response regulator, NarL family [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 237

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 51/237 (21%), Positives = 77/237 (32%), Gaps = 12/237 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  +K S  ++L     L+ N    + F      + L  P +      L+NY      +
Sbjct: 6   DLLLRKLSCEKDLQTAYRLVLNFFNNQGFEYCAFAAYLGSPDKHTSKVNLNNYPYGWDRL 65

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  + H N   LPI+W         +       R         G    V  
Sbjct: 66  YEQNGYASNDPLVAHCNQSSLPILWDETVFAHAPK-----LWRELNRQGLKYGWTQSVHD 120

Query: 125 GFHK-NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARN------LTER 177
                            +  E      G           L  K+ S A        L+ R
Sbjct: 121 EQGAHCSLFSLARSHCPIDIEEHYANLGYAIFASQRLHALASKKLSDALAIQPKCHLSPR 180

Query: 178 ETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           E   L+ + +G T+ E+   L LS  TVN ++ S   KL+  N+I A+AKA +   I
Sbjct: 181 EIEVLRWSAEGKTASEVGRILCLSERTVNFHVCSCMRKLNVSNKISAVAKAAQIHVI 237


>gi|59940063|gb|AAX12570.1| LuxR-type transcriptional regulator [Aeromonas popoffii]
          Length = 260

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 45/225 (20%), Positives = 83/225 (36%), Gaps = 13/225 (5%)

Query: 22  HLIQNRIKAR----NFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFL 77
             +   I        +  Y     +    ++  +   +                  D  +
Sbjct: 20  DRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHMLACDPII 79

Query: 78  FHFNSGLLPIIWQSIQ-EETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTS 136
                  LPI W  ++     ++      + L        GI+FP+     +NG + F +
Sbjct: 80  QLARKQTLPIYWNRLEGRARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENGILSFIT 139

Query: 137 EFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQLAGDGY 189
                +++++++           +       + +  +       LT+RET CL  A +G 
Sbjct: 140 AE-QASSDLLLDSSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTDRETECLFWASEGK 198

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 199 TSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|66277282|gb|AAY44572.1| LuxR-like protein [Aeromonas popoffii]
          Length = 260

 Score =  152 bits (384), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 44/211 (20%), Positives = 81/211 (38%), Gaps = 9/211 (4%)

Query: 32  NFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQS 91
            +  Y     +    ++  +   +                  D  +       LPI W  
Sbjct: 34  GYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHMLACDPIIQLARKQTLPIYWNR 93

Query: 92  IQ-EETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIE-- 148
           ++     ++      + L        GI+FP+     +NG + F +     +++++++  
Sbjct: 94  LEGRARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENGILSFITAE-QASSDLLLDSS 152

Query: 149 --AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVH 203
                    +       + +  +       LT+RET CL  A +G TS EIA  LG++  
Sbjct: 153 PILSWMSNYIFEAAIRIVRVSLREDDPQEALTDRETECLFWASEGKTSGEIACILGITER 212

Query: 204 TVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 213 TVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|217419193|ref|ZP_03450700.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 576]
 gi|226200253|ref|ZP_03795798.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pakistan 9]
 gi|217398497|gb|EEC38512.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 576]
 gi|225927761|gb|EEH23803.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pakistan 9]
          Length = 236

 Score =  151 bits (383), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 41/221 (18%), Positives = 66/221 (29%), Gaps = 9/221 (4%)

Query: 18  SPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFL 77
              + ++        +          FP     I  + NY     +          D  +
Sbjct: 21  QHVISVLTRAAATLGYEYAAYGMRRPFPISNPPILMVSNYPARWQERYIEARFANIDGAV 80

Query: 78  FHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSE 137
                  LP+ W +        +S               G +   R      G +  +  
Sbjct: 81  KAALGSDLPVTWSA-----PANASKSAFWAEALSFGIAHGWSSASRGADGAIGVLTLSRT 135

Query: 138 FLMLANEVIIE----AHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEE 193
              +            H                      +LT RET  L+   DG T+ E
Sbjct: 136 QDPIDTAEKFRNESIVHWLANVAHASMAPFLPAADEFDPDLTRRETDVLKWTADGKTAYE 195

Query: 194 IAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           IA  L +S  TVN ++ +   KL + N+IQA+AKA   G +
Sbjct: 196 IALILSISESTVNFHVKNIVSKLGSTNKIQAVAKAALMGML 236


>gi|324113634|gb|EGC07609.1| autoinducer binding domain-containing protein [Escherichia
           fergusonii B253]
          Length = 251

 Score =  151 bits (383), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 40/231 (17%), Positives = 79/231 (34%), Gaps = 13/231 (5%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++ +S +++   L L   +++   F  Y++      P  +  +     Y           
Sbjct: 29  QEMASAEDVFQELQLQTQKLE---FDYYSLCVRHPVPFTRPKVAYYSTYPEAWVSYYQQH 85

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  L   N     ++W             Q             G+   + L    
Sbjct: 86  NFLAIDPVLKPENFSQGHLLWDDALFS-----EAQPLWDAARAHGLRRGVTQYLMLSNRA 140

Query: 129 NGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERETSCLQ 183
            G++        E  +  +E+ ++      + +     +  +   + A   ++RET  L+
Sbjct: 141 LGFLSLSRMSAREGPIAHDELELKLQLLVRESLNVLARVQHEMVMTPAMRFSKRETEILR 200

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              +G TS EIA  L +S +TVN +  +   K +A N+ Q    A   G I
Sbjct: 201 WTAEGKTSAEIAMILSISENTVNFHQKNMQKKFNAPNKTQVACYAAATGII 251


>gi|126458323|ref|YP_001075604.1| ATP-dependent transcriptional regulator LuxR [Burkholderia
           pseudomallei 1106a]
 gi|134283391|ref|ZP_01770091.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 305]
 gi|167723653|ref|ZP_02406889.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei DM98]
 gi|167819785|ref|ZP_02451465.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 91]
 gi|167849631|ref|ZP_02475139.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei B7210]
 gi|167898230|ref|ZP_02485632.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 7894]
 gi|167906588|ref|ZP_02493793.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei NCTC 13177]
 gi|237510070|ref|ZP_04522785.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei MSHR346]
 gi|242312988|ref|ZP_04812005.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1106b]
 gi|254190270|ref|ZP_04896779.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pasteur 52237]
 gi|254193498|ref|ZP_04899932.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei S13]
 gi|254262913|ref|ZP_04953778.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1710a]
 gi|254300529|ref|ZP_04967975.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 406e]
 gi|126232091|gb|ABN95504.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1106a]
 gi|134245140|gb|EBA45234.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 305]
 gi|156105358|gb|ABU49178.1| BpsR2 [Burkholderia pseudomallei]
 gi|157810414|gb|EDO87584.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 406e]
 gi|157937947|gb|EDO93617.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pasteur 52237]
 gi|169650251|gb|EDS82944.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei S13]
 gi|235002275|gb|EEP51699.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei MSHR346]
 gi|242136227|gb|EES22630.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1106b]
 gi|254213915|gb|EET03300.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1710a]
          Length = 236

 Score =  151 bits (383), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 40/221 (18%), Positives = 65/221 (29%), Gaps = 9/221 (4%)

Query: 18  SPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFL 77
              + ++        +          FP     I  + NY     +          D  +
Sbjct: 21  QHVISVLTRAAATLGYEYAAYGMRRPFPISNPPILMVSNYPARWQERYIEARFANIDGAV 80

Query: 78  FHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSE 137
                   P+ W +        +S               G +   R      G +  +  
Sbjct: 81  KAALGSDRPVTWSA-----PANASKSAFWAEALSFGIAHGWSSASRGADGAIGVLTLSRT 135

Query: 138 FLMLANEVIIE----AHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEE 193
              +            H                      +LT RET  L+   DG T+ E
Sbjct: 136 QDPIDTAEKFRNESIVHWLANVAHASMAPFLPAADEFDPDLTRRETDVLKWTADGKTAYE 195

Query: 194 IAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           IA  L +S  TVN ++ +   KL + N+IQA+AKA   G +
Sbjct: 196 IALILSISESTVNFHVKNIVSKLGSTNKIQAVAKAALMGML 236


>gi|330822376|ref|YP_004362597.1| transcriptional regulator, LuxR family [Burkholderia gladioli BSR3]
 gi|327374213|gb|AEA65567.1| transcriptional regulator, LuxR family [Burkholderia gladioli BSR3]
          Length = 237

 Score =  151 bits (383), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 40/231 (17%), Positives = 69/231 (29%), Gaps = 16/231 (6%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           + S  ++   L      +    F   +    + FP          +Y     +       
Sbjct: 15  AKSGHDVFRELSAASREL---GFEHCSFGMRVPFPISNPRYVLQSDYPEAWKERYIRHNY 71

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
              D  + H  +  LP+ WQ+  +    E                 G   P        G
Sbjct: 72  FAVDPTVQHGLTQSLPLTWQADGQTESTE-----FWEEAAHHGLRYGWCMPACCQNGTIG 126

Query: 131 YVIFTSEFLMLANEVII-------EAHGACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
            V        +    ++           A    +   L L +        LT RE   L+
Sbjct: 127 LVTMARSDEPIEERELLCKEYRMLWLASAVNSAMNAHL-LAQSAPEYEVELTCREREALK 185

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +  G T  EI   + +   TV  +L +   KL+A+N+ +A  KA   G +
Sbjct: 186 WSAAGKTYVEIGMIMSVDDRTVKFHLVNTMRKLNAMNKTEAAVKAAMLGLL 236


>gi|283785661|ref|YP_003365526.1| regulatory protein [Citrobacter rodentium ICC168]
 gi|282949115|emb|CBG88722.1| regulatory protein [Citrobacter rodentium ICC168]
          Length = 240

 Score =  151 bits (383), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 40/235 (17%), Positives = 75/235 (31%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++ +S +++   L      ++   F  Y +      P  +  I    +Y       
Sbjct: 14  LLRFQEMASAKDVYSELQRQAQLLE---FDYYALYVRHPVPFTRPRISFQTSYPEAWVSR 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                 +  D  L          I   +     + +  Q             G+   V L
Sbjct: 71  YQAENYSAIDPVLK-----PENFIQGHLPWSDDLFNDAQTLWDAARAHGLRKGVTQCVML 125

Query: 125 GFHKNGYVIFTS----EFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++           +  +EV +       + +     L  +   +     ++RE 
Sbjct: 126 PNRALGFLSVVRASLRSNPIDDDEVELRLQLLVRESLAALSRLEDEMVMAPEMRFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K +A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSYEIAMILSISENTVNFHQKNMQKKFNAPNKTQVACYAAATGLI 240


>gi|53722204|ref|YP_111189.1| N-acyl-homoserine lactone dependent regulatory protein
           [Burkholderia pseudomallei K96243]
 gi|76817623|ref|YP_335301.1| N-acyl-homoserine lactone dependent regulatory protein
           [Burkholderia pseudomallei 1710b]
 gi|126444655|ref|YP_001062648.1| ATP-dependent transcriptional regulator LuxR [Burkholderia
           pseudomallei 668]
 gi|52212618|emb|CAH38644.1| N-acyl-homoserine lactone dependent regulatory protein
           [Burkholderia pseudomallei K96243]
 gi|76582096|gb|ABA51570.1| N-acyl-homoserine lactone dependent regulatory protein
           [Burkholderia pseudomallei 1710b]
 gi|126224146|gb|ABN87651.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 668]
          Length = 234

 Score =  151 bits (383), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 40/221 (18%), Positives = 65/221 (29%), Gaps = 9/221 (4%)

Query: 18  SPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFL 77
              + ++        +          FP     I  + NY     +          D  +
Sbjct: 19  QHVISVLTRAAATLGYEYAAYGMRRPFPISNPPILMVSNYPARWQERYIEARFANIDGAV 78

Query: 78  FHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSE 137
                   P+ W +        +S               G +   R      G +  +  
Sbjct: 79  KAALGSDRPVTWSA-----PANASKSAFWAEALSFGIAHGWSSASRGADGAIGVLTLSRT 133

Query: 138 FLMLANEVIIE----AHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEE 193
              +            H                      +LT RET  L+   DG T+ E
Sbjct: 134 QDPIDTAEKFRNESIVHWLANVAHASMAPFLPAADEFDPDLTRRETDVLKWTADGKTAYE 193

Query: 194 IAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           IA  L +S  TVN ++ +   KL + N+IQA+AKA   G +
Sbjct: 194 IALILSISESTVNFHVKNIVSKLGSTNKIQAVAKAALMGML 234


>gi|320641764|gb|EFX11152.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 str. G5101]
          Length = 240

 Score =  151 bits (383), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 85/235 (36%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++   +  Y++      P  +  +    NY       
Sbjct: 14  LLRFQRMETAEEVYHEIELQAQQLE---YDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSY 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W          +  Q             G+   + L
Sbjct: 71  YQAKNFLAIDPVLNPENFSQGHLMWNDDLF-----NEAQSLWEAARAHGLRRGVTQYLML 125

Query: 125 GFHKNGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F      E  +L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 126 PNRALGFLSFSRCSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 186 EILRWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|312967117|ref|ZP_07781335.1| regulatory protein sdiA [Escherichia coli 2362-75]
 gi|312288581|gb|EFR16483.1| regulatory protein sdiA [Escherichia coli 2362-75]
          Length = 228

 Score =  151 bits (383), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 43/235 (18%), Positives = 85/235 (36%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++   +  Y++      P  +  +    NY       
Sbjct: 2   LLRFQRMEAAEEVYHEIELQAQQLE---YDYYSLCVRHPVPFTRPKVAFYTNYPESWVSY 58

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W             Q             G+   + L
Sbjct: 59  YQAKNFLAIDPVLNPENFSQGHLMWNDDLFS-----EAQPLWEAARAHGLRRGVTQYLML 113

Query: 125 GFHKNGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F    T E  +L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 114 PNRALGFLSFSRCSTREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 173

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 174 EILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 228


>gi|84684996|ref|ZP_01012895.1| autoinducer-binding transcriptional regulator LuxR [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84666728|gb|EAQ13199.1| autoinducer-binding transcriptional regulator LuxR [Rhodobacterales
           bacterium HTCC2654]
          Length = 225

 Score =  151 bits (382), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 78/231 (33%), Gaps = 14/231 (6%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           K + SL+        + +     +   + +NS  +             Y     D    +
Sbjct: 2   KDADSLEAFQAATEQVCDIYGVLHCVYHWVNSDGER-------FGAGTYSSVWVDRYLEM 54

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +F       P  W+ +   T    +  +        L   G + P+     +
Sbjct: 55  DYLRMDPVIFGCFQRFTPANWKDLDWTTKAARA--MLDDALKHGLGNQGYSIPLHGPQGQ 112

Query: 129 NGYVIFTSEFLMLANEVIIE-----AHGACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
                   +         I+          ++     LE       A+ +L+ RE + ++
Sbjct: 113 FALFTLNHQAEDDDWAAFIDINGRDLIVLAHEFNRRALEFEGAEGIASPSLSPRELAAIR 172

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G +  + A +LG+S HT+  Y+ SA  KL A+N   A+A+A+  G I
Sbjct: 173 CLARGLSRAQAAAELGISEHTLRVYIESARHKLGALNTTHAVARALSTGII 223


>gi|188491931|ref|ZP_02999201.1| regulatory protein SdiA [Escherichia coli 53638]
 gi|260855896|ref|YP_003229787.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O26:H11 str. 11368]
 gi|331653323|ref|ZP_08354328.1| regulatory protein SdiA [Escherichia coli M718]
 gi|188487130|gb|EDU62233.1| regulatory protein SdiA [Escherichia coli 53638]
 gi|257754545|dbj|BAI26047.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O26:H11 str. 11368]
 gi|315617861|gb|EFU98459.1| regulatory protein sdiA [Escherichia coli 3431]
 gi|323152751|gb|EFZ39023.1| regulatory protein sdiA [Escherichia coli EPECa14]
 gi|331049421|gb|EGI21493.1| regulatory protein SdiA [Escherichia coli M718]
          Length = 240

 Score =  151 bits (382), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 85/235 (36%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++   +  Y++      P  +  +    NY       
Sbjct: 14  LLRFQRMEAAEEVYHEIELQAQQLE---YDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSY 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W          +  Q             G+   + L
Sbjct: 71  YQAKNFLAIDPVLNPENFSQGHLMWNDDLF-----NEAQPLWEAARAHGLRRGVTQYLML 125

Query: 125 GFHKNGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F      E  +L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 126 PNRALGFLSFSRCSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 186 EILRWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|117624058|ref|YP_852971.1| DNA-binding transcriptional activator SdiA [Escherichia coli APEC
           O1]
 gi|161486200|ref|NP_754222.2| DNA-binding transcriptional activator SdiA [Escherichia coli
           CFT073]
 gi|162138422|ref|YP_541121.2| DNA-binding transcriptional activator SdiA [Escherichia coli UTI89]
 gi|191173269|ref|ZP_03034799.1| regulatory protein SdiA [Escherichia coli F11]
 gi|218558774|ref|YP_002391687.1| DNA-binding transcriptional activator SdiA [Escherichia coli S88]
 gi|218699520|ref|YP_002407149.1| DNA-binding transcriptional activator SdiA [Escherichia coli IAI39]
 gi|227885657|ref|ZP_04003462.1| LuxR family protein [Escherichia coli 83972]
 gi|300982244|ref|ZP_07175956.1| autoinducer binding domain protein [Escherichia coli MS 200-1]
 gi|300993973|ref|ZP_07180620.1| autoinducer binding domain protein [Escherichia coli MS 45-1]
 gi|301050730|ref|ZP_07197588.1| autoinducer binding domain protein [Escherichia coli MS 185-1]
 gi|306814260|ref|ZP_07448426.1| DNA-binding transcriptional activator SdiA [Escherichia coli NC101]
 gi|331647509|ref|ZP_08348601.1| regulatory protein SdiA [Escherichia coli M605]
 gi|115513182|gb|ABJ01257.1| DNA-binding transcriptional activator [Escherichia coli APEC O1]
 gi|190906386|gb|EDV65995.1| regulatory protein SdiA [Escherichia coli F11]
 gi|218365543|emb|CAR03270.1| DNA-binding transcriptional activator [Escherichia coli S88]
 gi|218369506|emb|CAR17273.1| DNA-binding transcriptional activator [Escherichia coli IAI39]
 gi|222033657|emb|CAP76398.1| Regulatory protein sdiA [Escherichia coli LF82]
 gi|227837230|gb|EEJ47696.1| LuxR family protein [Escherichia coli 83972]
 gi|281178978|dbj|BAI55308.1| transcriptional regulator of ftsQAZ gene cluster [Escherichia coli
           SE15]
 gi|294493959|gb|ADE92715.1| regulatory protein SdiA [Escherichia coli IHE3034]
 gi|300297547|gb|EFJ53932.1| autoinducer binding domain protein [Escherichia coli MS 185-1]
 gi|300307314|gb|EFJ61834.1| autoinducer binding domain protein [Escherichia coli MS 200-1]
 gi|300406419|gb|EFJ89957.1| autoinducer binding domain protein [Escherichia coli MS 45-1]
 gi|305852419|gb|EFM52870.1| DNA-binding transcriptional activator SdiA [Escherichia coli NC101]
 gi|307553930|gb|ADN46705.1| DNA-binding transcriptional activator [Escherichia coli ABU 83972]
 gi|307626607|gb|ADN70911.1| DNA-binding transcriptional activator SdiA [Escherichia coli UM146]
 gi|312946508|gb|ADR27335.1| DNA-binding transcriptional activator SdiA [Escherichia coli O83:H1
           str. NRG 857C]
 gi|315286610|gb|EFU46043.1| autoinducer binding domain protein [Escherichia coli MS 110-3]
 gi|315290297|gb|EFU49675.1| autoinducer binding domain protein [Escherichia coli MS 153-1]
 gi|315296532|gb|EFU55829.1| autoinducer binding domain protein [Escherichia coli MS 16-3]
 gi|320194372|gb|EFW69003.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           WV_060327]
 gi|323186796|gb|EFZ72116.1| regulatory protein sdiA [Escherichia coli RN587/1]
 gi|323952411|gb|EGB48284.1| autoinducer binding domain-containing protein [Escherichia coli
           H252]
 gi|323956313|gb|EGB52056.1| autoinducer binding domain-containing protein [Escherichia coli
           H263]
 gi|324007279|gb|EGB76498.1| autoinducer binding domain protein [Escherichia coli MS 57-2]
 gi|324013560|gb|EGB82779.1| autoinducer binding domain protein [Escherichia coli MS 60-1]
 gi|330911724|gb|EGH40234.1| N-3-oxohexanoyl-L-homoserine lactone quorum-sensing transcriptional
           activator [Escherichia coli AA86]
 gi|331043233|gb|EGI15371.1| regulatory protein SdiA [Escherichia coli M605]
          Length = 240

 Score =  151 bits (382), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 43/235 (18%), Positives = 85/235 (36%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++   +  Y++      P  +  +    NY       
Sbjct: 14  LLRFQRMEAAEEVYHEIELQAQQLE---YDYYSLCVRHPVPFTRPKVAFYTNYPESWVSY 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W             Q             G+   + L
Sbjct: 71  YQAKNFLAIDPVLNPENFSQGHLMWNDDLFS-----EAQPLWEAARAHGLRRGVTQYLML 125

Query: 125 GFHKNGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F    T E  +L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 126 PNRALGFLSFSRCSTREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|300935891|ref|ZP_07150848.1| autoinducer binding domain protein [Escherichia coli MS 21-1]
 gi|300458941|gb|EFK22434.1| autoinducer binding domain protein [Escherichia coli MS 21-1]
          Length = 240

 Score =  151 bits (382), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 43/235 (18%), Positives = 85/235 (36%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++   +  Y++      P  +  +    NY       
Sbjct: 14  LLRFQRMEAAEEVYHEIELQAQQLE---YDYYSLCVRHPVPFTRPKVAFYTNYPESWVSY 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W             Q             G+   + L
Sbjct: 71  YQAKKFLAIDPVLNPENFSQGHLMWNDDLFS-----EAQPLWEAARAHGLRRGVTQYLML 125

Query: 125 GFHKNGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F    T E  +L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 126 PNRALGFLSFSRCSTREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|86359580|ref|YP_471472.1| LuxR family transcriptional regulator [Rhizobium etli CFN 42]
 gi|86283682|gb|ABC92745.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli CFN 42]
          Length = 251

 Score =  151 bits (382), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 47/230 (20%), Positives = 76/230 (33%), Gaps = 14/230 (6%)

Query: 19  PRLHLIQNRIKARNFALYTINSALDFPRRQQLICE-----LHNYDLDSGDIPNILIETYG 73
             +  ++  +    F  Y +   L     QQ I          +      I         
Sbjct: 21  AVVAELEQVLHGSGFEYYGLLRHLQQNPAQQNIELRAAPLAGRWPEQWLQIYAAKKYVRI 80

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRL---EGGLLPFAGIAFPVRLGFHKNG 130
           D  + +      P  W+        ++  +   ++     G     G  FP+       G
Sbjct: 81  DPMVRYLAHAQRPFRWRESMAAFDGDAHQRRMEQMMVDAFGHGLEDGYLFPIHGRNGILG 140

Query: 131 YVIFTSEFLMLANEVIIEAHGACYQVITDFLELF------KKRSSAARNLTERETSCLQL 184
            +    + + L+   I        +     L+L       +        LT RE   L  
Sbjct: 141 SLTLGGKPIDLSPVEIALLEAVARKSFWRLLDLTGEAEALETVLPTETPLTRREMEILHY 200

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             +G TS EI++ L +S HTV+ Y+     KL A NR QA+A A R G I
Sbjct: 201 LAEGMTSMEISKMLKISNHTVDWYMNGLQNKLKAKNRQQAVALAFRHGLI 250


>gi|59940059|gb|AAX12568.1| LuxR-type transcriptional regulator [Aeromonas allosaccharophila]
          Length = 260

 Score =  151 bits (382), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 47/231 (20%), Positives = 85/231 (36%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPILSWMSNYIFEAAIRIVRVSLRDDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TV  +L   T K  ++ R QAIAK +  G +
Sbjct: 193 WASEGKTSSEIACILGITERTVIYHLNQVTRKTGSMTRYQAIAKGVSSGIL 243


>gi|301018234|ref|ZP_07182749.1| autoinducer binding domain protein [Escherichia coli MS 69-1]
 gi|300399821|gb|EFJ83359.1| autoinducer binding domain protein [Escherichia coli MS 69-1]
          Length = 240

 Score =  151 bits (382), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 41/235 (17%), Positives = 83/235 (35%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++      Y++      P  +  +    NY       
Sbjct: 14  LLRFQRMEAAEEVYHEIELQAQQLEYD---YYSLCVRHPVPFTRPKVAFYTNYPEAWVSY 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W             Q             G+   + L
Sbjct: 71  YQAKNFLAIDPVLNPENFSQGHLMWNDDLFS-----EAQPLWEAARAHGLRRGVTQYLML 125

Query: 125 GFHKNGYVIFTSEF----LMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F+        +L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 126 PNRALGFLSFSRSSVREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|319943177|ref|ZP_08017460.1| autoinducer-binding transcriptional regulator [Lautropia mirabilis
           ATCC 51599]
 gi|319743719|gb|EFV96123.1| autoinducer-binding transcriptional regulator [Lautropia mirabilis
           ATCC 51599]
          Length = 236

 Score =  151 bits (382), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 43/234 (18%), Positives = 81/234 (34%), Gaps = 17/234 (7%)

Query: 6   LTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIP 65
           ++G  +S  +        IQ   +A  F   +       P  +     L++Y  D     
Sbjct: 12  VSGDSASERE----VFECIQRASRALGFQHVSYGFQAPLPLSRPKFTWLNDYPGDWQTHY 67

Query: 66  NILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLG 125
                   D  +        P IW       V E                 G +      
Sbjct: 68  MDAGYPAVDPRIIRARQSSEPFIWNETLFSEVPE-----LWADLQARGIQHGWSQSTLHE 122

Query: 126 FHKNGYVIFTSEFLMLANEV------IIEAHGACYQVITDFLELFKKRSSAARNLTERET 179
               G +       +   ++      +       ++  +  +    + +S A +LTERE 
Sbjct: 123 PGGIGMLSLCRSTPITEQDLQTRLQHMQWLALLAHKAFSKLIRA--RIASNAPSLTEREL 180

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGY 233
             L+   DG ++++IAE L LS +TV+ ++ ++  KLD  N+  A+ +A+  G 
Sbjct: 181 EVLRWTADGKSAQDIAEILLLSKNTVDFHIRNSINKLDVPNKTAAVVRAVLLGL 234


>gi|227821018|ref|YP_002824988.1| putative LuxR/GerE family transcriptional regulator [Sinorhizobium
           fredii NGR234]
 gi|227340017|gb|ACP24235.1| putative LuxR/GerE family transcriptional regulator [Sinorhizobium
           fredii NGR234]
          Length = 246

 Score =  151 bits (382), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 47/221 (21%), Positives = 92/221 (41%), Gaps = 3/221 (1%)

Query: 15  QELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGD 74
            ++   L  I +    R F +  I  +       Q    L ++ ++     +      G 
Sbjct: 27  DDVKRVLDQISDAFGFRGFMVLAIPDSGCHSLAAQ--ALLTSWPMEFLRRYDSAGLIEGS 84

Query: 75  DFLFHFNSGLLPIIWQS-IQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
             +       +P  + + +     ++  G+ ++ +        G+  PV         + 
Sbjct: 85  PVIQRLRRSTIPFTYDAHLLARRRVDGKGEAAISVFEAAGMPRGLYLPVHDAKGGRAAIA 144

Query: 134 FTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEE 193
           F  +  +++++ +   +     + +   E+         +L+ RE  CL+ A  G T+ E
Sbjct: 145 FGGDREVVSSDEMQALNFWAGLLYSRLSEVRTHDRRRPGSLSRREIECLRWAAAGKTTVE 204

Query: 194 IAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +A  + LS +TVN YL  AT KLD+VNR+Q +AKA+R G I
Sbjct: 205 MARIMALSEYTVNHYLNRATRKLDSVNRVQTVAKAMRAGLI 245


>gi|190893853|ref|YP_001980395.1| transcriptional regulator protein, LuxR family [Rhizobium etli CIAT
           652]
 gi|190699132|gb|ACE93217.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli CIAT 652]
          Length = 251

 Score =  151 bits (381), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 47/230 (20%), Positives = 76/230 (33%), Gaps = 14/230 (6%)

Query: 19  PRLHLIQNRIKARNFALYTINSALDFPRRQ-----QLICELHNYDLDSGDIPNILIETYG 73
             ++ ++  +    F  Y +   L     Q     +       +      I         
Sbjct: 21  AVVNELEQVLHGSGFEYYGLLRHLQQTPAQQNSELRAAPLAGRWPERWLQIYAAKKYIRI 80

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRL---EGGLLPFAGIAFPVRLGFHKNG 130
           D  + +      P  W+        ++  +   ++     G     G  FP+       G
Sbjct: 81  DPMVRYLTHAQRPFRWRESMAAFNSDAHRRRMEQMMVDAFGHGLEDGYLFPIHGRNGILG 140

Query: 131 YVIFTSEFLMLANEVIIEAHGACYQVITDFLELF------KKRSSAARNLTERETSCLQL 184
            +      + L+   I        +     LEL       +    A   LT RE   L  
Sbjct: 141 SLSLGGRPIELSPVEIALLEAVARKTFWRLLELTGEAEALETVLPAETPLTRREMEILHY 200

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             +G TS EI++ L +S HTV+ Y+     KL A NR QA+A A R G I
Sbjct: 201 LAEGMTSMEISKMLKISNHTVDWYMNGLQGKLKAKNRQQAVALAFRHGLI 250


>gi|237705872|ref|ZP_04536353.1| regulatory protein sdiA [Escherichia sp. 3_2_53FAA]
 gi|26108586|gb|AAN80789.1|AE016762_42 Regulatory protein sdiA [Escherichia coli CFT073]
 gi|91072709|gb|ABE07590.1| regulatory protein SdiA [Escherichia coli UTI89]
 gi|226900629|gb|EEH86888.1| regulatory protein sdiA [Escherichia sp. 3_2_53FAA]
          Length = 244

 Score =  151 bits (381), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 43/235 (18%), Positives = 85/235 (36%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++   +  Y++      P  +  +    NY       
Sbjct: 18  LLRFQRMEAAEEVYHEIELQAQQLE---YDYYSLCVRHPVPFTRPKVAFYTNYPESWVSY 74

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W             Q             G+   + L
Sbjct: 75  YQAKNFLAIDPVLNPENFSQGHLMWNDDLFS-----EAQPLWEAARAHGLRRGVTQYLML 129

Query: 125 GFHKNGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F    T E  +L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 130 PNRALGFLSFSRCSTREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 189

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 190 EILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 244


>gi|45453489|gb|AAS65458.1| quorum sensing transcriptional activator [Burkholderia
           thailandensis]
          Length = 239

 Score =  151 bits (381), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 41/238 (17%), Positives = 75/238 (31%), Gaps = 14/238 (5%)

Query: 3   ENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSG 62
           +  L    + + Q+L  ++     R+    F        +  P  + ++     Y     
Sbjct: 7   DAYLQFSAAENEQQLFQQIAAYTKRL---GFEYCCYGIRVPLPISKPVVAIFDTYPNGWM 63

Query: 63  DIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPV 122
           +    +     D  +         I+W                           G+A   
Sbjct: 64  ERYQEMNYLEVDPTVRDGALSSNMIVWPEASANDATT-----LWSDARDHGLAVGVAQSS 118

Query: 123 RLGFHKNGYVIFTSEFLMLANEVI----IEAHGACYQVITDFLELFKKRSSAAR--NLTE 176
                  G +        L +  I    ++A+       +        + +      LT 
Sbjct: 119 WASRGVFGLLTIARHTDRLTSAEINHLTLQANWLANMSHSLMSRFLVPKLAPESGVALTH 178

Query: 177 RETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           RE   L   G+G T+ EI + L +S  TVN ++ +   KL A N++QA+  AI  G I
Sbjct: 179 REREVLCWTGEGKTACEIGQILSISERTVNFHVNNILDKLGATNKVQAVVNAIAMGLI 236


>gi|291616969|ref|YP_003519711.1| SdiA [Pantoea ananatis LMG 20103]
 gi|291151999|gb|ADD76583.1| SdiA [Pantoea ananatis LMG 20103]
 gi|327393397|dbj|BAK10819.1| cell division activating regulatory protein SdiA [Pantoea ananatis
           AJ13355]
          Length = 240

 Score =  151 bits (381), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 40/238 (16%), Positives = 77/238 (32%), Gaps = 13/238 (5%)

Query: 2   SENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDS 61
           +E     +  ++ Q+L   L   Q+ I++  F  +        P  +  +     Y    
Sbjct: 11  TETENHFQALATTQQLKGLL---QDYIQSLGFDYFAFFIQHRVPFTRPRVYLHDTYPKLW 67

Query: 62  GDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFP 121
                       D  L         + W      +  E       +        +G +  
Sbjct: 68  IKRYKEQNYYAIDPVLQLCLRSGKGVEWTPELFSSAKE-----MWQDACNFGLLSGFSCS 122

Query: 122 VRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAA-----RNLTE 176
                   G +   S+   +     +E     + +    L L ++ +  A      + ++
Sbjct: 123 AMASNRAVGILSIGSKRPFITGSRRVELEVKLHFLAEQSLSLLERLNDEALMVQGNDFSQ 182

Query: 177 RETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           RE   L+   +G TS+EI+  L +S HTVN Y  +   + +  N+ Q    A   G I
Sbjct: 183 RELEILRWTAEGKTSQEISLILSISEHTVNFYQKNMKKRFNVSNKTQIACYAAAIGLI 240


>gi|170683439|ref|YP_001743327.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           SMS-3-5]
 gi|256017886|ref|ZP_05431751.1| DNA-binding transcriptional activator SdiA [Shigella sp. D9]
 gi|307314177|ref|ZP_07593787.1| transcriptional regulator, LuxR family [Escherichia coli W]
 gi|309795974|ref|ZP_07690387.1| autoinducer binding domain protein [Escherichia coli MS 145-7]
 gi|170521157|gb|ACB19335.1| regulatory protein SdiA [Escherichia coli SMS-3-5]
 gi|306906146|gb|EFN36664.1| transcriptional regulator, LuxR family [Escherichia coli W]
 gi|308120424|gb|EFO57686.1| autoinducer binding domain protein [Escherichia coli MS 145-7]
 gi|315061216|gb|ADT75543.1| DNA-binding transcriptional activator [Escherichia coli W]
 gi|323378207|gb|ADX50475.1| transcriptional regulator, LuxR family [Escherichia coli KO11]
 gi|323968333|gb|EGB63740.1| autoinducer binding domain-containing protein [Escherichia coli
           M863]
 gi|327253047|gb|EGE64701.1| regulatory protein sdiA [Escherichia coli STEC_7v]
          Length = 240

 Score =  151 bits (381), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 84/235 (35%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++   +  Y++      P  +  +    NY       
Sbjct: 14  LLRFQRMEAAEEVYHEIELQAQQLE---YDYYSLCVRHPVPFTRPKVAFYTNYPESWVSY 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W             Q             G+   + L
Sbjct: 71  YQAKNFLAIDPVLNPENFSQGHLMWNDDLFS-----EAQPLWEAARAHGLRRGVTQYLML 125

Query: 125 GFHKNGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F      E  +L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 126 PNRALGFLSFSRCSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|218695523|ref|YP_002403190.1| DNA-binding transcriptional activator SdiA [Escherichia coli 55989]
 gi|300904802|ref|ZP_07122630.1| autoinducer binding domain protein [Escherichia coli MS 84-1]
 gi|218352255|emb|CAU98011.1| DNA-binding transcriptional activator [Escherichia coli 55989]
 gi|300403316|gb|EFJ86854.1| autoinducer binding domain protein [Escherichia coli MS 84-1]
 gi|315257253|gb|EFU37221.1| autoinducer binding domain protein [Escherichia coli MS 85-1]
          Length = 240

 Score =  151 bits (381), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 40/235 (17%), Positives = 82/235 (34%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   +     +++   +  Y++      P  +  +    NY       
Sbjct: 14  LLRFQRMEAAEEVYHEIEFQAQQLE---YDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSY 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W             Q             G+   + L
Sbjct: 71  YQAKNFLAIDPVLNPENFSQGHLMWNDDLFS-----EAQPLWEAARAHGLRRGVTQYLML 125

Query: 125 GFHKNGYVIFTSEFLM----LANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F+         L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 126 PNRALGFLSFSRSSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|157161388|ref|YP_001458706.1| DNA-binding transcriptional activator SdiA [Escherichia coli HS]
 gi|170019746|ref|YP_001724700.1| DNA-binding transcriptional activator SdiA [Escherichia coli ATCC
           8739]
 gi|218689909|ref|YP_002398121.1| DNA-binding transcriptional activator SdiA [Escherichia coli ED1a]
 gi|218705411|ref|YP_002412930.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           UMN026]
 gi|300899169|ref|ZP_07117448.1| autoinducer binding domain protein [Escherichia coli MS 198-1]
 gi|300928947|ref|ZP_07144451.1| autoinducer binding domain protein [Escherichia coli MS 187-1]
 gi|331673434|ref|ZP_08374202.1| regulatory protein SdiA [Escherichia coli TA280]
 gi|331683468|ref|ZP_08384069.1| regulatory protein SdiA [Escherichia coli H299]
 gi|157067068|gb|ABV06323.1| regulatory protein SdiA [Escherichia coli HS]
 gi|169754674|gb|ACA77373.1| transcriptional regulator, LuxR family [Escherichia coli ATCC 8739]
 gi|218427473|emb|CAR08247.1| DNA-binding transcriptional activator [Escherichia coli ED1a]
 gi|218432508|emb|CAR13401.1| DNA-binding transcriptional activator [Escherichia coli UMN026]
 gi|300357228|gb|EFJ73098.1| autoinducer binding domain protein [Escherichia coli MS 198-1]
 gi|300463101|gb|EFK26594.1| autoinducer binding domain protein [Escherichia coli MS 187-1]
 gi|331069632|gb|EGI41019.1| regulatory protein SdiA [Escherichia coli TA280]
 gi|331079683|gb|EGI50880.1| regulatory protein SdiA [Escherichia coli H299]
          Length = 240

 Score =  151 bits (381), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 41/235 (17%), Positives = 83/235 (35%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++   +  Y++      P  +  +    NY       
Sbjct: 14  LLRFQRMEAAEEVYHEIELQAQQLE---YDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSY 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W             Q             G+   + L
Sbjct: 71  YQAKNFLAIDPVLNPENFSQGHLMWNDDLFS-----EAQPLWEAARAHGLRRGVTQYLML 125

Query: 125 GFHKNGYVIFTSEFLM----LANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F+         L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 126 PNRALGFLSFSRSSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|331663414|ref|ZP_08364324.1| regulatory protein SdiA [Escherichia coli TA143]
 gi|323977903|gb|EGB72989.1| autoinducer binding domain-containing protein [Escherichia coli
           TW10509]
 gi|331059213|gb|EGI31190.1| regulatory protein SdiA [Escherichia coli TA143]
          Length = 240

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 43/235 (18%), Positives = 85/235 (36%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++   +  Y++      P  +  +    NY       
Sbjct: 14  LLRFQRMEAAEEVYHEIELQAQQLE---YDYYSLCVRHPVPFTRPKVAFYTNYPESWVSY 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W             Q             G+   + L
Sbjct: 71  YQAKNFLAIDPVLNPENFSQGHLMWNDDLFS-----EAQPLWEAARAHGLRRGVTQYLML 125

Query: 125 GFHKNGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F    T E  +L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 126 PNRALGFLSFSRCSTREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|126640216|ref|YP_001083200.1| eR transcriptional regulator [Acinetobacter baumannii ATCC 17978]
          Length = 198

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 43/200 (21%), Positives = 69/200 (34%), Gaps = 9/200 (4%)

Query: 41  ALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIES 100
                  +     L+NY                D  + H    L P++W S   +T  E 
Sbjct: 2   QSPLSIAEPKTIMLNNYPEAWQKRYVERQYVKIDPTVQHCMVSLQPLVWSSQSAKTQAEK 61

Query: 101 SGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIE----AHGACYQV 156
                           G A   R      G +        L+ +         +     V
Sbjct: 62  D---FWEEARSYGLNVGWAQSSRDFIGTRGMLTLARSNDQLSEKEQKAQYTNMYWLTQTV 118

Query: 157 ITDFLELFKKRSSAARNL--TERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATV 214
            +   ++      A  NL  T RE   L+   +G TS EIA+ LG++  TVN +L ++  
Sbjct: 119 HSSIAKIVNDVEFAKFNLYLTNREKEALRWTAEGKTSAEIAQILGVTERTVNFHLSNSMQ 178

Query: 215 KLDAVNRIQAIAKAIRFGYI 234
           KL+  N+I A  +A+  G +
Sbjct: 179 KLNVNNKISAAIRAVMLGLL 198


>gi|301029367|ref|ZP_07192464.1| autoinducer binding domain protein [Escherichia coli MS 196-1]
 gi|301645566|ref|ZP_07245495.1| autoinducer binding domain protein [Escherichia coli MS 146-1]
 gi|307138583|ref|ZP_07497939.1| DNA-binding transcriptional activator SdiA [Escherichia coli H736]
 gi|331642538|ref|ZP_08343673.1| regulatory protein SdiA [Escherichia coli H736]
 gi|299877793|gb|EFI86004.1| autoinducer binding domain protein [Escherichia coli MS 196-1]
 gi|301076098|gb|EFK90904.1| autoinducer binding domain protein [Escherichia coli MS 146-1]
 gi|323186308|gb|EFZ71658.1| regulatory protein sdiA [Escherichia coli 1357]
 gi|323948203|gb|EGB44191.1| autoinducer binding domain-containing protein [Escherichia coli
           H120]
 gi|324017952|gb|EGB87171.1| autoinducer binding domain protein [Escherichia coli MS 117-3]
 gi|324118970|gb|EGC12859.1| autoinducer binding domain-containing protein [Escherichia coli
           E1167]
 gi|331039336|gb|EGI11556.1| regulatory protein SdiA [Escherichia coli H736]
          Length = 240

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 83/235 (35%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++      Y++      P  +  +    NY       
Sbjct: 14  LLRFQRMEAAEEVYHEIELQAQQLEYD---YYSLCVRHPVPFTRPKVAFYTNYPEAWVSY 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W             Q             G+   + L
Sbjct: 71  YQAKNFLAIDPVLNPENFSQGHLMWNDDLFS-----EAQPLWEAARAHGLRRGVTQYLML 125

Query: 125 GFHKNGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F      E  +L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 126 PNRALGFLSFSRCSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|194434963|ref|ZP_03067206.1| regulatory protein SdiA [Shigella dysenteriae 1012]
 gi|194416798|gb|EDX32924.1| regulatory protein SdiA [Shigella dysenteriae 1012]
 gi|320178182|gb|EFW53159.1| DNA-binding transcriptional activator SdiA [Shigella boydii ATCC
           9905]
 gi|332095461|gb|EGJ00482.1| regulatory protein sdiA [Shigella dysenteriae 155-74]
          Length = 240

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 43/235 (18%), Positives = 85/235 (36%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++   +  Y++      P  +  +    NY       
Sbjct: 14  LLRFQRMEAAEEVYHEIELQAQQLE---YDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSY 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W             Q             G+   + L
Sbjct: 71  YQAKNFLAIDPVLNPENFSQGHLMWNDDLFS-----EAQPLWEAARAHGLRRGVTQYLML 125

Query: 125 GFHKNGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F    T E  +L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 126 PNRALGFLSFSRCSTREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 186 EILRWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|74311738|ref|YP_310157.1| DNA-binding transcriptional activator SdiA [Shigella sonnei Ss046]
 gi|82543616|ref|YP_407563.1| DNA-binding transcriptional activator SdiA [Shigella boydii Sb227]
 gi|157156210|ref|YP_001463220.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           E24377A]
 gi|187730097|ref|YP_001879705.1| DNA-binding transcriptional activator SdiA [Shigella boydii CDC
           3083-94]
 gi|193071152|ref|ZP_03052076.1| regulatory protein SdiA [Escherichia coli E110019]
 gi|194439563|ref|ZP_03071636.1| regulatory protein SdiA [Escherichia coli 101-1]
 gi|300822312|ref|ZP_07102453.1| autoinducer binding domain protein [Escherichia coli MS 119-7]
 gi|300917358|ref|ZP_07134027.1| autoinducer binding domain protein [Escherichia coli MS 115-1]
 gi|73855215|gb|AAZ87922.1| transcriptional regulator of ftsQAZ gene cluster [Shigella sonnei
           Ss046]
 gi|81245027|gb|ABB65735.1| transcriptional regulator of ftsQAZ gene cluster [Shigella boydii
           Sb227]
 gi|157078240|gb|ABV17948.1| regulatory protein SdiA [Escherichia coli E24377A]
 gi|187427089|gb|ACD06363.1| regulatory protein SdiA [Shigella boydii CDC 3083-94]
 gi|192955547|gb|EDV86026.1| regulatory protein SdiA [Escherichia coli E110019]
 gi|194421472|gb|EDX37486.1| regulatory protein SdiA [Escherichia coli 101-1]
 gi|300415404|gb|EFJ98714.1| autoinducer binding domain protein [Escherichia coli MS 115-1]
 gi|300525195|gb|EFK46264.1| autoinducer binding domain protein [Escherichia coli MS 119-7]
 gi|309702211|emb|CBJ01527.1| regulatory protein [Escherichia coli ETEC H10407]
 gi|320176080|gb|EFW51148.1| DNA-binding transcriptional activator SdiA [Shigella dysenteriae
           CDC 74-1112]
 gi|323165288|gb|EFZ51076.1| regulatory protein sdiA [Shigella sonnei 53G]
 gi|323174570|gb|EFZ60191.1| regulatory protein sdiA [Escherichia coli LT-68]
 gi|323937191|gb|EGB33471.1| autoinducer binding domain-containing protein [Escherichia coli
           E1520]
 gi|323972721|gb|EGB67922.1| autoinducer binding domain-containing protein [Escherichia coli
           TA007]
 gi|332343642|gb|AEE56976.1| regulatory protein SdiA [Escherichia coli UMNK88]
          Length = 240

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 43/235 (18%), Positives = 85/235 (36%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++   +  Y++      P  +  +    NY       
Sbjct: 14  LLRFQRMEAAEEVYHEIELQAQQLE---YDYYSLCVRHPVPFTRPKVAFYTNYPESWVSY 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W             Q             G+   + L
Sbjct: 71  YQAKNFLAIDPVLNPENFSQGHLMWNDDLFS-----EAQPLWEAAHAHGLRRGVTQYLML 125

Query: 125 GFHKNGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F    T E  +L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 126 PNRALGFLSFSRCSTREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|332278913|ref|ZP_08391326.1| regulatory protein sdiA [Shigella sp. D9]
 gi|332101265|gb|EGJ04611.1| regulatory protein sdiA [Shigella sp. D9]
          Length = 244

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 83/235 (35%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++      Y++      P  +  +    NY       
Sbjct: 18  LLRFQRMEAAEEVYHEIELQAQQLEYD---YYSLCVRHPVPFTRPKVAFYTNYPESWVSY 74

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W             Q             G+   + L
Sbjct: 75  YQAKNFLAIDPVLNPENFSQGHLMWNDDLFS-----EAQPLWEAARAHGLRRGVTQYLML 129

Query: 125 GFHKNGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F      E  +L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 130 PNRALGFLSFSRCSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 189

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 190 EILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 244


>gi|59940037|gb|AAX12557.1| LuxR-type transcriptional regulator [Aeromonas media]
          Length = 260

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 47/234 (20%), Positives = 91/234 (38%), Gaps = 9/234 (3%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           +  + + + S    ++        +  Y     L    +++     +           + 
Sbjct: 11  EHLTMVTDESRLAEVMSRFTVGIGYDDYRFAVILPTSMQRRKEVLFNQCPDSWVQAYTVN 70

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQE-ETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
                D  +    +  LPI W  + E    ++      + L        GI+FP+     
Sbjct: 71  NMLACDPIIQLARTQTLPIYWNRLDEKARFLQEGSMDVMGLAAEFGLRNGISFPLHGATG 130

Query: 128 KNGYVIFTSEFLMLANEVIIE----AHGACYQVITDFLELFK---KRSSAARNLTERETS 180
           ++G + F +     ++++++E           +    + + +   +       LT+RET 
Sbjct: 131 ESGILSFIT-RERASSDLLLESSPILSWMSNYIFEAAIRIVRQSMREEDPQEALTDRETE 189

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           CL  A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 190 CLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|293405402|ref|ZP_06649394.1| regulatory protein sdiA [Escherichia coli FVEC1412]
 gi|298381046|ref|ZP_06990645.1| regulatory protein sdiA [Escherichia coli FVEC1302]
 gi|291427610|gb|EFF00637.1| regulatory protein sdiA [Escherichia coli FVEC1412]
 gi|298278488|gb|EFI20002.1| regulatory protein sdiA [Escherichia coli FVEC1302]
          Length = 244

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 41/235 (17%), Positives = 83/235 (35%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++   +  Y++      P  +  +    NY       
Sbjct: 18  LLRFQRMEAAEEVYHEIELQAQQLE---YDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSY 74

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W             Q             G+   + L
Sbjct: 75  YQAKNFLAIDPVLNPENFSQGHLMWNDDLFS-----EAQPLWEAARAHGLRRGVTQYLML 129

Query: 125 GFHKNGYVIFTSEFLM----LANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F+         L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 130 PNRALGFLSFSRSSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 189

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 190 EILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 244


>gi|300951540|ref|ZP_07165374.1| autoinducer binding domain protein [Escherichia coli MS 116-1]
 gi|300956569|ref|ZP_07168849.1| autoinducer binding domain protein [Escherichia coli MS 175-1]
 gi|300316616|gb|EFJ66400.1| autoinducer binding domain protein [Escherichia coli MS 175-1]
 gi|300449215|gb|EFK12835.1| autoinducer binding domain protein [Escherichia coli MS 116-1]
 gi|323940421|gb|EGB36612.1| autoinducer binding domain-containing protein [Escherichia coli
           E482]
 gi|332089650|gb|EGI94752.1| regulatory protein sdiA [Shigella boydii 5216-82]
          Length = 240

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 40/235 (17%), Positives = 81/235 (34%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   +     +++      Y++      P  +  +    NY       
Sbjct: 14  LLRFQRMEAAEEVYHEIEFQAQQLEYD---YYSLCVRHPVPFTRPKVAFYTNYPEAWVSY 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W             Q             G+   + L
Sbjct: 71  YQAKNFLAIDPVLNPENFSQGHLMWNDDLFS-----EAQPLWEAARAHGLRRGVTQYLML 125

Query: 125 GFHKNGYVIFTSEFLM----LANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F+         L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 126 PNRALGFLSFSRSSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|191168286|ref|ZP_03030079.1| regulatory protein SdiA [Escherichia coli B7A]
 gi|194429919|ref|ZP_03062429.1| regulatory protein SdiA [Escherichia coli B171]
 gi|218554500|ref|YP_002387413.1| DNA-binding transcriptional activator SdiA [Escherichia coli IAI1]
 gi|260844320|ref|YP_003222098.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O103:H2 str. 12009]
 gi|260868508|ref|YP_003234910.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O111:H- str. 11128]
 gi|293410275|ref|ZP_06653851.1| conserved hypothetical protein [Escherichia coli B354]
 gi|300818660|ref|ZP_07098868.1| autoinducer binding domain protein [Escherichia coli MS 107-1]
 gi|300925008|ref|ZP_07140932.1| autoinducer binding domain protein [Escherichia coli MS 182-1]
 gi|301327706|ref|ZP_07220912.1| autoinducer binding domain protein [Escherichia coli MS 78-1]
 gi|331668610|ref|ZP_08369458.1| regulatory protein SdiA [Escherichia coli TA271]
 gi|331677801|ref|ZP_08378476.1| regulatory protein SdiA [Escherichia coli H591]
 gi|190901658|gb|EDV61414.1| regulatory protein SdiA [Escherichia coli B7A]
 gi|194412008|gb|EDX28320.1| regulatory protein SdiA [Escherichia coli B171]
 gi|218361268|emb|CAQ98852.1| DNA-binding transcriptional activator [Escherichia coli IAI1]
 gi|257759467|dbj|BAI30964.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O103:H2 str. 12009]
 gi|257764864|dbj|BAI36359.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O111:H- str. 11128]
 gi|284921829|emb|CBG34902.1| regulatory protein [Escherichia coli 042]
 gi|291470743|gb|EFF13227.1| conserved hypothetical protein [Escherichia coli B354]
 gi|300418843|gb|EFK02154.1| autoinducer binding domain protein [Escherichia coli MS 182-1]
 gi|300528832|gb|EFK49894.1| autoinducer binding domain protein [Escherichia coli MS 107-1]
 gi|300845750|gb|EFK73510.1| autoinducer binding domain protein [Escherichia coli MS 78-1]
 gi|323158600|gb|EFZ44614.1| regulatory protein sdiA [Escherichia coli E128010]
 gi|323180833|gb|EFZ66373.1| regulatory protein sdiA [Escherichia coli 1180]
 gi|331063804|gb|EGI35715.1| regulatory protein SdiA [Escherichia coli TA271]
 gi|331074261|gb|EGI45581.1| regulatory protein SdiA [Escherichia coli H591]
          Length = 240

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 43/235 (18%), Positives = 85/235 (36%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++   +  Y++      P  +  +    NY       
Sbjct: 14  LLRFQRMEAAEEVYHEIELQAQQLE---YDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSY 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W             Q             G+   + L
Sbjct: 71  YQAKNFLAIDPVLNPENFSQGHLMWNDDLFS-----EAQPLWEAARAHGLRRGVTQYLML 125

Query: 125 GFHKNGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F    T E  +L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 126 PNRALGFLSFSRCSTREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|215487121|ref|YP_002329552.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O127:H6 str. E2348/69]
 gi|215265193|emb|CAS09582.1| DNA-binding transcriptional activator [Escherichia coli O127:H6
           str. E2348/69]
          Length = 240

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 43/235 (18%), Positives = 85/235 (36%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++   +  Y++      P  +  +    NY       
Sbjct: 14  LLRFQRMEAAEEVYHEIELQAQQLE---YDYYSLCVRHPVPFTRPKVAFYTNYPESWVSY 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W             Q             G+   + L
Sbjct: 71  YQAKNFLAIDPVLNPENFSQGHLMWNDDLFS-----EAQPLWEAARAHGLRRGVTQYLML 125

Query: 125 GFHKNGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAAR-NLTERET 179
                G++ F    T E  +L++E+ ++      + +   + L  +    +  N ++RE 
Sbjct: 126 PNRALGFLSFSRCSTREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTSEMNFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|157145292|ref|YP_001452611.1| DNA-binding transcriptional activator SdiA [Citrobacter koseri ATCC
           BAA-895]
 gi|157082497|gb|ABV12175.1| hypothetical protein CKO_01029 [Citrobacter koseri ATCC BAA-895]
          Length = 240

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 36/231 (15%), Positives = 73/231 (31%), Gaps = 13/231 (5%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++ ++ +++   L     +++   +  Y +      P  +  I     Y           
Sbjct: 18  QEMATAEDVYTELQHQTQQLE---YDYYALCVRHPVPFTRPKISVHTTYPQAWVAHYQSE 74

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  L              +     + S  Q             G    + L    
Sbjct: 75  NYFSIDPVLK-----PENFRQGHLAWNDALFSEAQSLWDAARAHGLRRGATQCLMLPNRA 129

Query: 129 NGYVIFTS---EFLMLANEVI-IEAHGACYQVITDFLEL-FKKRSSAARNLTERETSCLQ 183
            G++  +         A++ I +       + ++    L  +   +     ++RE   L+
Sbjct: 130 LGFLSVSRASARHAPFAHDEIELRLQLLVRESLSALTRLEDEMVMTPEMRFSKREKEILK 189

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              +G TS EIA  L +S +TVN +  +   K +A N+ Q    A   G I
Sbjct: 190 WTAEGKTSSEIAMILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|312115398|ref|YP_004012994.1| LuxR family transcriptional regulator [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311220527|gb|ADP71895.1| transcriptional regulator, LuxR family [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 251

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 50/235 (21%), Positives = 76/235 (32%), Gaps = 8/235 (3%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
               + S +E+S              +    I                 NY  D  +   
Sbjct: 12  DANAAKSSKEVSALFGKALAVFGYDRYCYSLITDHPSLGLNAGHGLVC-NYPDDWMEHYR 70

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
           +      D    +  S   P  W S+  +          +          GIA PV    
Sbjct: 71  LNQYEKKDPVPQYGISASRPFTWASVVAQRKWHPDQMKVMHEAEEARLCDGIAVPVCGVN 130

Query: 127 HKNGYVIFTSEFLMLANE--VIIEAHGACYQVITDFLELFKKRSSAARNL-----TERET 179
            +       S    ++ +  ++ +      Q    F EL K  +    NL     TERE 
Sbjct: 131 GELAGFGIASSHGGVSPDRTLLHKVQALAIQFHLAFTELEKIETPLTENLAEVYLTEREK 190

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             +  A +G +   IAE LG+S  TV  ++ +   KL+A  R  A  KAIR G I
Sbjct: 191 EIMSWAAEGKSDSVIAEILGVSHSTVRFHMNNVFKKLNANERTLATVKAIRHGLI 245


>gi|59940083|gb|AAX12580.1| LuxR-type transcriptional regulator [Aeromonas schubertii]
          Length = 260

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 48/231 (20%), Positives = 86/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +    +
Sbjct: 193 WASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSAIL 243


>gi|209919338|ref|YP_002293422.1| DNA-binding transcriptional activator SdiA [Escherichia coli SE11]
 gi|293446298|ref|ZP_06662720.1| regulatory protein sdiA [Escherichia coli B088]
 gi|209912597|dbj|BAG77671.1| transcriptional regulator of ftsQAZ gene cluster [Escherichia coli
           SE11]
 gi|291323128|gb|EFE62556.1| regulatory protein sdiA [Escherichia coli B088]
          Length = 244

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 84/235 (35%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++   +  Y++      P  +  +    NY       
Sbjct: 18  LLRFQRMEAAEEVYHEIELQAQQLE---YDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSY 74

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W             Q             G+   + L
Sbjct: 75  YQAKNFLAIDPVLNPENFSQGHLMWNDDLFS-----EAQPLWEAARAHGLRRGVTQYLML 129

Query: 125 GFHKNGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F      E  +L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 130 PNRALGFLSFSRCSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 189

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 190 EILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 244


>gi|90422223|ref|YP_530593.1| LuxR family transcriptional regulator [Rhodopseudomonas palustris
           BisB18]
 gi|90104237|gb|ABD86274.1| transcriptional regulator, LuxR family [Rhodopseudomonas palustris
           BisB18]
          Length = 245

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 35/226 (15%), Positives = 70/226 (30%), Gaps = 2/226 (0%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           + ++S + L   +         R+F +            ++    L ++           
Sbjct: 20  QTTTSPRALIDAVRDAAAAYGYRSFVIAAAPKLACNAFDKR--VLLRHWPEAWFGQYLQD 77

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D    H         W     +   + +  +            G   P+      
Sbjct: 78  NYQDHDPIAAHARQQTRAFCWSDAPWDRSDKKTAAVMDCAAHDYDMRRGFCVPIFGMRGY 137

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDG 188
              + F    +  +              +   + + +  +     L+ RE   +  A  G
Sbjct: 138 EAAISFGGPEIDASPAATAAMELIAIYAMNQLMTMREPPARRQTTLSPREREVVAWAAVG 197

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            T+ + A  L +S  TVN ++ SA  KLDA  + QA+ ++IR G I
Sbjct: 198 KTAWDTARILAISTDTVNKHMASAMRKLDACTKTQAVVESIRRGEI 243


>gi|116254365|ref|YP_770203.1| GerE family transcriptional regulator [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115259013|emb|CAK10122.1| LuxR-family regulator [Rhizobium leguminosarum bv. viciae 3841]
          Length = 251

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 46/231 (19%), Positives = 75/231 (32%), Gaps = 14/231 (6%)

Query: 18  SPRLHLIQNRIKARNFALYTINSALDFPRRQQLIC-----ELHNYDLDSGDIPNILIETY 72
              +  ++  +    F  Y +   L     QQ            +      I        
Sbjct: 20  EAVVTELEQILHGCGFEYYGLPRHLPQTPMQQNPEPWAAALAGRWPEQWPHIYTAKKYAL 79

Query: 73  GDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRL---EGGLLPFAGIAFPVRLGFHKN 129
            D  + +      P  W+        ++  +   ++     G     G  FP+       
Sbjct: 80  IDPMVRYLAHAQRPFRWREAMAAFRKDAYHRRMEQMMVDAFGHGLEDGYIFPIHGRNGIL 139

Query: 130 GYVIFTSEFLMLANEVIIEAHGACYQVITDFLELF------KKRSSAARNLTERETSCLQ 183
             +    + + L+   I        +     L+L       +    A   LT RE   L 
Sbjct: 140 ASLSLAGKPIELSPVEIALLEAVARKAFWRLLDLKGEAQALETVLPADTPLTRREMEILH 199

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              +G TS EI++ L +S HTV+ Y+     KL A NR QA+A A R G I
Sbjct: 200 YLAEGMTSMEISKMLKISNHTVDWYMNGLQDKLKAKNRQQAVALAFRHGLI 250


>gi|167839810|ref|ZP_02466494.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia thailandensis MSMB43]
          Length = 236

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 40/219 (18%), Positives = 65/219 (29%), Gaps = 9/219 (4%)

Query: 20  RLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFH 79
            + ++        +          FP     I  + NY     +          D  +  
Sbjct: 23  VISVLTRAAATLGYEYAAYGMRRPFPISNPQILMVSNYPARWQERYIEARFANVDGAVKA 82

Query: 80  FNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFL 139
                 P+ W +        +S               G +   R      G +  +    
Sbjct: 83  ALGSDRPVTWSA-----PANASKSAFWAEALSFGIAHGWSSASRGADGAIGVLSLSRTQG 137

Query: 140 MLANEVIIE----AHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIA 195
            +            H                      +LT RET  L+   DG T+ EIA
Sbjct: 138 PIDTAEKFRNESIVHWLANVAHASMAPFLPAADEFDPDLTRRETDVLKWTADGKTAYEIA 197

Query: 196 EKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L +S  TVN ++ +   KL + N+IQA+AKA   G +
Sbjct: 198 LILSISESTVNFHVKNIVSKLGSTNKIQAVAKAALMGML 236


>gi|293415226|ref|ZP_06657869.1| regulatory protein sdiA [Escherichia coli B185]
 gi|291432874|gb|EFF05853.1| regulatory protein sdiA [Escherichia coli B185]
          Length = 244

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 83/235 (35%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L    ++   +  Y++      P  +  +    NY       
Sbjct: 18  LLRFQRMEAAEEVYHEIELQAQLLE---YDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSY 74

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W             Q             G+   + L
Sbjct: 75  YQAKNFLAIDPVLNPENFSQGHLMWNDDLFS-----EAQPLWEAARAHGLRRGVTQYLML 129

Query: 125 GFHKNGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F      E  +L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 130 PNRALGFLSFSRCSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 189

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 190 EILRWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 244


>gi|110681100|ref|YP_684107.1| LuxR family transcription regulator [Roseobacter denitrificans OCh
           114]
 gi|109457216|gb|ABG33421.1| transcription regulator, LuxR family, putative [Roseobacter
           denitrificans OCh 114]
          Length = 248

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 43/204 (21%), Positives = 71/204 (34%), Gaps = 4/204 (1%)

Query: 33  FALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSI 92
            + ++ ++    P  + L      Y                D      +    P  W   
Sbjct: 39  VSYHSDDAQ--LPGSKPLGIVSDGYPEGWVCEYLQSELFRVDPIPQLASILSRPFRWSEA 96

Query: 93  QEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI--FTSEFLMLANEVIIEAH 150
            +   +   G+  ++         G+A  V     +N YV   F  +   L  + I E  
Sbjct: 97  PKLMRLSPEGERYMQTLAQSGLGDGVAMQVYGPNMRNAYVGLGFGKQDPDLTADEIFELQ 156

Query: 151 GACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLG 210
            A       + EL + R   A +L+ RE   LQ    G ++  IAE LG+S HTV+    
Sbjct: 157 CAAQIAHIRYCELTEFRQRVAESLSPREVEILQWIARGKSNSVIAEILGISRHTVDTITR 216

Query: 211 SATVKLDAVNRIQAIAKAIRFGYI 234
               KLD  +R  A  + +  G +
Sbjct: 217 RIFEKLDVNDRTTAAIRGLGSGLV 240


>gi|238023440|ref|YP_002907673.1| DNA-binding HTH domain-containing protein [Burkholderia glumae
           BGR1]
 gi|237880493|gb|ACR32822.1| DNA-binding HTH domain-containing protein [Burkholderia glumae
           BGR1]
          Length = 235

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 44/230 (19%), Positives = 77/230 (33%), Gaps = 14/230 (6%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           S S + +  +L    +++    F           P   + +    NY     +    +  
Sbjct: 14  SDSSRVVFDKLVGYASQL---GFDYCCYGFRSPLPVGGESVKVFDNYPNGWMEHYRHMGY 70

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
              D  +    +    I W         ES      +         GIA P        G
Sbjct: 71  IDVDPTVEKAMTCSQTICWPGFD-----ESKQSAFWQDARDHGLKVGIAQPSWSARGAFG 125

Query: 131 YVIFTSEFLMLANEVI----IEAHGACYQVITDFLE--LFKKRSSAARNLTERETSCLQL 184
            +        +    +    ++       V +             AA +LTERE   L+ 
Sbjct: 126 LLSLARGEGEIDGHELKRLSLQLSWITNAVHSAMTAHVFDSLGLGAAISLTERERQVLRW 185

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             +G  + +I+EKL +SV TVN ++G    K  A N++QA A+A+    +
Sbjct: 186 TVEGLNAFDISEKLNISVSTVNWHIGKVLAKFGATNKVQAAARAVALNLL 235


>gi|167839488|ref|ZP_02466172.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           thailandensis MSMB43]
          Length = 239

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 41/238 (17%), Positives = 75/238 (31%), Gaps = 14/238 (5%)

Query: 3   ENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSG 62
           +  L    + + Q+L  ++     R+    F        +  P  + ++     Y     
Sbjct: 7   DAYLQFSAAENEQQLFQQIAAYTKRL---GFEYCCYGIRVPLPISRPVVAIFDTYPNGWM 63

Query: 63  DIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPV 122
           +    +     D  +         I+W                           G+A   
Sbjct: 64  ERYQEMNYLEVDPTVREGALSSNMIVWPEASACDATS-----LWSDARDHGLAVGVAQSS 118

Query: 123 RLGFHKNGYVIFTSEFLMLANEVI----IEAHGACYQVITDFLELFKKRSSAAR--NLTE 176
                  G +        L    I    ++ +       +        + +      LT 
Sbjct: 119 WASRGVFGLLTIARHTDRLTIAEINHLTLQTNWLANMSHSLMSRFLVPKLAPESGVALTH 178

Query: 177 RETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           RE   L   G+G T+ EI + LG+S  TVN ++ +   KL A N++QA+ KAI  G +
Sbjct: 179 REREVLCWTGEGKTACEIGQILGISERTVNFHVNNVLDKLGATNKVQAVVKAIAMGLV 236


>gi|170752129|ref|YP_001758389.1| LuxR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170658651|gb|ACB27706.1| transcriptional regulator, LuxR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 242

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 45/230 (19%), Positives = 83/230 (36%), Gaps = 6/230 (2%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICEL-HNYDLDSGDIP 65
             +++++  E++  L    +R          I      P+R+     L            
Sbjct: 16  DLERAATPDEIARLLVEAFSRYGVSYIM-AGIVPDPGLPKRRHAGFVLASTMPEGWARRY 74

Query: 66  NILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLG 125
                   D  +    +   P  W ++        +    +   G     AGI  P    
Sbjct: 75  VTQGYALHDPTVRRLCTTATPFDWNAVL---PDTPTAGRVMNEAGEFGIRAGITVPFVTL 131

Query: 126 FHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAAR-NLTERETSCLQL 184
             + G +  + E + +     +  +      +   L +  + ++ A   L+ RE   LQ 
Sbjct: 132 DGEPGGISVSGERIEIDPAERVAVNLVATYAVGQLLLMNSRPAAPAPARLSPREREALQW 191

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           A +G T  EI   +G++   V+ +L SA  KLD VNR   +A+A+R G I
Sbjct: 192 AAEGKTDVEIGMVMGITAAGVDYHLRSARAKLDTVNRAHTVAQALRSGLI 241


>gi|311279135|ref|YP_003941366.1| transcriptional regulator, LuxR family [Enterobacter cloacae SCF1]
 gi|308748330|gb|ADO48082.1| transcriptional regulator, LuxR family [Enterobacter cloacae SCF1]
          Length = 240

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 43/233 (18%), Positives = 75/233 (32%), Gaps = 17/233 (7%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           + +SS +E+   L      ++   +A   +      P  +  I     Y           
Sbjct: 18  QLASSSEEIYSILQQQTEMLEYDWYA---LCVRHPVPFTRPKIALQTTYPRAWIAQYQAE 74

Query: 69  IETYGDDFLF--HFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                D  L   ++  G LP  W     +   E                 G+   + L  
Sbjct: 75  NYFTIDPVLKPENYRHGYLP--WTDRLFQDAQE-----FWDAARDHGLRKGVTQCLILPN 127

Query: 127 HKNGYVIFTSEFLMLAN----EVIIEAHGACYQVITDFLELFK-KRSSAARNLTERETSC 181
              G++  + E +        E  +          T  L L      +     ++RE   
Sbjct: 128 RALGFLSVSREGIQKDPLAEDETQMRLQMLAEFSTTALLRLDDSAILTPEMKFSKRELEI 187

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           L+   +G TS EI+  L +S +TVN +  +   K +A N+ Q    A+  G I
Sbjct: 188 LKWTAEGKTSAEISIILSISENTVNFHQKNMQKKFNAPNKTQIACYAVATGLI 240


>gi|312973873|ref|ZP_07788045.1| regulatory protein sdiA [Escherichia coli 1827-70]
 gi|310332468|gb|EFP99703.1| regulatory protein sdiA [Escherichia coli 1827-70]
          Length = 221

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 39/229 (17%), Positives = 79/229 (34%), Gaps = 13/229 (5%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
             + +E+   +     +++   +  Y++      P  +  +    NY             
Sbjct: 1   MEAAEEVYHEIEFQAQQLE---YDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSYYQAKNF 57

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
              D  L   N     ++W             Q             G+   + L     G
Sbjct: 58  LAIDPVLNPENFSQGHLMWNDDLFS-----EAQPLWEAARAHGLRRGVTQYLMLPNRALG 112

Query: 131 YVIFTSEFLM----LANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERETSCLQLA 185
           ++ F+         L++E+ ++      + +   + L  +   +   N ++RE   L+  
Sbjct: 113 FLSFSRSSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREKEILKWT 172

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 173 AEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 221


>gi|15964581|ref|NP_384934.1| putative transcription regulator protein [Sinorhizobium meliloti
           1021]
 gi|307309327|ref|ZP_07588990.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
 gi|307320063|ref|ZP_07599484.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|15073759|emb|CAC45400.1| Putative transcriptional regulator [Sinorhizobium meliloti 1021]
 gi|306894278|gb|EFN25043.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|306900196|gb|EFN30814.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
          Length = 246

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 48/226 (21%), Positives = 91/226 (40%), Gaps = 3/226 (1%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
              S  ++   L  +      R F +  I  +       Q    +  + +D     +   
Sbjct: 22  AIDSEDDVRRALGRVSEGFGFRGFMVLAIPESGSHSLTAQ--ALMTTWPMDFLRRYDSAR 79

Query: 70  ETYGDDFLFHFNSGLLPIIWQS-IQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
              G   +       +P  + + +     ++  G+ ++ +        G+  PV      
Sbjct: 80  LIDGSPVIQRLRRSTIPFTYDAHLLARGRVDGKGEAAICVFEQANMPRGVYLPVHDAAGH 139

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDG 188
              + F  +   ++++ +   +     + +   E+  +      +L+ RE  CL+ A  G
Sbjct: 140 RAAIAFGGDRSAVSDDEMQALNLWAGLLYSRLSEVRTRDRRGPGSLSRREIECLRWAAAG 199

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            T+ E+A  + LS +TVN YL  AT KLD+VNR+Q +AKAIR G I
Sbjct: 200 KTTVEMARIMALSEYTVNHYLNRATRKLDSVNRVQTVAKAIRAGLI 245


>gi|167828172|ref|ZP_02459643.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 9]
          Length = 210

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 41/215 (19%), Positives = 64/215 (29%), Gaps = 9/215 (4%)

Query: 24  IQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSG 83
           +        +          FP     I  + NY     +          D  +      
Sbjct: 1   MTRAAATLGYEYAAYGMRRPFPISNPPILMVSNYPARWQERYIEARFANIDGAVKAALGS 60

Query: 84  LLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLAN 143
            LP+ W +        +S               G +   R      G +  +     +  
Sbjct: 61  DLPVTWSA-----PANASKSAFWAEALSFGIAHGWSSASRGADGAIGVLTLSRTQDPIDT 115

Query: 144 EVIIE----AHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLG 199
                     H                      +LT RET  L+   DG T+ EIA  L 
Sbjct: 116 AEKFRNESIVHWLANVAHASMAPFLPAADEFDPDLTRRETDVLKWTADGKTAYEIALILS 175

Query: 200 LSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +S  TVN ++ +   KL + N+IQA+AKA   G +
Sbjct: 176 ISESTVNFHVKNIVSKLGSTNKIQAVAKAALMGML 210


>gi|53717016|ref|YP_106048.1| ATP-dependent transcription regulator LuxR [Burkholderia mallei
           ATCC 23344]
 gi|67643368|ref|ZP_00442115.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei GB8 horse 4]
 gi|124382942|ref|YP_001025964.1| ATP-dependent transcription regulator LuxR [Burkholderia mallei
           NCTC 10229]
 gi|126445405|ref|YP_001061548.1| ATP-dependent transcriptional regulator LuxR [Burkholderia
           pseudomallei 668]
 gi|126446264|ref|YP_001078053.1| ATP-dependent transcription regulator LuxR [Burkholderia mallei
           NCTC 10247]
 gi|126457742|ref|YP_001074487.1| ATP-dependent transcriptional regulator LuxR [Burkholderia
           pseudomallei 1106a]
 gi|134284195|ref|ZP_01770887.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 305]
 gi|167003599|ref|ZP_02269385.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei PRL-20]
 gi|167741352|ref|ZP_02414126.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 14]
 gi|167818528|ref|ZP_02450208.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 91]
 gi|167826910|ref|ZP_02458381.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 9]
 gi|167848430|ref|ZP_02473938.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei B7210]
 gi|167896980|ref|ZP_02484382.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 7894]
 gi|167905359|ref|ZP_02492564.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei NCTC 13177]
 gi|167921599|ref|ZP_02508690.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei BCC215]
 gi|217423225|ref|ZP_03454727.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 576]
 gi|226194550|ref|ZP_03790147.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pakistan 9]
 gi|237507990|ref|ZP_04520705.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei MSHR346]
 gi|242313995|ref|ZP_04813012.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1106b]
 gi|254176241|ref|ZP_04882899.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei ATCC 10399]
 gi|254189375|ref|ZP_04895885.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pasteur 52237]
 gi|254195237|ref|ZP_04901665.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei S13]
 gi|254200901|ref|ZP_04907266.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei FMH]
 gi|254204867|ref|ZP_04911220.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei JHU]
 gi|254262915|ref|ZP_04953780.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1710a]
 gi|254299430|ref|ZP_04966879.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 406e]
 gi|254358982|ref|ZP_04975254.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei 2002721280]
 gi|52422986|gb|AAU46556.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei ATCC 23344]
 gi|126224896|gb|ABN88401.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 668]
 gi|126231510|gb|ABN94923.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1106a]
 gi|126239118|gb|ABO02230.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei NCTC 10247]
 gi|134244398|gb|EBA44504.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 305]
 gi|147748513|gb|EDK55588.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei FMH]
 gi|147754453|gb|EDK61517.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei JHU]
 gi|148028169|gb|EDK86129.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei 2002721280]
 gi|156105362|gb|ABU49180.1| BpsR4 [Burkholderia pseudomallei]
 gi|157809517|gb|EDO86687.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 406e]
 gi|157937053|gb|EDO92723.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pasteur 52237]
 gi|160697283|gb|EDP87253.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei ATCC 10399]
 gi|169651984|gb|EDS84677.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei S13]
 gi|217394133|gb|EEC34153.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 576]
 gi|225933378|gb|EEH29368.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pakistan 9]
 gi|235000195|gb|EEP49619.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei MSHR346]
 gi|238524705|gb|EEP88137.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei GB8 horse 4]
 gi|242137234|gb|EES23637.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1106b]
 gi|243060902|gb|EES43088.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei PRL-20]
 gi|254213917|gb|EET03302.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1710a]
 gi|261827048|gb|ABM99276.2| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei NCTC 10229]
          Length = 238

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 46/217 (21%), Positives = 76/217 (35%), Gaps = 17/217 (7%)

Query: 26  NRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLL 85
            ++  +NFA                 C L  +  +     +       D  + H     +
Sbjct: 31  RQLGFKNFAY-----RHQISGAASSRCMLDGFPAEWRLRYDAADYLSIDPVVQHCRCRTV 85

Query: 86  PIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFL-MLANE 144
           P+IW          S  +L            G++ PV         +   ++        
Sbjct: 86  PLIWHDDLY---TTSRAKLMRDEAKSYGLVYGLSCPVHDRSGAISMLSMATDDPFEHDAS 142

Query: 145 VIIEAHG-------ACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEK 197
            I+             +  + + L+   +R  +   LT RE   LQ AG G T+ EI++ 
Sbjct: 143 DILRLLSLSQLLASFVHAAMHELLDCRLRRQGSCD-LTARERESLQWAGRGKTAWEISKI 201

Query: 198 LGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           LG+S  TV  +L +A  K+ A NR QA+  A   G I
Sbjct: 202 LGISERTVVFHLSNAARKIGANNRAQAVVIASARGLI 238


>gi|59940051|gb|AAX12564.1| LuxR-type transcriptional regulator [Aeromonas veronii]
          Length = 260

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 48/231 (20%), Positives = 86/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y          ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIFPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  ++E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLEERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +   A   LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDAQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR  AIA  +  G +
Sbjct: 193 WASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYHAIANGVSSGML 243


>gi|167742620|ref|ZP_02415394.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 14]
 gi|167914947|ref|ZP_02502038.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 112]
 gi|167922782|ref|ZP_02509873.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei BCC215]
          Length = 210

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 40/215 (18%), Positives = 63/215 (29%), Gaps = 9/215 (4%)

Query: 24  IQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSG 83
           +        +          FP     I  + NY     +          D  +      
Sbjct: 1   MTRAAATLGYEYAAYGMRRPFPISNPPILMVSNYPARWQERYIEARFANIDGAVKAALGS 60

Query: 84  LLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLAN 143
             P+ W +        +S               G +   R      G +  +     +  
Sbjct: 61  DRPVTWSA-----PANASKSAFWAEALSFGIAHGWSSASRGADGAIGVLTLSRTQDPIDT 115

Query: 144 EVIIE----AHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLG 199
                     H                      +LT RET  L+   DG T+ EIA  L 
Sbjct: 116 AEKFRNESIVHWLANVAHASMAPFLPAADEFDPDLTRRETDVLKWTADGKTAYEIALILS 175

Query: 200 LSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +S  TVN ++ +   KL + N+IQA+AKA   G +
Sbjct: 176 ISESTVNFHVKNIVSKLGSTNKIQAVAKAALMGML 210


>gi|150395666|ref|YP_001326133.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
 gi|150027181|gb|ABR59298.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
          Length = 286

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 55/230 (23%), Positives = 82/230 (35%), Gaps = 3/230 (1%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQ-QLICELHNYDLDSGDIPN 66
             + + L+     +  ++   +   F  + I S       +      + N   +  +  +
Sbjct: 56  ASEIARLETQFDIIRYMRRITQIFGFKTFLICSIPAVEVERLSATTVISNMPAELLNKYD 115

Query: 67  ILIETYGDDFLFHFNSGLLPI--IWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
            L        +        P   + +  ++E     +      +           FPV  
Sbjct: 116 SLSMLRFSTGVRRLRETTTPFQILLEDWEKEGGKPDAAADYFAMLRENGLLQANYFPVHD 175

Query: 125 GFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQL 184
                G VI       L     +E       V     E+     +    L+ERE  CL  
Sbjct: 176 AEGGRGAVILMGPEAGLPMTAAMELQMIAIHVYNRLAEIGSVWKNTNTVLSEREIQCLNW 235

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              G TS EIA  LGLS HTVN YL   T KLDAVNR QA+ KA++ GYI
Sbjct: 236 TAAGKTSSEIAGILGLSEHTVNHYLNHVTKKLDAVNRTQAVVKAMKKGYI 285


>gi|167564970|ref|ZP_02357886.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia oklahomensis EO147]
 gi|167572172|ref|ZP_02365046.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia oklahomensis C6786]
          Length = 238

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 44/217 (20%), Positives = 77/217 (35%), Gaps = 17/217 (7%)

Query: 26  NRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLL 85
            ++  +NFA                 C L  +  +     +       D  + H     +
Sbjct: 31  RQLGFKNFAY-----RHQIAGMSSSRCTLDGFPAEWRLRYDSADYLSIDPVVQHCRCRTV 85

Query: 86  PIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSE-------- 137
           P+IW      T      ++            G++ PV         +   ++        
Sbjct: 86  PLIWSDDLYTTG---RAKIMRDEAKSYGLVYGLSCPVHDRGGTISMLSMATDAPFERDTI 142

Query: 138 FLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEK 197
            ++    +        +  + + L+   +R  +   LT RE   LQ AG G T+ EI++ 
Sbjct: 143 DVLRLLSLSQLLASFVHAAMQELLDCRLRRQGSCD-LTARERESLQWAGRGKTAWEISKI 201

Query: 198 LGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           LG+S  TV  +L +A  K+ A NR QA+  A   G I
Sbjct: 202 LGISERTVVFHLSNAARKIGANNRAQAVVIASARGLI 238


>gi|167913657|ref|ZP_02500748.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 112]
          Length = 238

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 46/217 (21%), Positives = 76/217 (35%), Gaps = 17/217 (7%)

Query: 26  NRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLL 85
            ++  +NFA                 C L  +  +     +       D  + H     +
Sbjct: 31  RQLGFKNFAY-----RHQISGAASSRCMLDGFPAEWRLRYDAADYLSIDPVVQHCRCRTV 85

Query: 86  PIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFL-MLANE 144
           P+IW          S  +L            G++ PV         +   ++        
Sbjct: 86  PLIWHDDLY---TTSRAKLMRDEAKSYGLVYGLSCPVHDRSGAISMLSMATDDPFEHDAS 142

Query: 145 VIIEAHG-------ACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEK 197
            I+             +  + + L+   +R  +   LT RE   LQ AG G T+ EI++ 
Sbjct: 143 DILRLLSLSQLLASFVHAAMHELLDCRLRRQGSCD-LTARERESLQWAGRGKTAWEISKI 201

Query: 198 LGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           LG+S  TV  +L +A  K+ A NR QA+  A   G I
Sbjct: 202 LGISERTVVFHLSNAARKIGANNRAQAVVIASARGLI 238


>gi|323961965|gb|EGB57564.1| autoinducer binding domain-containing protein [Escherichia coli
           H489]
          Length = 240

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 84/235 (35%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++   +  Y++      P  +  +    NY       
Sbjct: 14  LLRFQRMEAAEEVYHEIELQAQQLE---YDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSY 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L         ++W             Q             G+   + L
Sbjct: 71  YQAKNFLAIDPVLNPEYFNQGHLMWNDDLFS-----EAQPLWEAARAHGLRRGVTQYLML 125

Query: 125 GFHKNGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F    T E  +L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 126 PNRALGFLSFSRCSTREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 186 EILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|150395665|ref|YP_001326132.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
 gi|150027180|gb|ABR59297.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
          Length = 246

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 49/221 (22%), Positives = 89/221 (40%), Gaps = 3/221 (1%)

Query: 15  QELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGD 74
            ++   L  +      R F +  I  +       Q    +  + +D     +      G 
Sbjct: 27  DDVRGALGRVSEGFGFRGFMVLAIPDSGSHSLTAQ--ALMTTWPMDFLRRYDSARLIDGS 84

Query: 75  DFLFHFNSGLLPIIWQS-IQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
             +       +P  + +       ++  G+ ++ +        G+  PV         V 
Sbjct: 85  PVIQRLRRSTIPFTYDAHQLARGRVDGKGEAAICVFEQANMPRGVYLPVHDAAGHRAAVA 144

Query: 134 FTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEE 193
           F  +   ++ + + E +     + +   E+  +      +L+ RE  CL+ A  G T+ E
Sbjct: 145 FGGDRSAVSGDELQELNLWAGLLYSRLSEVRTRDRRGPGSLSRREIECLRWAAAGKTTVE 204

Query: 194 IAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +A  + LS +TVN YL  AT KLD+VNR+Q +AKAIR G I
Sbjct: 205 MARIMALSEYTVNHYLNRATRKLDSVNRVQTVAKAIRAGLI 245


>gi|149193353|gb|ABR21211.1| PhzR [Pseudomonas chlororaphis subsp. aureofaciens]
          Length = 241

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 42/226 (18%), Positives = 74/226 (32%), Gaps = 13/226 (5%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++     +    ++   F  +        P  +       NY  D             D 
Sbjct: 22  DMQEFTAVALRALRELRFDFFAYGMCSVTPFMRPRTYMYGNYPEDWVQRYQAANYAVIDP 81

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
            + H      PI+W +       +                 G+A P      + G +   
Sbjct: 82  TVKHSKVSSSPILWSNELFRGCPD-----LWSEANDSNLRHGLAQPSFNTQGRVGVLSLA 136

Query: 136 SEFLMLANEVIIEAHGACYQVITDF-------LELFKKRSSAARNLTERETSCLQLAGDG 188
            +   ++ +   EA     +            LE   +  +     + RE   L+   DG
Sbjct: 137 RKDNPISLQE-FEALKVVTKAFAAAVHEKISELESDVRVFNTDVEFSGRECDVLRWTADG 195

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            TSEEI   +G+   TVN +  +   K+ A NR+QA++ A+  GYI
Sbjct: 196 KTSEEIGVIMGVCTDTVNYHHRNIQRKIGASNRVQAVSYAVAMGYI 241


>gi|76819232|ref|YP_337020.1| ATP-dependent transcriptional regulator LuxR [Burkholderia
           pseudomallei 1710b]
 gi|76583705|gb|ABA53179.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1710b]
          Length = 394

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 46/217 (21%), Positives = 76/217 (35%), Gaps = 17/217 (7%)

Query: 26  NRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLL 85
            ++  +NFA                 C L  +  +     +       D  + H     +
Sbjct: 187 RQLGFKNFAY-----RHQISGAASSRCMLDGFPAEWRLRYDAADYLSIDPVVQHCRCRTV 241

Query: 86  PIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFL-MLANE 144
           P+IW          S  +L            G++ PV         +   ++        
Sbjct: 242 PLIWHDDLY---TTSRAKLMRDEAKSYGLVYGLSCPVHDRSGAISMLSMATDDPFEHDAS 298

Query: 145 VIIEAHG-------ACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEK 197
            I+             +  + + L+   +R  +   LT RE   LQ AG G T+ EI++ 
Sbjct: 299 DILRLLSLSQLLASFVHAAMHELLDCRLRRQGSCD-LTARERESLQWAGRGKTAWEISKI 357

Query: 198 LGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           LG+S  TV  +L +A  K+ A NR QA+  A   G I
Sbjct: 358 LGISERTVVFHLSNAARKIGANNRAQAVVIASARGLI 394


>gi|167577870|ref|ZP_02370744.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia thailandensis TXDOH]
          Length = 236

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 39/215 (18%), Positives = 62/215 (28%), Gaps = 9/215 (4%)

Query: 24  IQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSG 83
           +        +          FP     I  + NY     +          D  +      
Sbjct: 27  LTRAAATLGYEYAAYGMRRPFPISNPQILMVSNYPDRWQERYIEARFANVDSAVKAALGS 86

Query: 84  LLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLAN 143
             P+ W +    +                    G +   R      G +  +     +  
Sbjct: 87  DRPVTWSASTNASKSA-----FWAEALSFGIAHGWSSASRGADGTIGVLSLSRRQDAIDT 141

Query: 144 EVIIE----AHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLG 199
                     H                      +LT RET  L+   DG T+ EIA  L 
Sbjct: 142 AEKFRNESIVHWLANVAHASMAPFLPAADEFDPDLTRRETDVLKWTADGKTAYEIALILS 201

Query: 200 LSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +S  TVN ++ +   KL + N+IQA+AKA   G +
Sbjct: 202 ISESTVNFHVKNIVSKLGSTNKIQAVAKAALMGML 236


>gi|53721347|ref|YP_110332.1| LuxR family transcriptional regulator [Burkholderia pseudomallei
           K96243]
 gi|52211761|emb|CAH37760.1| putative LuxR-family transcriptional regulator [Burkholderia
           pseudomallei K96243]
          Length = 234

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 46/217 (21%), Positives = 76/217 (35%), Gaps = 17/217 (7%)

Query: 26  NRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLL 85
            ++  +NFA                 C L  +  +     +       D  + H     +
Sbjct: 27  RQLGFKNFAY-----RHQISGAASSRCMLDGFPAEWRLRYDAADYLSIDPVVQHCRCRTV 81

Query: 86  PIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFL-MLANE 144
           P+IW          S  +L            G++ PV         +   ++        
Sbjct: 82  PLIWHDDLY---TTSRAKLMRDEAKSYGLVYGLSCPVHDRSGAISMLSMATDDPFEHDAS 138

Query: 145 VIIEAHG-------ACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEK 197
            I+             +  + + L+   +R  +   LT RE   LQ AG G T+ EI++ 
Sbjct: 139 DILRLLSLSQLLASFVHAAMHELLDCRLRRQGSCD-LTARERESLQWAGRGKTAWEISKI 197

Query: 198 LGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           LG+S  TV  +L +A  K+ A NR QA+  A   G I
Sbjct: 198 LGISERTVVFHLSNAARKIGANNRAQAVVIASARGLI 234


>gi|83716885|ref|YP_439427.1| ATP-dependent transcription regulator LuxR [Burkholderia
           thailandensis E264]
 gi|257142551|ref|ZP_05590813.1| ATP-dependent transcription regulator LuxR [Burkholderia
           thailandensis E264]
 gi|83650710|gb|ABC34774.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia thailandensis E264]
          Length = 234

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 39/215 (18%), Positives = 62/215 (28%), Gaps = 9/215 (4%)

Query: 24  IQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSG 83
           +        +          FP     I  + NY     +          D  +      
Sbjct: 25  LTRAAATLGYEYAAYGMRRPFPISNPQILMVSNYPDRWQERYIEARFANVDSAVKAALGS 84

Query: 84  LLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLAN 143
             P+ W +    +                    G +   R      G +  +     +  
Sbjct: 85  DRPVTWSASTNASKSA-----FWAEALSFGIAHGWSSASRGADGTIGVLSLSRRQDAIDT 139

Query: 144 EVIIE----AHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLG 199
                     H                      +LT RET  L+   DG T+ EIA  L 
Sbjct: 140 AEKFRNESIVHWLANVAHASMAPFLPAADEFDPDLTRRETDVLKWTADGKTAYEIALILS 199

Query: 200 LSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +S  TVN ++ +   KL + N+IQA+AKA   G +
Sbjct: 200 ISESTVNFHVKNIVSKLGSTNKIQAVAKAALMGML 234


>gi|312963163|ref|ZP_07777648.1| transcriptional regulator, LuxR family [Pseudomonas fluorescens
           WH6]
 gi|311282674|gb|EFQ61270.1| transcriptional regulator, LuxR family [Pseudomonas fluorescens
           WH6]
          Length = 240

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 40/212 (18%), Positives = 73/212 (34%), Gaps = 11/212 (5%)

Query: 15  QELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGD 74
            +++    ++ N   +  F   +   +      Q++I E  NY  +   +         D
Sbjct: 16  DQITSVFEMVINETYSLGFQFCSFKMSTQQLANQKIIFEKSNYPNEWSHLYKQAKFADVD 75

Query: 75  DFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
             + H    +LP +W+    +            L        G   P+         +  
Sbjct: 76  PVVAHCQRSVLPFVWKETAFQGTP-----HLWTLAQSCGVHLGWTQPLHGPRGVFSMLTL 130

Query: 135 TSEFLMLANEVIIE----AHGACYQVITDFLE--LFKKRSSAARNLTERETSCLQLAGDG 188
           +     ++ E + E    A   C+ + T        +  +    NLT RE   L+ +  G
Sbjct: 131 SRSKREISPEELYEKAGNALWLCHAMHTVVAHKYANEPDAVPCNNLTPRELEVLRWSALG 190

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVN 220
            T+ EIA+ L LS  TV  +  S+  KL   N
Sbjct: 191 KTAGEIAKILCLSERTVGFHNCSSMRKLGVNN 222


>gi|329907385|ref|ZP_08274651.1| hypothetical protein IMCC9480_3266 [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327546980|gb|EGF31877.1| hypothetical protein IMCC9480_3266 [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 267

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 41/225 (18%), Positives = 75/225 (33%), Gaps = 11/225 (4%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++      I  R  A  F   +    +  P     I   +NYD +  ++         D 
Sbjct: 43  DIDVLFAHIVERTAALGFDFASFGMQMPLPLNNPKIVTRNNYDPEWWNVYLKNNYFQIDP 102

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
            + H  +     +W         +                 G     R        + F+
Sbjct: 103 VVIHVRTSDEAAVWSDNFFSAQPK-----FWEHAQSFGLRYGWTKATRSSVGTMSQLSFS 157

Query: 136 SEFLMLANEVII----EAHGACYQVITDFLELF--KKRSSAARNLTERETSCLQLAGDGY 189
                L+ + ++                  E F  ++   +   L++RE   ++   DG 
Sbjct: 158 RRENPLSEQELLLKESAMIDLADLAHLHMTECFVLEQFPESKTELSQRERDVIRWCADGK 217

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           T+ EIA  L +S  +VN ++ +   KLDA N+  A+ KA  FG +
Sbjct: 218 TNAEIAMILNISTSSVNFHVLNFIKKLDASNKTHAVMKAASFGLL 262


>gi|222085036|ref|YP_002543565.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
 gi|221722484|gb|ACM25640.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
          Length = 245

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 57/219 (26%), Positives = 83/219 (37%), Gaps = 2/219 (0%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++   +  + +  + R F +  + S   F  +      ++N+  +   + +         
Sbjct: 28  DVFRFMKRVTDAYRCRAFMVVNLPSLTSFELQ--SNSVINNWPAELLTVYDQEGLLRNST 85

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
                    LP ++ +       +S  QL   L         I  P        G VI +
Sbjct: 86  VSRRLRVSTLPFVYDTAANTNRDDSKIQLRASLFERFRMARSICLPTHDASGIRGAVILS 145

Query: 136 SEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIA 195
            +      E   +       V     E+          LT+RE  CL     G TS EIA
Sbjct: 146 GDREAFTAEETKDLCYIAIHVFDRLAEIRNLDVRIVDTLTDRELDCLNWTAAGKTSAEIA 205

Query: 196 EKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           E L LS HTVN YL  AT KLD VNR QA+AKA+R G I
Sbjct: 206 EILTLSEHTVNHYLNRATKKLDTVNRTQAVAKALRVGLI 244


>gi|83956361|ref|ZP_00964786.1| autoinducer-binding transcriptional regulator LuxR [Sulfitobacter
           sp. NAS-14.1]
 gi|83839409|gb|EAP78592.1| autoinducer-binding transcriptional regulator LuxR [Sulfitobacter
           sp. NAS-14.1]
          Length = 269

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 50/240 (20%), Positives = 88/240 (36%), Gaps = 11/240 (4%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLD 60
           +SE+  +  KS+   +L   L+ +      +N   ++ +              +  Y   
Sbjct: 33  LSEDFSSRAKSTPELDLETTLNDLSTLYGLKNITYFSASIPYANDDE---HILITTYSTT 89

Query: 61  SGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAF 120
             +    L     D  L   +  LLP+ W  +   T  E+S       +   +   G+  
Sbjct: 90  WVEHYFSLKYQDVDPVLHAGSRSLLPVDWGHL--STTGETSRNFFGEAKEYGIGETGLTI 147

Query: 121 PVRLGFHKNGYVIFTSEFLMLANEV-----IIEAHGACYQVITDFLELFKKRSSAARN-L 174
           PVR    +   +   S+      E+     I +     + +          +       L
Sbjct: 148 PVRGMLGEEAMISLNSDLRARDWELFCREMISDFTYFAHLLHDSVTRSRIHQHETDHPQL 207

Query: 175 TERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           T+RE   L+ A  G T+ E    LGL+  TV+ YLG+A  KL    + QA+A A++   I
Sbjct: 208 TKREAQVLRWAARGKTAWETGIILGLTEKTVSFYLGNACAKLKVATKTQAVAFAVKERLI 267


>gi|167578890|ref|ZP_02371764.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia thailandensis TXDOH]
 gi|167616988|ref|ZP_02385619.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia thailandensis Bt4]
 gi|257140903|ref|ZP_05589165.1| ATP-dependent transcription regulator LuxR [Burkholderia
           thailandensis E264]
          Length = 238

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 45/217 (20%), Positives = 76/217 (35%), Gaps = 17/217 (7%)

Query: 26  NRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLL 85
            ++  +NFA                 C L  +  +     +       D  + H     +
Sbjct: 31  RQLGFKNFAY-----RHQISGAASSRCMLDGFPTEWRLRYDAADYLSIDPVVQHCRCRTV 85

Query: 86  PIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFL------ 139
           P+IW      T      +L            G++ PV         +   ++        
Sbjct: 86  PLIWHDELYTTG---RAKLMRDEAKSYGLVYGLSCPVHDRSGAISMLSMATDDPFEHDAN 142

Query: 140 --MLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEK 197
             +    +        +  + + L+   +R  +   LT RE   LQ AG G T+ EI++ 
Sbjct: 143 DILRLLSLSQLLASFVHAAMHELLDCRLRRQGSCD-LTARERESLQWAGRGKTAWEISKI 201

Query: 198 LGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           LG+S  TV  +L +A  K+ A NR QA+  A   G I
Sbjct: 202 LGISERTVVFHLSNAARKIGANNRAQAVVIASARGLI 238


>gi|90023140|ref|YP_528967.1| LuxR family transcriptional regulator [Saccharophagus degradans
           2-40]
 gi|89952740|gb|ABD82755.1| transcriptional regulator, LuxR family [Saccharophagus degradans
           2-40]
          Length = 247

 Score =  148 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 53/231 (22%), Positives = 88/231 (38%), Gaps = 8/231 (3%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
           +++  + L          +    +    I+SA         I  + NY  +         
Sbjct: 15  EATDEETLKELCLKFCELVGFEFYIFGIISSASSL--SSPTISTISNYPDEWFKNYFEEG 72

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQE-ETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
               D  + +       I W+ + + E  +++ G+  +          G++ P++    +
Sbjct: 73  MQRHDPVVRYCMQNTSAIRWRQLMDLEHYVDAIGEKIMIRASESGLCDGLSIPIKAPSGE 132

Query: 129 NGYVIFTSEFLMLANEVIIE----AHGACYQVITDFLELFKKRSSAARN-LTERETSCLQ 183
                  S      N+ I      A     QV   +  L  K +   +  LT RE   L 
Sbjct: 133 IAIFSLASNREEGLNQRINACLPFAQSFGTQVFECYSALMLKLAQNKQTHLTAREKESLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G T+ EI++ L +S  TV  +L SAT KL AVNR  A+AKAI  G I
Sbjct: 193 WACEGKTTWEISKILDVSERTVIFHLSSATSKLGAVNRQHAVAKAILSGLI 243


>gi|320652407|gb|EFX20705.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H- str. H 2687]
          Length = 240

 Score =  148 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 41/235 (17%), Positives = 84/235 (35%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++   +  Y++      P  +  +    NY       
Sbjct: 14  LLRFQRMETAEEVYHEIELQAQQLE---YDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSY 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                       L   N     ++W          +  Q             G+   + L
Sbjct: 71  YQAKNFLAIAPVLNPENFSQGHLMWNDDLF-----NEAQPLWEAARAHGLRRGVTQYLML 125

Query: 125 GFHKNGYVIF----TSEFLMLANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F      E  +L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 126 PNRALGFLSFSRCSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 186 EILRWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|163744256|ref|ZP_02151616.1| Transcriptional activator protein RaiR, putative [Oceanibulbus
           indolifex HEL-45]
 gi|161381074|gb|EDQ05483.1| Transcriptional activator protein RaiR, putative [Oceanibulbus
           indolifex HEL-45]
          Length = 239

 Score =  148 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 76/231 (32%), Gaps = 15/231 (6%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
           ++     L      +++     +   + I++A +             Y     D  +   
Sbjct: 16  QADGQAALGQVSEALRDHYGILHVVYHWIDTAGEQ-------YGCGTYGALWSDRYHEHN 68

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
               D  +        P+ W+ +   +                +   G + PVR    + 
Sbjct: 69  YLRIDPVVSGCYRRFEPVDWKDLDWTSRAARK--FRRDASDHGVGNQGFSVPVRGPHGQF 126

Query: 130 GYVIFTSEFLMLANEV-----IIEAHGACYQVITDFLELFK-KRSSAARNLTERETSCLQ 183
                                  +   A +      L L   +R  A + L+ RE   + 
Sbjct: 127 ALFTTNHSCTDALWSSFTARHRRDLIWAAHCFNEKALALAPNRRPGAVQALSPREVDAMT 186

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           L   GY   ++A++L +S HT+ AY+ SA  KL A N   A+A+A+  G I
Sbjct: 187 LLAVGYNRAQVAQRLSISEHTLRAYVESARFKLGASNTTHAVARALSRGLI 237


>gi|62822972|gb|AAY15207.1| transcriptional activator PhzR [Pseudomonas chlororaphis]
          Length = 241

 Score =  148 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 40/225 (17%), Positives = 71/225 (31%), Gaps = 11/225 (4%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++     +    ++   F  +        P  +       NY  D             D 
Sbjct: 22  DMQEFTAVALRALRELRFDFFAYGMCSVTPFMRPRTYMYGNYPEDWVQRYQAANYAVIDP 81

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
            + H      PI+W +       +                 G+A P      + G +   
Sbjct: 82  TVKHSKVSSAPILWSNELFRGCAD-----LWSEAKDSHLCHGLAQPSFNAQGRVGVLSLA 136

Query: 136 SEFLMLANEVIIEA----HGACYQVITDFLELFK--KRSSAARNLTERETSCLQLAGDGY 189
            +   ++ +                     EL    +  +     + RE   L+   DG 
Sbjct: 137 RKNNPISLQEFEALKPVTRAFAAAAHEKISELESDVRVFNTGVEFSGRECDVLRWTADGK 196

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           TSEEI   +G+   TVN +  +   K+ A NR+QA++ A+  GYI
Sbjct: 197 TSEEIGVIMGVCTDTVNYHHRNIQRKIGASNRVQAVSYAVAMGYI 241


>gi|26417542|gb|AAM75413.1| transcriptional regulator PpuR [Pseudomonas putida]
          Length = 238

 Score =  148 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 38/234 (16%), Positives = 73/234 (31%), Gaps = 12/234 (5%)

Query: 3   ENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSG 62
           +  L   +    ++    L ++  ++   NF    I          Q +    +Y     
Sbjct: 7   DELLRLSEMERFEDWLAHLKILTRKLGYSNFL---IGLKPAPTDANQQVLIYSDYPDAWR 63

Query: 63  DIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPV 122
              +       D  + H  +   P++W         ES                G+A P+
Sbjct: 64  TRYDAESYAAVDPVVQHCLNANRPLLWDRDNYRRPSESE---FFEEAAAHGLQQGLALPL 120

Query: 123 RLGFHKNGYVIFTSEFLMLAN-----EVIIEAHGACYQVITDFLELFKKRSSAARNLTER 177
                + G +                E +  A       +   L+   + S+    LT R
Sbjct: 121 HGPRGEAGMLCLKPSESGPRATATMIESLPMATLLRDYAMEGMLKARIECSTPVH-LTSR 179

Query: 178 ETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRF 231
           E   LQ +  G T+ EI+  L  +   ++ +  +   K    +R  A+ KAI+ 
Sbjct: 180 EKEVLQWSAAGKTTWEISMILSCTTSAIDFHFKNIRRKFQVSSRQMAVLKAIQQ 233


>gi|209863456|gb|ACI88828.1| PhzR [Pseudomonas sp. G5(2008b)]
          Length = 241

 Score =  148 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 40/225 (17%), Positives = 71/225 (31%), Gaps = 11/225 (4%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++     +    ++   F  +        P  +       NY  D             D 
Sbjct: 22  DMQEFTAVALRALRELRFDFFAYGMCSVTPFMRPRTYMYGNYPEDWVQRYQAANYAVIDP 81

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
            + H      PI+W +       +                 G+A P      + G +   
Sbjct: 82  TVKHSKVSSAPILWSNELFRGCAD-----LWSEAKDSHLCHGLAQPSFNAQGRVGVLSLA 136

Query: 136 SEFLMLANEVIIEA----HGACYQVITDFLELFK--KRSSAARNLTERETSCLQLAGDGY 189
            +   ++ +                     EL    +  +     + RE   L+   DG 
Sbjct: 137 RKNNPISLQEFEALKPVTRAFAAAAHEKISELESDVRVFNTGVAFSGRECDVLRWTADGK 196

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           TSEEI   +G+   TVN +  +   K+ A NR+QA++ A+  GYI
Sbjct: 197 TSEEIGVIMGVCTDTVNYHHRNIQRKIGASNRVQAVSYAVAMGYI 241


>gi|59940041|gb|AAX12559.1| LuxR-type transcriptional regulator [Aeromonas eucrenophila]
          Length = 260

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 88/239 (36%), Gaps = 11/239 (4%)

Query: 1   MSENTLT--GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYD 58
           M ++ L    +  +S+ +      LI        +  Y     +    ++        Y 
Sbjct: 1   MKQDQLLEYLEHLTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPRAEVFMQYP 60

Query: 59  LDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQ-EETVIESSGQLSVRLEGGLLPFAG 117
                          D  +       LPI W  ++     ++      + L        G
Sbjct: 61  DPWVQAYTANHMLACDPIIQLARKQTLPIYWNRLEGRARFLQEGSLDVMGLAAEFGLRNG 120

Query: 118 IAFPVRLGFHKNGYVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSA 170
           I+FP+     +NG + F +     ++++++E           +       + +  +    
Sbjct: 121 ISFPLHGAAGENGILSFITSER-ASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREHDP 179

Query: 171 ARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAI 229
              LT+RET CL  A +G TS EIA  LG++  TVN +L   T K  ++NR  AIAK +
Sbjct: 180 HEALTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYHAIAKGV 238


>gi|163761139|ref|ZP_02168216.1| probable transcriptional regulator protein, LuxR family [Hoeflea
           phototrophica DFL-43]
 gi|162281690|gb|EDQ31984.1| probable transcriptional regulator protein, LuxR family [Hoeflea
           phototrophica DFL-43]
          Length = 246

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 48/230 (20%), Positives = 87/230 (37%), Gaps = 5/230 (2%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDF----PRRQQLICELHNYDLDSGDI 64
           +  S ++     + +++    +  F  +++ +         +    I  + ++  +    
Sbjct: 15  EPISKIRTTFDAIQVLRKTCLSYGFRYFSVLTIPAMVSESAQVMSHISVISSWPPELIAD 74

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQ-SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVR 123
            + L        L      + P++++    +     +    +  L        G+ FPV+
Sbjct: 75  YDRLELGKNSPVLERLRKQITPLLFEVENIDSERDGAEQASAKELFTRFGVTMGVYFPVQ 134

Query: 124 LGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
            G  +   V F      L+   +         ++    ++     +A   L  RET  LQ
Sbjct: 135 DGRGQRFAVCFMGARKPLSATELPSLAMFATLLVDQLSQITANEDTAKLVLNARETEVLQ 194

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGY 233
              +G TS EIA   GLS HTVN Y   AT KL   NR QA+ +AIR G 
Sbjct: 195 WTAEGKTSAEIARITGLSEHTVNHYATIATQKLGCSNRTQAVVQAIRLGL 244


>gi|310769028|gb|ADP21168.1| PhzR [Pseudomonas chlororaphis]
          Length = 241

 Score =  148 bits (374), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 40/225 (17%), Positives = 71/225 (31%), Gaps = 11/225 (4%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++     +    ++   F  +        P  +       NY  D             D 
Sbjct: 22  DMQEFTAVALRALRELRFDFFAYGMCSVTPFMRPRTYMYGNYPEDWVQRYQAANYAVIDP 81

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
            + H      PI+W +       +                 G+A P      + G +   
Sbjct: 82  TVKHSKVSSAPILWSNELFRGCAD-----LWSEAKDSHLCHGLAQPSFNAQGRVGVLSLA 136

Query: 136 SEFLMLANEVIIEA----HGACYQVITDFLELFK--KRSSAARNLTERETSCLQLAGDGY 189
            +   ++ +                     EL    +  +     + RE   L+   DG 
Sbjct: 137 RKNNPISLQEFEALKPVTRAFAAAAHEKISELESDVRVFNTDVEFSGRECDVLRWTADGK 196

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           TSEEI   +G+   TVN +  +   K+ A NR+QA++ A+  GYI
Sbjct: 197 TSEEIGVIMGVCTDTVNYHHRNIQRKIGASNRVQAVSYAVAMGYI 241


>gi|325292093|ref|YP_004277957.1| transcriptional regulator, LuxR family [Agrobacterium sp. H13-3]
 gi|325059946|gb|ADY63637.1| transcriptional regulator, LuxR family [Agrobacterium sp. H13-3]
          Length = 246

 Score =  148 bits (373), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 50/220 (22%), Positives = 80/220 (36%), Gaps = 3/220 (1%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++   L  +      + F +  ++ + +          + ++  +     +         
Sbjct: 28  DIFRFLKRLTEAWGFKAFMV--LDLSAEMASELSQCTIITSWPAELLQRYDEEGMLQRSL 85

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQ-LSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
            +        P         +  E++ +   + L         + FPV       G V F
Sbjct: 86  VMAQLKKSTTPFSVSLDFLVSGDENAPKKPVIGLFERFDMINSVWFPVHDITTMRGAVSF 145

Query: 135 TSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEI 194
           +     L    + E       +     E+ +        L ERE  CL     G TS EI
Sbjct: 146 SGNKTTLPTSQLAELFYISSHIFARLSEIRRLDLRVPETLNEREIDCLNWTAAGKTSAEI 205

Query: 195 AEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           AE + LS HT+N YL  AT KLD VNR QA+AKA+R G I
Sbjct: 206 AEIMMLSEHTINHYLNRATKKLDTVNRTQAVAKALRVGLI 245


>gi|159044368|ref|YP_001533162.1| putative transcriptional regulator [Dinoroseobacter shibae DFL 12]
 gi|157912128|gb|ABV93561.1| putative transcriptional regulator [Dinoroseobacter shibae DFL 12]
          Length = 243

 Score =  147 bits (372), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 42/229 (18%), Positives = 74/229 (32%), Gaps = 5/229 (2%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNI 67
             ++ +  ++   +    +       + +   +    P  +  +     +          
Sbjct: 11  VSRAETPAQIWDAVLPFAHSFGIDKVSYHNTPAFGAVPGSETAVF-ARGFPESWLCDYVN 69

Query: 68  LIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
                 D    +      P  W  I + T + +     ++         G+A  V     
Sbjct: 70  ERLYEVDPIPAYAAHATEPFRWSDIAKLTPLTAPETDFLKRLLQQGLGDGLALQVFGPNM 129

Query: 128 KNGYVI--FTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLA 185
           +NGYV   F S    L+   I E   A       +  L    +     LT RE   L   
Sbjct: 130 RNGYVGVGFASSDPDLSGGDIRELQAAAQAAHLRYCTLVPVATP--EALTPREREVLGWI 187

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             G ++  IAE LG+S HTV+  +     KL+  +R  A  + I  G I
Sbjct: 188 ARGKSNSVIAEILGVSPHTVDTLVRRIYGKLEVADRTTAAIRGIGAGLI 236


>gi|197344637|gb|ACH69668.1| LuxR family transcriptional regulator [uncultured proteobacterium]
          Length = 246

 Score =  147 bits (372), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 40/231 (17%), Positives = 78/231 (33%), Gaps = 13/231 (5%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
           +++   +L   L  +Q    A  F        L  P    +      Y     +I     
Sbjct: 22  EATDEADL---LKRMQAAAVASGFEHVLFGIELRRPFLDPIQHITSGYPDSYQEIYRTKG 78

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
               D  + +  +   P+IW                +          G + PVR G H  
Sbjct: 79  FISRDPSVAYCQTHTKPLIWGEDMYLADSYE----IMEESTKYGLSHGFSVPVRDGPHVV 134

Query: 130 GYVIFTSEFLMLANEV---IIEAHGA---CYQVITDFLELFKKRSSAARNLTERETSCLQ 183
             +    +    +      +++A      C  V +  + +    ++    L+ RE  CL+
Sbjct: 135 SMLSLARDKPFESAAEKKLVVDAGMVLANCVHVASKNIIVPDVETTLRPKLSRREHECLK 194

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              +G ++  I++ L +S  TV  ++ +   KL+   R+QA    +  G I
Sbjct: 195 WIAEGKSNGVISDLLKISEPTVEFHIRNLFTKLNVATRVQAAVVGVLMGLI 245


>gi|163734517|ref|ZP_02141956.1| transcription regulator, LuxR family, putative [Roseobacter
           litoralis Och 149]
 gi|161392010|gb|EDQ16340.1| transcription regulator, LuxR family, putative [Roseobacter
           litoralis Och 149]
          Length = 267

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 42/204 (20%), Positives = 70/204 (34%), Gaps = 4/204 (1%)

Query: 33  FALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSI 92
            + ++ ++    P  + L      +                D      +    P  W   
Sbjct: 58  VSYHSDDAQ--LPGSKPLGIVSDGFPEGWVCEYLESELFRVDPIPQLASILSRPFRWSEA 115

Query: 93  QEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI--FTSEFLMLANEVIIEAH 150
            +   +   G+  ++         G+A  V     +N YV   F      L ++ I E  
Sbjct: 116 PKLMRLSQEGERYMQTLADSGLGDGVAMQVYGPNMRNAYVGLGFGEHDPNLTSDEIFELQ 175

Query: 151 GACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLG 210
            A       + EL + R   A  L+ RE   LQ    G ++  IAE LG+S HTV+    
Sbjct: 176 CAAQIAHIRYCELTEYRQRTADTLSPREVEILQWIARGKSNSVIAEILGISRHTVDTITR 235

Query: 211 SATVKLDAVNRIQAIAKAIRFGYI 234
               KLD  +R  A  + +  G +
Sbjct: 236 RIFEKLDVNDRTTAAIRGLGSGLV 259


>gi|227823797|ref|YP_002827770.1| putative transcriptional regulator, LuxR family [Sinorhizobium
           fredii NGR234]
 gi|227342799|gb|ACP27017.1| putative transcriptional regulator, LuxR family [Sinorhizobium
           fredii NGR234]
          Length = 246

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 76/235 (32%), Gaps = 12/235 (5%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++  + +E+ P    + +R     + +       + P R   +     +      I    
Sbjct: 14  EEMKTREEILPEFERLLDRCGFDFYGVVRQPKPHENPLR---LLLAGRWPESWPQIYIRK 70

Query: 69  IETYGDDFLFHFNSGLLPIIWQS---IQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLG 125
                D  + +         W+               +  +        F G  FPV   
Sbjct: 71  KYVVIDPTIRYLGHAQRGFRWRDTLVAFRSDPHRKRMESMMVEARNHGLFDGDIFPVHGR 130

Query: 126 FHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLEL------FKKRSSAARNLTERET 179
               G +      + L+   +        ++    LEL       +  S     +T RE 
Sbjct: 131 RGLMGNLTVGGRVVDLSPVELSLFDAIAKRLFWKLLELTDPEIMAELVSRVEVQMTRREM 190

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L    DG TS +I + L +S HTV+ Y+     KL A NR  A+A A R G I
Sbjct: 191 EALNYLADGMTSNDIGKVLDISSHTVDWYMNGIQEKLKAKNRHHAVAIAFRLGLI 245


>gi|50084356|ref|YP_045866.1| putative transcriptional regulator [Acinetobacter sp. ADP1]
 gi|49530332|emb|CAG68044.1| putative transcriptional regulator, luxR family [Acinetobacter sp.
           ADP1]
          Length = 246

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 40/229 (17%), Positives = 75/229 (32%), Gaps = 3/229 (1%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
             +++S ++++   +      I      + +I          ++     N+  D  +I  
Sbjct: 18  QIRQASKIEDIFDVVVEFAQNIDFDRLIICSIAPHGKEELIDEVFFVYGNW-TDRTNIEE 76

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                       H      P  W     +   + + ++   +       +G+  P+    
Sbjct: 77  RNKYLRNCPITRHIFDYDEPFFWTKTFNKNNSKETYRVIKNISER-GEESGVQVPIFGRT 135

Query: 127 HKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARN-LTERETSCLQLA 185
              G + F  +   L  +        C     +             + LT+RE   L+  
Sbjct: 136 GLEGAISFAGKLSDLGADFRFILQSVCVTAFREIQSKRSLNLLRENSVLTQREKEILKWT 195

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             G    EIAE L +S  TV  +L S   KL+  +  QAIA A+  G I
Sbjct: 196 AVGRKQSEIAEILKISERTVENHLRSIRKKLEVKSTGQAIASALLKGEI 244


>gi|309779367|ref|ZP_07674129.1| autoinducer-binding transcriptional regulator BmaR5 [Ralstonia sp.
           5_7_47FAA]
 gi|308921925|gb|EFP67560.1| autoinducer-binding transcriptional regulator BmaR5 [Ralstonia sp.
           5_7_47FAA]
          Length = 250

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 39/231 (16%), Positives = 69/231 (29%), Gaps = 12/231 (5%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
           + + L++    +  +Q  +    F           P  +        Y     +   +  
Sbjct: 22  QLNGLRDADAVIRSLQPAVALLGFDYCAYALRAAIPITRFNTLCWSTYPEPWCEHYRVHG 81

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
               D  L      + P++W  I                        G +  +R      
Sbjct: 82  YLAIDPVLQFGQRCVKPVLWSGIATADA------RFWADARQHGLNHGWSHTIRDHTGIF 135

Query: 130 GYVIFTSEFLMLANEVII----EAHGACYQVITDF--LELFKKRSSAARNLTERETSCLQ 183
           G          +  + +     E      +       L   K    AA  L E E   L 
Sbjct: 136 GTFSLVRRATPITEDELAVSEPEMIWLSQRAHGSISTLMAEKVLPDAATRLKEVERQTLH 195

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              +G T+ E+A  L ++   VN ++ +A  KL+A N+  A+ KA   G I
Sbjct: 196 WTAEGKTAAEVAAILEMTERNVNFHIRNAVTKLNAANKTHAVVKAALLGLI 246


>gi|59940131|gb|AAX12604.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
          Length = 260

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 47/231 (20%), Positives = 84/231 (36%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +++ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TTVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQL-SVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LP  W  + E       G    + L        GI+FP+     +N 
Sbjct: 74  ACDPIIQLARKQTLPNYWNRLDERARFLPEGSPDVMGLAAEFRLRHGISFPLHGAAGENR 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPILSWMSNYIFQAAIRIVRVSLREDEPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS EIA  LG++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 WASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|229592722|ref|YP_002874841.1| putative LuxR family regulatory protein [Pseudomonas fluorescens
           SBW25]
 gi|229364588|emb|CAY52478.1| putative LuxR-family regulatory protein [Pseudomonas fluorescens
           SBW25]
          Length = 236

 Score =  146 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 41/225 (18%), Positives = 74/225 (32%), Gaps = 13/225 (5%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           E++    ++ N+     F   +   +      Q    E  NY  +   + N       D 
Sbjct: 17  EITSVFEMVINQTYELGFQYCSFKMSSQVSENQTNPIEFTNYPKEWTTVYNQARYFDVDP 76

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
            + H    +LP++W+    +            L   L         V         +  +
Sbjct: 77  VVKHCKRCVLPVVWEGTLFKDAPS-----LWSLAQTLNVNVAWTQAVHDFQGVFSMLTLS 131

Query: 136 SEFLMLANEVI-------IEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDG 188
                ++   +       +    A + V+             +  LT RET  L+ +  G
Sbjct: 132 RGTDDVSPVELYEKAGHVLWLCHAMHAVVAQKYAGKPSALPPS-KLTPRETEILKWSAMG 190

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGY 233
            T+ +IA  L LS  TV  ++ S   KL   N+I A+  A + G 
Sbjct: 191 KTASDIATILCLSERTVGFHISSTFKKLGVNNKIAAVLCASKAGL 235


>gi|161724874|emb|CAO85748.1| PmrR protein [Pseudomonas sp. RW10S2]
          Length = 236

 Score =  146 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 37/208 (17%), Positives = 59/208 (28%), Gaps = 11/208 (5%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           +    L  ++   +   F           P  +  I  L NY     D  +       D 
Sbjct: 16  DTQTLLEEVKAAARHLGFDYCAYGLRTPLPVTKPRIFMLSNYSRPWCDHYHANGYLLLDP 75

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
            + H    + P++W         +                 G A     G    G +   
Sbjct: 76  TVRHCQRSMQPVVWGDEIFADAPQ-----LWDEARQAGLRHGWAQSCLEGSKGGGMLTLA 130

Query: 136 SEFLMLANEVII----EAHGACYQVITDFLEL--FKKRSSAARNLTERETSCLQLAGDGY 189
                +    +                 F  L     +      L+ERE   L+ A DG 
Sbjct: 131 RSGEGIGEGELRAHETRMRWLANVAHQGFSRLLSDSWQPQPQSPLSEREREVLRWAADGK 190

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLD 217
           T  E+A+ L LS+ TV  +  +A  KL 
Sbjct: 191 TLNEVADILTLSIETVKFHTRNAGAKLG 218


>gi|328542023|ref|YP_004302132.1| transcriptional regulator, LuxR family [polymorphum gilvum
           SL003B-26A1]
 gi|326411773|gb|ADZ68836.1| Transcriptional regulator, LuxR family [Polymorphum gilvum
           SL003B-26A1]
          Length = 239

 Score =  146 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 49/226 (21%), Positives = 78/226 (34%), Gaps = 4/226 (1%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
           +  + Q++S RL  +         A    +        +  I     +  +  +   +  
Sbjct: 16  RLETAQDVSARLGALARDYGFH--AHVLASFQGPGTVAEPRILAAG-WAQEWQERYLVNQ 72

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
               D  +       +P  W     E  +   G              G+  PV       
Sbjct: 73  YAVDDPVVVRATLASMPFRWSDALNEPWVTPRGVRVFDEARAFRLCDGVFIPVYGPKGLE 132

Query: 130 GYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSS-AARNLTERETSCLQLAGDG 188
           G +    E + +  E +   H            L +   + +A  LT RE  CL+    G
Sbjct: 133 GGLSLGGERVDVGAEELKALHLVGLYAYDHVRALSQGDPAWSAGTLTPRELECLKWVAAG 192

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            TS EI++ LG+S HT + YL  A  KL A NR  A+A+A R   I
Sbjct: 193 KTSWEISQVLGISRHTADWYLAEAVRKLGAANRTHAVAEAFRRAMI 238


>gi|73672744|gb|AAZ80478.1| PpuR [Pseudomonas putida]
          Length = 238

 Score =  146 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 38/234 (16%), Positives = 73/234 (31%), Gaps = 12/234 (5%)

Query: 3   ENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSG 62
           +  L   +    ++    L ++  ++   NF    I          Q +    +Y     
Sbjct: 7   DELLRLSEMERFEDWLAHLKILTRKLGYSNFL---IGLKPAPTDANQQVLIYSDYPDAWR 63

Query: 63  DIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPV 122
              +       D  + H  +   P++W         ES                G+A P+
Sbjct: 64  TRYDAESYAAVDPVVQHCLNANRPLLWDRDNYRRPSESE---FFEEAAAHGLQQGLALPL 120

Query: 123 RLGFHKNGYVIFTSEFLMLAN-----EVIIEAHGACYQVITDFLELFKKRSSAARNLTER 177
                + G +                E +  A       +   L+   + S+    LT R
Sbjct: 121 HGPRGEAGMLCLKPFESGPRATATMIESLPMATLLRDYAMEGMLKARIECSTPVH-LTSR 179

Query: 178 ETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRF 231
           E   LQ +  G T+ EI+  L  +   ++ +  +   K    +R  A+ KAI+ 
Sbjct: 180 EKEVLQWSAAGKTTWEISMILSCTTSAIDFHFKNIRRKFQVSSRQMAVLKAIQQ 233


>gi|2495423|sp|Q51786|PHZR_PSEFL RecName: Full=Transcriptional activator protein phzR
 gi|1050313|gb|AAC18899.1| shows homology to luxR family; putative [Pseudomonas fluorescens]
          Length = 244

 Score =  146 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 40/215 (18%), Positives = 69/215 (32%), Gaps = 11/215 (5%)

Query: 26  NRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLL 85
             ++   F  +        P  +       NY                D  + H      
Sbjct: 35  RALRELRFDFFAYGMCSVTPFMRPKTYMYGNYPEHWLQRYQAANYALIDPTVKHSKVSSA 94

Query: 86  PIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEV 145
           PI+W +       +                 G+A P      + G +    +   ++ + 
Sbjct: 95  PILWSNELFRNCPD-----LWSEANDSSLCHGLAQPSFNTQGRVGVLSLARKDNAISLQE 149

Query: 146 IIEAH----GACYQVIT--DFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLG 199
                          +     LE   +  +     +ERE   L+   DG TSEEI   +G
Sbjct: 150 FEALKPVTKAFAAAALEKISALETDVRAFNTDVEFSERECDVLRWTADGKTSEEIGVIMG 209

Query: 200 LSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +   TVN +  +   K+ A NR+QA++ A+  GYI
Sbjct: 210 VCTDTVNYHHRNIQRKIGASNRVQAVSYAVALGYI 244


>gi|289649319|ref|ZP_06480662.1| LuxR transcriptional regulator [Pseudomonas syringae pv. aesculi
           str. 2250]
          Length = 247

 Score =  146 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 39/230 (16%), Positives = 68/230 (29%), Gaps = 15/230 (6%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           L++L        + I    +A ++         R      L NY                
Sbjct: 24  LRQLIEDFENDLHHIGDFTYAYFSTPKT-----RNVKPVILSNYPDSWLKSYVASNYHLI 78

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
           D  + H    + P  W+  +       +     R        +G  F +         + 
Sbjct: 79  DPIIKHAWHSITPFFWREARNAAQGVETDDFLKRSAK-YQLSSGATFTLHDASGLFAALS 137

Query: 134 FTSEFLMLANEVIIE---------AHGACYQVITDFLELFKKRSSAARNLTERETSCLQL 184
             +       +  I                ++I            A   L+ RET  L+ 
Sbjct: 138 LCNARQQKDFDQRIREKAADIQMSLIRFHDRLIKTRAPHELFPQPAQCKLSTRETGVLKW 197

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              G +  EIAE   +S  TV  ++ + + KL+     QA+ KAI  G +
Sbjct: 198 VAMGKSYSEIAEIFSISERTVKFHMSNVSSKLEVRTAKQAVYKAINMGMV 247


>gi|150377825|ref|YP_001314420.1| response regulator receiver protein [Sinorhizobium medicae WSM419]
 gi|150032372|gb|ABR64487.1| response regulator receiver protein [Sinorhizobium medicae WSM419]
          Length = 243

 Score =  146 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 51/240 (21%), Positives = 85/240 (35%), Gaps = 11/240 (4%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLD 60
           +S +  T + +    +L   L  +       +  +  + S                Y   
Sbjct: 7   LSASLRTLQAAKHRADLQSALGELCEHYGVSHMTILVVCSGGR---SGSYPYCCTTYPER 63

Query: 61  SGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAF 120
             +          D  +     G LP+ W S+   +  E + +L        +   G+  
Sbjct: 64  WTEKYVGKCFFEIDPVIDVIRWGFLPVDWSSLDRRS--EQAHRLFKEARLYDIGPHGLTI 121

Query: 121 PVRLGFHKNGYVIFT-----SEFLMLANEVIIEAHGACYQVITDFLELFKKR-SSAARNL 174
           P+R    +   +  T       +  L    I E     + +    L     R +   RNL
Sbjct: 122 PIRGPKGERCLLSVTSNLPGRHWSRLRASSIHELQILSHYLHETVLSASGLRGTDRYRNL 181

Query: 175 TERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           + RE+ C QL   G  S++IA  LG+S + V  YL SA +KL A    QA+A+A     I
Sbjct: 182 SRRESQCFQLLATGRISKQIAADLGISENAVKLYLRSARMKLGAATSHQAVARASFLELI 241


>gi|323528655|ref|YP_004230807.1| LuxR family transcriptional regulator [Burkholderia sp. CCGE1001]
 gi|323385657|gb|ADX57747.1| transcriptional regulator, LuxR family [Burkholderia sp. CCGE1001]
          Length = 242

 Score =  146 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 38/231 (16%), Positives = 71/231 (30%), Gaps = 13/231 (5%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           ++   E    +  +          +  +        R +       Y  +     +    
Sbjct: 15  AADEAEWFSAVAGLAETWGFDRLLVAMLPRPT---IRLEDAYVRSTYAPEWRRTYDEQGL 71

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
            + D  + H  +   P++W     E    +  Q            AG+  P+     + G
Sbjct: 72  VHIDPTVAHCATRSTPLVWS---PEIFTTAPQQSMYEEARAHGLRAGVTLPIHGPNQEAG 128

Query: 131 YVIFTSEFLMLANEVI-IEAHGACYQVITDF------LELFKKRSSAARNLTERETSCLQ 183
            + F ++          I+       ++ D         L     +    LT RE  CLQ
Sbjct: 129 MMCFVNDASPTDTFWRHIDVVLPNLVLLRDLVIDTSQRHLNTHAQTLLPKLTPRERECLQ 188

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G ++ EI+  L  S   VN ++ +   KL   +R  A   A + G I
Sbjct: 189 WTARGKSTWEISHILNCSEAVVNFHMKNIRTKLGVNSRRAAAVIATQLGLI 239


>gi|218509884|ref|ZP_03507762.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli Brasil 5]
          Length = 373

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 74/194 (38%), Positives = 113/194 (58%), Gaps = 3/194 (1%)

Query: 6   LTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIP 65
           +   + SS  +L PRL  +Q    A+ FA+Y ++ +   P +Q+L+CEL N+   +    
Sbjct: 10  VRVNRISSRSDLFPRLIAMQKLADAQGFAIYRVSGS-GLPAKQRLVCELENWGSSNAGFG 68

Query: 66  NILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESS--GQLSVRLEGGLLPFAGIAFPVR 123
               + YGD  L H    LLP+ W    +      +       RL  G+LPF+G+AFPVR
Sbjct: 69  KAFTDAYGDILLDHIEKSLLPLSWAGAHDRAAPGPADFAPFMTRLRDGILPFSGLAFPVR 128

Query: 124 LGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
           LG   NG+++FT + +  ++++I+E HG C  ++ D L L ++R++AA  L+ERE +CLQ
Sbjct: 129 LGAVGNGFILFTGDDIDPSSDMIVELHGRCCHIMMDLLSLDERRTAAAEALSEREIACLQ 188

Query: 184 LAGDGYTSEEIAEK 197
           LAGDG  SEEIA K
Sbjct: 189 LAGDGRISEEIARK 202


>gi|257487581|ref|ZP_05641622.1| LuxR transcriptional regulator [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|331012605|gb|EGH92661.1| LuxR transcriptional regulator [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 247

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 39/230 (16%), Positives = 67/230 (29%), Gaps = 15/230 (6%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           L++L        + I    +A ++         R      L NY                
Sbjct: 24  LRQLIEDFENDLHHIGDFTYAYFSTPKT-----RNVKPVILSNYPDSWLKSYVASNYHLI 78

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
           D  + H    + P  W+  +       +     R        +G  F +         + 
Sbjct: 79  DPIIKHAWHSITPFFWREARNAVQGVETDDFLKRSAK-YQLSSGATFTLHDASGLFAALS 137

Query: 134 FTSEFLMLANEVIIE---------AHGACYQVITDFLELFKKRSSAARNLTERETSCLQL 184
             +       +  I                ++I            A   L+ RET  L+ 
Sbjct: 138 LCNARQQNDFDQRIREKAADIQMSLIRFHDRLIKTRAPHELFPQPAQCKLSTRETGVLKW 197

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              G +  EIAE   +S  TV  ++ + + KL      QA+ KAI  G +
Sbjct: 198 VAMGKSYSEIAEIFSISERTVKFHMSNVSSKLKVRTAKQAVYKAINMGMV 247


>gi|118917992|dbj|BAF40420.1| PsyR [Pseudomonas syringae pv. tabaci]
          Length = 247

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 38/230 (16%), Positives = 67/230 (29%), Gaps = 15/230 (6%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           L++L        + I    +A ++         R      L NY                
Sbjct: 24  LRQLIEDFENDLHHIGDFTYAYFSTPKT-----RNVKPVILSNYPDSWLKSYVASNYHLI 78

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
           D  + H    + P  W+  +       +     R        +G  F +         + 
Sbjct: 79  DPIIKHAWHSITPFFWREARNAVQGVETDDFLKRSAK-YQLSSGATFTLHDASGLFAALS 137

Query: 134 FTSEFLMLANEVIIE---------AHGACYQVITDFLELFKKRSSAARNLTERETSCLQL 184
             +       +  I                ++I                L+ RET  L+ 
Sbjct: 138 LCNARQQNDFDQRIREKAADIQMSLIRFHDRLIKTRAPHELFPQPTQCKLSTRETGVLKW 197

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              G +  EIAE   +S  TV  ++ + + KL+     QA+ KAI  G +
Sbjct: 198 VAMGKSYSEIAEIFSISERTVKFHMSNVSSKLEVRTAKQAVYKAINMGMV 247


>gi|330985566|gb|EGH83669.1| LuxR transcriptional regulator [Pseudomonas syringae pv. lachrymans
           str. M301315]
          Length = 247

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 39/230 (16%), Positives = 68/230 (29%), Gaps = 15/230 (6%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           L++L        + I    +A ++         R      L NY                
Sbjct: 24  LRQLIEDFENDLHHIGDFTYAYFSTPKT-----RNVKPVILSNYPDSWLKSYVASNYHLI 78

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
           D  + H    + P  W+  +       +     R        +G  F +         + 
Sbjct: 79  DPIIKHAWHSITPFFWREARNAVQGVETDDFLKRSAQ-YQLSSGATFTLHDASGLFAALS 137

Query: 134 FTSEFLMLANEVIIE---------AHGACYQVITDFLELFKKRSSAARNLTERETSCLQL 184
             +       +  I                ++I            A   L+ RET  L+ 
Sbjct: 138 LCNARQQNDFDQRIREKAADIQMSLIRFHDRLIKTRAPHELFPQPAQCKLSTRETGVLKW 197

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              G +  EIAE   +S  TV  ++ + + KL+     QA+ KAI  G +
Sbjct: 198 VAMGKSYSEIAEIFSISERTVKFHMSNVSSKLEVRTAKQAVYKAINMGMV 247


>gi|167566223|ref|ZP_02359139.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           oklahomensis EO147]
 gi|167573334|ref|ZP_02366208.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           oklahomensis C6786]
          Length = 230

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 37/221 (16%), Positives = 69/221 (31%), Gaps = 5/221 (2%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++   +   +       +  + I           +     +Y  +  +          D 
Sbjct: 11  DVRTLIETFRQAALQIGYQHHAIVELSGASHSASVNVVSLHYPSEWVEHYTRNDYFDIDP 70

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
                     P  W  +    +     +  +          GI+ P+         +  +
Sbjct: 71  IPRAAFRYSTPFSWSDVATSNL---RERHLLMEAEDAGLDNGISIPLHQPLGHVLLINLS 127

Query: 136 SEFLMLANEVIIE-AHGACYQVITDFLELFKKRS-SAARNLTERETSCLQLAGDGYTSEE 193
                   E     A+    Q    F  +   R    + +LT+RE  CL     G +S  
Sbjct: 128 GTAPTHDAEAKWRNAYLLGMQFHLQFQSMRTSRPIPPSVHLTDREQICLTWVARGKSSWV 187

Query: 194 IAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           IA  L +S +TV+ ++ +A  KL+  +R  A  KA R G I
Sbjct: 188 IANMLDISKYTVDFHIENAMEKLNTRSRTFAAVKATRQGLI 228


>gi|239831035|ref|ZP_04679364.1| Transcriptional activator protein solR [Ochrobactrum intermedium
           LMG 3301]
 gi|239823302|gb|EEQ94870.1| Transcriptional activator protein solR [Ochrobactrum intermedium
           LMG 3301]
          Length = 238

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 46/233 (19%), Positives = 76/233 (32%), Gaps = 12/233 (5%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           +   S  +    L  I    +   FA       +             +   +  D     
Sbjct: 11  ESMQSADDAGQLLEYINTYARQCGFAHTAYLMRIPLLNGVVKWLSFGSLPQEWTDHYADK 70

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +    + + P++W S       +                 GI+ P       
Sbjct: 71  KYADIDPLVRKALNSIEPLVWSSKLFAEAPQ-----IWTDAQRFGIRVGISQPCWAAQGV 125

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDF-LELFKKRSSAARN------LTERETSC 181
            G + F      L++  I         V     L +++       N      LT RE   
Sbjct: 126 FGMLSFLRSGPALSSGEISMLRRQLQTVANMLHLAMYEHLDVPTMNCVSEVNLTMREREI 185

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           L+   +G T+E I   L +S  TVN ++ +   KL AVN++QA+AKA  FG +
Sbjct: 186 LRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNKVQAVAKARTFGLL 238


>gi|307727058|ref|YP_003910271.1| LuxR family transcriptional regulator [Burkholderia sp. CCGE1003]
 gi|307587583|gb|ADN60980.1| transcriptional regulator, LuxR family [Burkholderia sp. CCGE1003]
          Length = 242

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 38/231 (16%), Positives = 68/231 (29%), Gaps = 13/231 (5%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           ++   E    +  +          +  +                  Y        +    
Sbjct: 15  AADEAEWFSAVAKLAETWGFDRLLIAMLPRPTMRLE---DAYIRSTYAPAWRRTYDEQGL 71

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
            + D  + H  +   P++W     E    +  Q            AG+  P+     + G
Sbjct: 72  VHIDPTVAHCATRSTPLVWS---PEIFTTAPQQSMYEEARAHGLRAGVTLPIHGPNQEAG 128

Query: 131 YVIFTSEFLMLANEVI-IEAHGACYQVITDF------LELFKKRSSAARNLTERETSCLQ 183
            + F ++          I+       ++ D         L     S    LT RE  CLQ
Sbjct: 129 MMCFVNDASPTDTFWRHIDVVLPNLVLLRDLVIDTSQRHLHTHAQSLLPKLTPRERECLQ 188

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G ++ EI+  L  S   VN ++ +   KL   +R  A   A + G I
Sbjct: 189 WTARGKSTWEISHILNCSEAVVNFHMKNIRTKLGVNSRRAAAVIATQLGLI 239


>gi|186473257|ref|YP_001860599.1| LuxR family transcriptional regulator [Burkholderia phymatum
           STM815]
 gi|184195589|gb|ACC73553.1| transcriptional regulator, LuxR family [Burkholderia phymatum
           STM815]
          Length = 234

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 37/223 (16%), Positives = 67/223 (30%), Gaps = 10/223 (4%)

Query: 19  PRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLF 78
                +        F    +        R +       Y        N     + D  + 
Sbjct: 12  TWFRELARLADDWGFDRVLVGILPRPGMRLEDAFIRSTYSPTWRQFYNEQGFAHIDPTVA 71

Query: 79  HFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEF 138
           H  +   P+IW     +       Q            AG++ P+     ++G + F ++ 
Sbjct: 72  HCMTKSSPLIWS---PDLFDTYPAQTMYEEARAHGLRAGVSLPIHGPRQESGLICFVNDH 128

Query: 139 -LMLANEVIIEAHGACYQVITDFL------ELFKKRSSAARNLTERETSCLQLAGDGYTS 191
                    ++       ++ D +       L     +    LT RE  CL+    G ++
Sbjct: 129 NPSDDFWRHLDVVLPNLVLLRDLVIDTSQPHLNTHTQALVPKLTPREQECLKWTARGKST 188

Query: 192 EEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            EI+  L  S   VN +L +   K    +R  A   A + G I
Sbjct: 189 WEISHILNCSEAVVNFHLKNIRTKFGVNSRRAAAVIATQLGLI 231


>gi|298486193|ref|ZP_07004256.1| transcriptional regulator PsyR [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298159200|gb|EFI00258.1| transcriptional regulator PsyR [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|306431677|emb|CBM41481.1| N-acyl homoserine lactone sensor/regulator [Pseudomonas savastanoi
           pv. savastanoi]
          Length = 247

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 38/230 (16%), Positives = 67/230 (29%), Gaps = 15/230 (6%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           L++L        + I    +A ++         R        NY                
Sbjct: 24  LRQLIEDFENDLHHIGDFTYAYFSTPKT-----RNVKPVISSNYPDSWLKSYVASNYHLI 78

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
           D  + H    + P  W+  +       +     R        +G  F +         + 
Sbjct: 79  DPIIKHAWHSITPFFWREARNAVQGVETDDFLKRSAK-YQLSSGATFTLHDASGLFAALS 137

Query: 134 FTSEFLMLANEVIIE---------AHGACYQVITDFLELFKKRSSAARNLTERETSCLQL 184
             +       +  I                ++I            A   L+ RET  L+ 
Sbjct: 138 LCNARQQNDFDQRIREKAADIQMSLIRFHDRLIKTRAPHELFPQPAQCKLSTRETGVLKW 197

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              G +  EIAE   +S  TV  ++ + + KL+     QA+ KAI  G +
Sbjct: 198 MAMGKSYSEIAEIFSISERTVKFHMSNVSSKLEVRTAKQAVYKAINMGMV 247


>gi|315499426|ref|YP_004088229.1| transcriptional regulator, luxr family [Asticcacaulis excentricus
           CB 48]
 gi|315417438|gb|ADU14078.1| transcriptional regulator, LuxR family [Asticcacaulis excentricus
           CB 48]
          Length = 248

 Score =  145 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 41/232 (17%), Positives = 75/232 (32%), Gaps = 5/232 (2%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
              +  S++ L          +       +++   +D     Q    +  Y     D   
Sbjct: 16  DTSRVRSVERLFVVFIEAMAHLGFDR-VNFSVMRDMDLDASAQGFGLISTYPTVWQDYYA 74

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                  D  +      + P  W  I+ E  +    +  +R       + GI  P     
Sbjct: 75  HNGLARIDPVVKWAVGSVRPFRWADIEHEAELTRRQRQFLREAEAGGLYNGIGVPFPGPK 134

Query: 127 HKNGYVIFTSE----FLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCL 182
              G +   +       M   +V+       Y V    +    + S AA +LT  E   L
Sbjct: 135 TLRGGIALATSVRKARPMENLDVLAAYCHHFYAVYKRLVPPGLRLSPAAASLTRTEQEVL 194

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
                G ++E IA++L +   +V+ ++ +   K    NR  A  K +  GYI
Sbjct: 195 FRLAHGLSNEIIADRLSIKAGSVDFHVQNIFRKFGVNNRTAAAMKGLMGGYI 246


>gi|167837236|ref|ZP_02464119.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia thailandensis MSMB43]
          Length = 237

 Score =  145 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 45/240 (18%), Positives = 77/240 (32%), Gaps = 17/240 (7%)

Query: 3   ENTLTG-KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDS 61
           E+ L G   + S +E    +      +    F        + +P  +  I    N+    
Sbjct: 6   EDLLAGLDSARSEEEAFRSIETATTALD---FEYCAYGLRVPWPLSRPRIETRSNFPEQW 62

Query: 62  GDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFP 121
                       D  L H      P++       +                    G A  
Sbjct: 63  KRRYVEAGFLDIDPILAHGRRSQQPVVLSETLFAS-----SHQMWVEAQSFGLRFGWAQS 117

Query: 122 VRLGFHKNGYVIFTSEFLMLANEVI-------IEAHGACYQVITDFLELFKKRSSAARNL 174
               +   G +        +    +              +  +   + L K  +   R L
Sbjct: 118 SFDAYGGMGMLALVRSRGPVTEAELDAKEYRMRWLVRTAHAALGRMM-LPKLMADPERGL 176

Query: 175 TERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           TERE   L+ A DG TS EI++ L +SV TVN ++ +A +KL   N+  A+ +A   G +
Sbjct: 177 TEREVEVLKWAADGKTSGEISKILAISVDTVNFHVKNAILKLRTANKTAAVVRAAMLGLL 236


>gi|307322370|ref|ZP_07601730.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|306891988|gb|EFN22814.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
          Length = 243

 Score =  145 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 54/240 (22%), Positives = 84/240 (35%), Gaps = 11/240 (4%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLD 60
           +S +  T + +    +L P L  +  R    +     + S                Y   
Sbjct: 7   LSLSLRTLQSAKHRGDLHPALDELCARYGLSHMTFLVVCSGGR---SGLYPDYCTTYPGK 63

Query: 61  SGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAF 120
             +I         D  +     G LP+ W S+   +    + +L        +   G+  
Sbjct: 64  WTEIYVDKRYFDIDPVIDVIRWGFLPVDWSSLDRRSAQ--AYRLFKEARSYDIGPHGLTI 121

Query: 121 PVRLGFHKNGYVIFTSEFLMLANE-----VIIEAHGACYQVITDFLELFK-KRSSAARNL 174
           P+R    +      +S              I E     + +    L     +     R L
Sbjct: 122 PIRGSKGERCLFSVSSNLPKRDWSRLGASSIHELQILSHYLHETTLSASGLREVGRYRTL 181

Query: 175 TERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           + RET CLQL   G  S++IA  LG+S + V  YL SA VKL+A    QA+AKA     I
Sbjct: 182 SRRETQCLQLLATGRISKQIAADLGISENAVKLYLRSARVKLNAATSYQAVAKASFLELI 241


>gi|254563872|ref|YP_003070967.1| N-acylhomoserine lactone LuxR family transcriptional regulator
           [Methylobacterium extorquens DM4]
 gi|254271150|emb|CAX27157.1| N-acylhomoserine lactone transcriptional regulator, LuxR family
           [Methylobacterium extorquens DM4]
          Length = 165

 Score =  145 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 44/164 (26%), Positives = 65/164 (39%)

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
            Y D  +    S      W  I+   V++   +  +   G      G   P+     + G
Sbjct: 1   MYTDPVVQATLSSTTGFRWSEIEPAGVLDPRSRQVMNEAGEFGLGDGFTVPLATLEEERG 60

Query: 131 YVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYT 190
            + F    L ++             V+   L +    S     LT RE   LQ   +G T
Sbjct: 61  GLTFAGPQLDISPGQRGMLTLLASYVVGQTLLIDNGPSERRMGLTPRERESLQWVAEGKT 120

Query: 191 SEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             EI E +G+S H V+ +L SA VKL  V+R QA+A+  R G I
Sbjct: 121 DWEIGELMGISRHGVDFHLRSARVKLGCVSRTQAVAEGFRRGLI 164


>gi|209551411|ref|YP_002283328.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537167|gb|ACI57102.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 251

 Score =  145 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 48/231 (20%), Positives = 74/231 (32%), Gaps = 14/231 (6%)

Query: 18  SPRLHLIQNRIKARNFALYTINSALDFPRRQQLIC-----ELHNYDLDSGDIPNILIETY 72
              +   +  I    F  Y +   L     Q+            +      I +      
Sbjct: 20  RALVTEFERVIDDCGFEYYGLLRHLPQNPAQRHPEPRAAALADRWPEQWPQIYSAKKYVM 79

Query: 73  GDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRL---EGGLLPFAGIAFPVRLGFHKN 129
            D  + +      P  W+        ++  +   ++     G     G  FPV       
Sbjct: 80  IDPMVRYLAHAQRPFRWRESLAAFGKDAQRRRMEQMMVDAFGHGLEDGYIFPVHGRNGIL 139

Query: 130 GYVIFTSEFLMLANEVIIEAHGACYQVITDFLELF------KKRSSAARNLTERETSCLQ 183
           G +    + + L+   I        +     LEL       +    A   LT RE   L 
Sbjct: 140 GSLSLAGKPVELSPVEIALFEAVARKSFWRMLELKDEAQALETVLPADTPLTRREMEILH 199

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              +G TS EI + L +S HTV+ Y+     KL A NR QA+A A R   I
Sbjct: 200 YLAEGMTSMEIGKVLKISNHTVDWYMNGLQNKLKAKNRQQAVALAFRHRLI 250


>gi|222087763|ref|YP_002546300.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
 gi|221725211|gb|ACM28367.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
          Length = 246

 Score =  145 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 39/224 (17%), Positives = 71/224 (31%), Gaps = 9/224 (4%)

Query: 20  RLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFH 79
            +  +++ +++  F  Y +            +     +                D  + +
Sbjct: 22  VVTELESVLRSYKFDFYGLLRHPRPAVDIVSVMLAGRWPDKWPLTYVARKYVLVDPTMRY 81

Query: 80  FNSGLLPIIWQSIQEE---TVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTS 136
                 P  W+          +    +  +          G  FP+       G +    
Sbjct: 82  LGQAQRPFRWRDAMAALKGDPLRRRMEQMMADARANGLVDGYIFPIFGRSGLLGTMTIGG 141

Query: 137 EFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARN------LTERETSCLQLAGDGYT 190
             + L+   +        +V    LEL  +             LT RE   L    +G T
Sbjct: 142 NSVDLSPAELSLFDAVAKKVFWRLLELRDEARPLEEAPAIEAKLTRREIEVLNHLAEGMT 201

Query: 191 SEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           S +I+  L +S HTV+ Y+ S   KL+A NR   +A A R G +
Sbjct: 202 SMDISRTLKISNHTVDWYMNSIQDKLNARNRQHIVAIAFRNGLV 245


>gi|307315521|ref|ZP_07595072.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
 gi|306898775|gb|EFN29433.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
          Length = 243

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 54/240 (22%), Positives = 86/240 (35%), Gaps = 11/240 (4%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLD 60
           +S +  T + +    +L P L  +  R    +     + S                Y   
Sbjct: 7   LSLSLRTLQSAKHRGDLHPALDELCARYGLSHMTFLVVCSGGR---SGLYPDYCTTYPGK 63

Query: 61  SGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAF 120
             +I         D  +     G LP+ W S+   +    + +L        +   G+  
Sbjct: 64  WTEIYVDKRYFDIDPVIDVIRWGFLPVDWSSLDRRSAQ--AYRLFKEARSYDIGPHGLTI 121

Query: 121 PVRLGFHKNGYVIFT-----SEFLMLANEVIIEAHGACYQVITDFLELFK-KRSSAARNL 174
           P+R    +      +      ++  L    I E     + +    L     +     R L
Sbjct: 122 PIRGSKGERCLFSVSSNLPKRDWSRLRASSIHELQILSHYLHETTLSASGLREVGRYRTL 181

Query: 175 TERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           + RET CLQL   G  S++IA  LG+S + V  YL SA VKL+A    QA+AKA     I
Sbjct: 182 SRRETQCLQLLATGRISKQIAADLGISENAVKLYLRSARVKLNAATSYQAVAKASFLELI 241


>gi|295700193|ref|YP_003608086.1| LuxR family transcriptional regulator [Burkholderia sp. CCGE1002]
 gi|295439406|gb|ADG18575.1| transcriptional regulator, LuxR family [Burkholderia sp. CCGE1002]
          Length = 234

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 38/231 (16%), Positives = 68/231 (29%), Gaps = 13/231 (5%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           ++   E    +  +          +  +                  Y        +    
Sbjct: 7   AADEAEWFGVITGLAETWGFDRILVAMLPRPTMRLE---DAYLRSTYAPAWRQTYDEQGM 63

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
            + D  + H  S   P+IW     E     + Q            AG+  P+     + G
Sbjct: 64  VHIDPTVAHCLSRSAPLIWT---PEIFATPAQQSLYEEARSYGLGAGVTLPIHGPNQEAG 120

Query: 131 YVIFTSEFLMLA-NEVIIEAHGACYQVITDFL------ELFKKRSSAARNLTERETSCLQ 183
            + F ++          + A      ++ D +       L     S    LT RE  CL+
Sbjct: 121 MMCFVNDDKPADGFRRHVNAALPNLVLLRDLVIDTSKQHLDSHAQSLMPKLTPRERECLK 180

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G ++ EI+  L  S   VN ++ +   K    +R  A   A + G I
Sbjct: 181 WTARGKSTWEISHILSCSEAVVNFHMKNIRAKFGVNSRRAAAVIAAQLGLI 231


>gi|167581251|ref|ZP_02374125.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia thailandensis TXDOH]
 gi|167619336|ref|ZP_02387967.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia thailandensis Bt4]
 gi|257138549|ref|ZP_05586811.1| ATP-dependent transcription regulator LuxR [Burkholderia
           thailandensis E264]
          Length = 237

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 45/240 (18%), Positives = 77/240 (32%), Gaps = 17/240 (7%)

Query: 3   ENTLTG-KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDS 61
           E+ L G   + S  E    +      +    F        + +P  +  I    N+    
Sbjct: 6   EDLLAGLDSARSEDEAFRSIETAATALD---FEYCAYGLRVPWPLSRPRIETRSNFPEQW 62

Query: 62  GDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFP 121
                       D  L H      P++       +                    G A  
Sbjct: 63  KRRYVEAGFLDVDPILAHGRRSQQPVVLNETLFAS-----SHQMWVEAQSFGLRFGWAQS 117

Query: 122 VRLGFHKNGYVIFTSEFLMLANEVI-------IEAHGACYQVITDFLELFKKRSSAARNL 174
               +   G +        + +  +              +  +   + L K  +   R L
Sbjct: 118 SFDAYGGMGMLALVRSREPVTHAELDAKEYRMRWLVRTAHAALGRMM-LPKLMADPERGL 176

Query: 175 TERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           TERE   L+ A DG TS EI++ L +SV TVN ++ +A +KL   N+  A+ +A   G +
Sbjct: 177 TEREVEVLKWAADGKTSGEISKILAISVDTVNFHVKNAILKLRTANKTAAVVRAAMLGLL 236


>gi|209809715|ref|YP_002265254.1| transcriptional activator protein LuxR [Aliivibrio salmonicida
           LFI1238]
 gi|21311436|gb|AAM46717.1|AF452135_2 LuxR1 [Aliivibrio salmonicida]
 gi|208011278|emb|CAQ81719.1| transcriptional activator protein LuxR [Aliivibrio salmonicida
           LFI1238]
          Length = 248

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 49/229 (21%), Positives = 94/229 (41%), Gaps = 9/229 (3%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           SSS  +++  L  + N +   N   Y  +   +    +  +  L NY     D  +    
Sbjct: 19  SSSNDQINQCLIEVANTL---NCEYYLFSIISNKSMIKPDVLILDNYPQKWRDHYDETNL 75

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
              D  + +      PI+W    ++T+  +     ++    L  ++G +FP+       G
Sbjct: 76  IKYDPIVDYCFFNHSPILWDIFGKKTLKTNKPN-VIQEAKSLGLYSGFSFPIHSVNGSFG 134

Query: 131 YVIFTSEFLMLANEVIIEAH-----GACYQVITDFLELFKKRSSAARNLTERETSCLQLA 185
            + F       + + +              ++  +  + K  + +  +LT+RE  CL  A
Sbjct: 135 MISFAHSNKKQSTDCLFSTACMYIPLIIPALLDSYYRINKNNTESTHDLTKREKECLAWA 194

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +G +S EI+  LG +  TV  +L ++  KL   NR Q+++KAI  G I
Sbjct: 195 CEGKSSWEISIILGCTERTVAFHLTNSQTKLGTTNRCQSVSKAILTGAI 243


>gi|83716740|ref|YP_439002.1| LuxR family transcriptional regulator [Burkholderia thailandensis
           E264]
 gi|167577397|ref|ZP_02370271.1| transcriptional regulator, LuxR family protein [Burkholderia
           thailandensis TXDOH]
 gi|167615548|ref|ZP_02384183.1| transcriptional regulator, LuxR family protein [Burkholderia
           thailandensis Bt4]
 gi|257142109|ref|ZP_05590371.1| LuxR family transcriptional regulator [Burkholderia thailandensis
           E264]
 gi|83650565|gb|ABC34629.1| transcriptional regulator, LuxR family [Burkholderia thailandensis
           E264]
          Length = 230

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 36/221 (16%), Positives = 69/221 (31%), Gaps = 5/221 (2%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++   +   +       +  + I           +     +Y  +  +          D 
Sbjct: 11  DVRTLIETFRQAALQIGYQHHAIVELSGTSHPASIDVVSLHYPSEWVEHYTRNDYFTIDP 70

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
                     P  W  I    +     +  +          GI+ P+     +   V  +
Sbjct: 71  VHRAAFRYSTPFPWNDIATSNL---RERHLLMEAEDAGLDNGISIPLHQPLGRVLLVSLS 127

Query: 136 SEFLMLANEVIIE-AHGACYQVITDFLELFK-KRSSAARNLTERETSCLQLAGDGYTSEE 193
                   +     A+    Q       +   +    + +LT+RE  CL     G +S  
Sbjct: 128 GTAPTHDADAKWRNAYLLGMQFNLQLQSMRTCRPIPPSVHLTDREQMCLTWVARGKSSWV 187

Query: 194 IAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           IA  L +S +TV+ ++ +A  KL+  +R  A  KA R G I
Sbjct: 188 IANMLDISKYTVDFHIENAMEKLNTRSRTFAAVKATRQGLI 228


>gi|307302498|ref|ZP_07582255.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
 gi|307316172|ref|ZP_07595616.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|86278997|gb|ABC88593.1| N-acyl homoserine lactone receptor [Sinorhizobium meliloti]
 gi|306898012|gb|EFN28754.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|306903168|gb|EFN33758.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
          Length = 246

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 44/235 (18%), Positives = 74/235 (31%), Gaps = 12/235 (5%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++  + +E+ P    + +R     + +       + P R   +     +      I    
Sbjct: 14  EEMKTREEILPEFERLLDRCGFDFYGIVRQPKPHENPLR---LLLAGRWPEGWPQIYIRK 70

Query: 69  IETYGDDFLFHFNSGLLPIIWQS---IQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLG 125
                D  +           W+               +  +        F G  FPV   
Sbjct: 71  KYVVIDPTIRFLGHAQRGFRWRDTLVAFRSDPHRKRMESMMVEARNHGLFDGYIFPVHGR 130

Query: 126 FHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLEL------FKKRSSAARNLTERET 179
               G +      + L+   +        ++    LEL       +  S     +T RE 
Sbjct: 131 RGLMGNLTVGGRVVDLSPVELSLFDAIAKRLFWKLLELTDPEIMAELVSRVEVQMTRREM 190

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L    DG TS +I + L +S HTV+ Y+     KL A NR   +A A R G I
Sbjct: 191 EALHYLADGMTSNDIGKVLDISSHTVDWYMNGIQEKLKAKNRHHVVAIAFRLGLI 245


>gi|206576935|ref|YP_002237709.1| regulatory protein SdiA [Klebsiella pneumoniae 342]
 gi|290508769|ref|ZP_06548140.1| DNA-binding transcriptional activator SdiA [Klebsiella sp. 1_1_55]
 gi|206565993|gb|ACI07769.1| regulatory protein SdiA [Klebsiella pneumoniae 342]
 gi|289778163|gb|EFD86160.1| DNA-binding transcriptional activator SdiA [Klebsiella sp. 1_1_55]
          Length = 240

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 36/217 (16%), Positives = 66/217 (30%), Gaps = 12/217 (5%)

Query: 24  IQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSG 83
           +Q   +A  +  YT+      P  +  +     Y                D  L      
Sbjct: 30  LQRETEALEYDYYTLCVRHPVPFTRPRVTFQSTYPRAWMSHYQAENYFAIDPVLR----- 84

Query: 84  LLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT------SE 137
               +   +  E  +                  G+   + L  H  G++  +        
Sbjct: 85  PENFMRGHLPWEDGLFRDAAALWDGARDHGLKKGVTQCLTLPNHAQGFLSVSANNRLPGS 144

Query: 138 FLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEK 197
           +     E+ +        +    LE  +         + RE   L+   +G TS E+A  
Sbjct: 145 YPDDELEMRLRMLTELSLLALLRLE-DEMVMPPEMKFSRRELEILKWTAEGKTSAEVAMI 203

Query: 198 LGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           L +S +TVN +  +   K +A N+ Q    A+  G I
Sbjct: 204 LSISENTVNFHQKNMQRKFNAPNKTQIACYAVATGLI 240


>gi|288934569|ref|YP_003438628.1| LuxR family transcriptional regulator [Klebsiella variicola At-22]
 gi|288889278|gb|ADC57596.1| transcriptional regulator, LuxR family [Klebsiella variicola At-22]
          Length = 240

 Score =  145 bits (365), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 36/217 (16%), Positives = 66/217 (30%), Gaps = 12/217 (5%)

Query: 24  IQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSG 83
           +Q   +A  +  YT+      P  +  +     Y                D  L      
Sbjct: 30  LQRETEALEYDYYTLCVRHPVPFTRPRVTFQSTYPRAWMSHYQAENYFAIDPVLR----- 84

Query: 84  LLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT------SE 137
               +   +  E  +                  G+   + L  H  G++  +        
Sbjct: 85  PENFMRGHLPWEDGLFRDAAALWEGARDHGLKKGVTQCLTLPNHAQGFLSVSANNRLPGS 144

Query: 138 FLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEK 197
           +     E+ +        +    LE  +         + RE   L+   +G TS E+A  
Sbjct: 145 YPDDELEMRLRMLTELSLLALLRLE-DEMVMPPEMKFSRRELEILKWTAEGKTSAEVAMI 203

Query: 198 LGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           L +S +TVN +  +   K +A N+ Q    A+  G I
Sbjct: 204 LSISENTVNFHQKNMQRKFNAPNKTQIACYAVATGLI 240


>gi|43288|emb|CAA27327.1| unnamed protein product [Escherichia coli]
          Length = 241

 Score =  145 bits (365), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 38/236 (16%), Positives = 82/236 (34%), Gaps = 14/236 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   + L   +++   +  Y++      P  +  +    NY       
Sbjct: 14  LLRFQRMETAEEVYHEIELQAQQLE---YDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSY 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGI-AFPVR 123
                    D  L   N     ++W             Q             G+ +    
Sbjct: 71  YQAKNFLAIDPVLNPENFSQGHLMWNDDLFS-----EAQPLWEAARAHGLRRGVHSVFNA 125

Query: 124 LGFHKNGYVIFTS---EFLMLANEVI-IEAHGACYQVITDFLEL-FKKRSSAARNLTERE 178
                 G++ F+      + + ++ + ++      + +   + L  +   +   N ++RE
Sbjct: 126 AQTGALGFLSFSRCSRREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKRE 185

Query: 179 TSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 186 KEILRWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 241


>gi|71733308|ref|YP_273861.1| autoinducer transcriptional regulator AhlR [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|71553861|gb|AAZ33072.1| autoinducer transcriptional regulator AhlR [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|320327729|gb|EFW83737.1| autoinducer transcriptional regulator AhlR [Pseudomonas syringae
           pv. glycinea str. race 4]
          Length = 233

 Score =  145 bits (365), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 39/230 (16%), Positives = 68/230 (29%), Gaps = 15/230 (6%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           L++L        + I    +A ++         R      L NY                
Sbjct: 10  LRQLIEDFENDLHHIGDFTYAYFSTPKT-----RNVKPVILSNYPDSWLKSYVASNYHLI 64

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
           D  + H    + P  W+  +       +     R        +G  F +         + 
Sbjct: 65  DPIIKHAWHSITPFFWREARNAVQGVETDDFLKRSAK-YQLSSGATFTLHDASGLFAALS 123

Query: 134 FTSEFLMLANEVIIE---------AHGACYQVITDFLELFKKRSSAARNLTERETSCLQL 184
             +       +  I                ++I            A   L+ RET  L+ 
Sbjct: 124 LCNARQQNDFDQRIREKAADIQMSLIRFHDRLIKTRAPHELFPQPAQCKLSTRETGVLKW 183

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              G +  EIAE   +S  TV  ++ + + KL+     QA+ KAI  G +
Sbjct: 184 VAMGKSYSEIAEIFSISERTVKFHMSNVSSKLEVRTAKQAVYKAINIGMV 233


>gi|150398334|ref|YP_001328801.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
 gi|150029849|gb|ABR61966.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
          Length = 246

 Score =  145 bits (365), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 76/235 (32%), Gaps = 12/235 (5%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++  + +E+ P    + +R     + +       + P R   +     +      I    
Sbjct: 14  EEMKTREEILPEFERLLDRCGFDFYGVVRQPKPHENPLR---LLLAGRWPEGWPQIYIRK 70

Query: 69  IETYGDDFLFHFNSGLLPIIWQS--IQEETVIESSGQLSVR-LEGGLLPFAGIAFPVRLG 125
                D  +           W+   +   +        S+         F G  FPV   
Sbjct: 71  KYVVIDPTIRFLGHAQRGFRWRDTLVAFRSDPHRKRMESMMIEARNHGLFDGYIFPVHGR 130

Query: 126 FHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLEL------FKKRSSAARNLTERET 179
               G +      + L+   +        ++    LEL       +  S     +T RE 
Sbjct: 131 RGLMGNLTVGGRVVDLSPVELSLFDAIAKRLFWKLLELTDPEIMAELVSRVEVQMTRREM 190

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L    DG TS +I + L +S HTV+ Y+     KL A NR   +A A R G I
Sbjct: 191 EALHYLADGMTSNDIGKVLDISSHTVDWYMNGIQEKLKAKNRHHVVALAFRLGLI 245


>gi|170693116|ref|ZP_02884277.1| transcriptional regulator, LuxR family [Burkholderia graminis
           C4D1M]
 gi|170142114|gb|EDT10281.1| transcriptional regulator, LuxR family [Burkholderia graminis
           C4D1M]
          Length = 255

 Score =  145 bits (365), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 39/228 (17%), Positives = 71/228 (31%), Gaps = 10/228 (4%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
             + +     + +  +   F    I        R +       Y        +     + 
Sbjct: 28  AADEAAWFGAVADLAETWGFDRLLIAMLPRPTIRLEDAYVRSTYAPAWRRTYDEQGLVHI 87

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
           D  + H  +   P++W     E  I +  +            AG+  P+     + G + 
Sbjct: 88  DPTVAHCATRSTPLVWS---PEIFITAPQRSMYEEARAHGLRAGVTLPIHGPNQEAGMMC 144

Query: 134 FTSEFLMLANEVI-IEAHGACYQVITDF------LELFKKRSSAARNLTERETSCLQLAG 186
           F ++          I+       ++ D         L     +    LT RE  CLQ   
Sbjct: 145 FVNDANPTDTFWRHIDVVLPNLVLLRDLVIDTSQRHLHTHTQTLLPKLTPRERECLQWTA 204

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            G ++ EI+  L  S   VN ++ +   KL   +R  A   A + G I
Sbjct: 205 RGKSTWEISHILNCSEAVVNFHMKNIRTKLGVNSRRAAAVIATQLGLI 252


>gi|153007543|ref|YP_001368758.1| autoinducer-binding domain-containing protein [Ochrobactrum
           anthropi ATCC 49188]
 gi|151559431|gb|ABS12929.1| Autoinducer-binding domain protein [Ochrobactrum anthropi ATCC
           49188]
          Length = 235

 Score =  144 bits (364), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 47/234 (20%), Positives = 77/234 (32%), Gaps = 14/234 (5%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           +   S  +    L  I    +   FA       +             +   +  D     
Sbjct: 8   ESMQSADDAGQLLEYIGTYARQCGFAHTAYVMRVPLLNGVVKWLSFGSLPQEWTDHYTAR 67

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +    + + P++W S       +                 GI+ P       
Sbjct: 68  KYADVDPLVRKALNSIEPLVWSSKLFAEAPQ-----IWADAQRFGIKVGISQPCWAAQGV 122

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELF--KKRSSAARN------LTERETS 180
            G + F      L++  I        Q+  + L L   +       N      LT RE  
Sbjct: 123 FGMLSFLRTGPALSSGEISML-RRQMQIAANLLHLSMYEHLDVPTMNCVSEVNLTMRERE 181

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            L+   +G T+E I   L +S  TVN ++ +   KL AVN++QA+AKA  FG +
Sbjct: 182 ILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNKVQAVAKARTFGLL 235


>gi|59940155|gb|AAX12616.1| LuxR-type transcriptional regulator [Aeromonas sp. 13m]
          Length = 260

 Score =  144 bits (364), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 47/231 (20%), Positives = 86/231 (37%), Gaps = 9/231 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    ++  +   +                
Sbjct: 14  TSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LPI W  + E    ++      + L        GI+FP+     +NG
Sbjct: 74  ACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHGAAGENG 133

Query: 131 YVIFTSEFLMLANEVIIE----AHGACYQVIT---DFLELFKKRSSAARNLTERETSCLQ 183
            + F +     ++++++E           +       + +  +       LT+RET CL 
Sbjct: 134 ILSFITAER-ASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTDRETECLF 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G TS +IA  L ++  TVN +L   T K  ++NR QAIAK +  G +
Sbjct: 193 CASEGKTSGDIACILRITERTVNYHLNHVTRKTVSMNRYQAIAKGVSSGIL 243


>gi|293393463|ref|ZP_06637774.1| transcriptional activator protein LasR [Serratia odorifera DSM
           4582]
 gi|291424064|gb|EFE97282.1| transcriptional activator protein LasR [Serratia odorifera DSM
           4582]
          Length = 237

 Score =  144 bits (364), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 43/230 (18%), Positives = 75/230 (32%), Gaps = 15/230 (6%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
           +  +  +L   L      I    + L       D  +       L N+     +    L 
Sbjct: 12  RIDNFSQLDEVLAERCQAIGFDGYLLGVTGHGRDINQA----VVLTNHPPAWRETYTRLG 67

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
               D  + H   GL P+ W    +   I +      +         G++FP+     + 
Sbjct: 68  YINTDPTVAHCLGGLFPLEW----QACPITAETAPFWQEASYYGLAHGVSFPLHGVQGEQ 123

Query: 130 GYVIFT-SEFLMLANEVIIEAHGACYQVITDFLE------LFKKRSSAARNLTERETSCL 182
           G +  +           +++       ++ D L       L +K    A  L+ RE    
Sbjct: 124 GILSLSLGRQRQRDYRELMQQRWGELYILRDILLHHCIRLLDEKNKLTATVLSPREIEVC 183

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFG 232
           +    G T+ EI+  L  S   VN +  +   K +  +R  AI KAI  G
Sbjct: 184 KWFTIGKTTWEISRILNCSEANVNFHFKNIRRKFNVSSRGAAIIKAIASG 233


>gi|330891500|gb|EGH24161.1| LuxR transcriptional regulator [Pseudomonas syringae pv. mori str.
           301020]
          Length = 247

 Score =  144 bits (364), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 39/229 (17%), Positives = 67/229 (29%), Gaps = 15/229 (6%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           L++L        + I    +A ++         R      L NY                
Sbjct: 24  LRQLIEDFENDLHHIGDFTYAYFSTPKT-----RNVKPVILSNYPDSWLKSYVASNYHLI 78

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
           D  + H    + P  W+  +       +     R        +G  F +         + 
Sbjct: 79  DPIIKHAWHSITPFFWREARNAVQGVETDDFLKRSAK-YQLSSGATFTLHDASGLFAALS 137

Query: 134 FTSEFLMLANEVIIE---------AHGACYQVITDFLELFKKRSSAARNLTERETSCLQL 184
             +       +  I                ++I            A   L+ RET  L+ 
Sbjct: 138 LCNARQQNDFDQRIREKAADIQMSLIRFHDRLIKTRAPHELFPQPAQCKLSTRETGVLKW 197

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGY 233
              G +  EIAE   +S  TV  ++ + + KL+     QA+ KAI  G 
Sbjct: 198 VAMGKSYSEIAEIFSISERTVKFHMSNVSSKLEVRTAKQAVYKAINMGM 246


>gi|167840217|ref|ZP_02466901.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           thailandensis MSMB43]
          Length = 230

 Score =  144 bits (364), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 37/221 (16%), Positives = 69/221 (31%), Gaps = 5/221 (2%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++   +   +       +  + I           +     +Y  +  +          D 
Sbjct: 11  DVRTLIETFRQAALQIGYQHHAIVELSGASHPASIDVVSLHYPSEWVEHYTRSDYFAIDP 70

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
                     P  W  I    +     +  +          GI+ P+     +   V  +
Sbjct: 71  VHRAAFQYSTPFSWNDIATSNL---RERHLLMEAEDAGLDNGISIPLHQPLGRVLLVSLS 127

Query: 136 SEFLMLANEVIIE-AHGACYQVITDFLELFK-KRSSAARNLTERETSCLQLAGDGYTSEE 193
                   +     A+    Q    F  +        + +LT+RE  CL     G +S  
Sbjct: 128 GTAPTHDADAKWRNAYLLGMQFNLQFQSMRTCSPIPPSVHLTDREQMCLTWVARGKSSWV 187

Query: 194 IAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           IA  L +S +TV+ ++ +A  KL+  +R  A  KA R G I
Sbjct: 188 IANMLDISKYTVDFHIENAMEKLNTRSRTFAAVKATRQGLI 228


>gi|240141366|ref|YP_002965846.1| N-acylhomoserine lactone transcriptional regulator, LuxR family
           [Methylobacterium extorquens AM1]
 gi|240011343|gb|ACS42569.1| N-acylhomoserine lactone transcriptional regulator, LuxR family
           [Methylobacterium extorquens AM1]
          Length = 165

 Score =  144 bits (364), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 44/164 (26%), Positives = 65/164 (39%)

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
            Y D  +    S      W  I+   V++   +  +   G      G   P+     + G
Sbjct: 1   MYTDPVVQATLSSTTGFRWSEIEPAGVLDPRSRQVMNEAGEFGLGDGFTVPLATLEEERG 60

Query: 131 YVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYT 190
            + F    L ++             V+   L +    S     LT RE   LQ   +G T
Sbjct: 61  GLTFAGRQLDISPGQRGMLTLLASYVVGQTLLIDNGPSERRMGLTPRERESLQWVAEGKT 120

Query: 191 SEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             EI E +G+S H V+ +L SA VKL  V+R QA+A+  R G I
Sbjct: 121 DWEIGELMGISRHGVDFHLRSARVKLGCVSRTQAVAEGFRRGLI 164


>gi|45259344|emb|CAF32980.1| uR protein [Pseudomonas putida]
          Length = 238

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 37/234 (15%), Positives = 72/234 (30%), Gaps = 12/234 (5%)

Query: 3   ENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSG 62
           +  L   +    ++    L ++  ++   NF    I          Q +    +Y     
Sbjct: 7   DELLRLNEMERFEDWLAHLKILTRKLGYSNFL---IGLKPAPTDANQEVLIYSDYPDAWR 63

Query: 63  DIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPV 122
              +       D  + H  +    ++W         ES                G+A P+
Sbjct: 64  TRYDAESYAAVDPVVQHCLNANRALLWDRDNYRRPSESE---FFEEAAAHGLQQGLALPL 120

Query: 123 RLGFHKNGYVIFTSEFLMLAN-----EVIIEAHGACYQVITDFLELFKKRSSAARNLTER 177
                + G +                E +  A       +   L+   + S+    LT R
Sbjct: 121 HGPRGEAGMLCLKPSESGPQATATMIESLPTATLLRDYAMEGMLKARIECSTPVH-LTSR 179

Query: 178 ETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRF 231
           E   LQ +  G T+ EI+  L  +   ++ +  +   K    +R  A+ KAI+ 
Sbjct: 180 EKEVLQWSAAGKTTWEISMILSCTTSAIDFHFKNIRRKFQVSSRQMAVLKAIQQ 233


>gi|85713529|ref|ZP_01044519.1| Transcriptional regulatory protein, LuxR family protein
           [Nitrobacter sp. Nb-311A]
 gi|85699433|gb|EAQ37300.1| Transcriptional regulatory protein, LuxR family protein
           [Nitrobacter sp. Nb-311A]
          Length = 191

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 38/183 (20%), Positives = 61/183 (33%), Gaps = 2/183 (1%)

Query: 52  CELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGG 111
             LH +     +        + D  +   N+   P +W  ++       +    +     
Sbjct: 10  VVLHRWPKAWSERYFTQGYLFDDPTIQRVNTSTEPFLWSELEPSYRNTPAPTRVMGEARE 69

Query: 112 LLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAA 171
                G   P+     +       SE   +  +V  +            L   +K + A 
Sbjct: 70  FNLGCGFTVPMITLDGQAAGFSLASERADVPPKVRRQLQLIAMHAFARALA--QKYNPAP 127

Query: 172 RNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRF 231
            NLT RE   LQ   +G +  EI   L +S H V+        KL+A NR Q  A A+R 
Sbjct: 128 VNLTPREMDILQWMAEGKSDWEIGVILKVSEHFVDKIARQLRAKLNATNRTQTAATALRH 187

Query: 232 GYI 234
             I
Sbjct: 188 NLI 190


>gi|53716260|ref|YP_106160.1| LuxR family transcriptional regulator [Burkholderia mallei ATCC
           23344]
 gi|53722590|ref|YP_111575.1| N-acylhomoserine lactone-dependent regulatory protein [Burkholderia
           pseudomallei K96243]
 gi|67640560|ref|ZP_00439362.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei GB8 horse 4]
 gi|76818021|ref|YP_335776.1| LuxR family transcriptional regulator [Burkholderia pseudomallei
           1710b]
 gi|124383134|ref|YP_001025820.1| ATP-dependent transcription regulator LuxR [Burkholderia mallei
           NCTC 10229]
 gi|126442943|ref|YP_001063209.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 668]
 gi|126446904|ref|YP_001077903.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei NCTC 10247]
 gi|126457976|ref|YP_001076161.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 1106a]
 gi|134281979|ref|ZP_01768685.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 305]
 gi|167002385|ref|ZP_02268175.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei PRL-20]
 gi|167724282|ref|ZP_02407518.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei DM98]
 gi|167743255|ref|ZP_02416029.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 14]
 gi|167820433|ref|ZP_02452113.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 91]
 gi|167828803|ref|ZP_02460274.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 9]
 gi|167850259|ref|ZP_02475767.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei B7210]
 gi|167898862|ref|ZP_02486263.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 7894]
 gi|167907182|ref|ZP_02494387.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei NCTC 13177]
 gi|167915548|ref|ZP_02502639.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 112]
 gi|167923392|ref|ZP_02510483.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei BCC215]
 gi|217425142|ref|ZP_03456637.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 576]
 gi|226195987|ref|ZP_03791573.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei Pakistan 9]
 gi|237510506|ref|ZP_04523221.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei MSHR346]
 gi|242313819|ref|ZP_04812836.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 1106b]
 gi|254176584|ref|ZP_04883242.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei ATCC 10399]
 gi|254185131|ref|ZP_04891720.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 1655]
 gi|254186897|ref|ZP_04893413.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254194457|ref|ZP_04900889.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei S13]
 gi|254201028|ref|ZP_04907393.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei FMH]
 gi|254204993|ref|ZP_04911346.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei JHU]
 gi|254264301|ref|ZP_04955166.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 1710a]
 gi|254301416|ref|ZP_04968860.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 406e]
 gi|254359112|ref|ZP_04975384.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei 2002721280]
 gi|52213004|emb|CAH39042.1| putative N-acylhomoserine lactone-dependent regulatory protein
           [Burkholderia pseudomallei K96243]
 gi|52422230|gb|AAU45800.1| transcriptional regulator, LuxR family [Burkholderia mallei ATCC
           23344]
 gi|76582494|gb|ABA51968.1| transcriptional regulator, LuxR family [Burkholderia pseudomallei
           1710b]
 gi|126222434|gb|ABN85939.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 668]
 gi|126231744|gb|ABN95157.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 1106a]
 gi|126239758|gb|ABO02870.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei NCTC 10247]
 gi|134246508|gb|EBA46596.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 305]
 gi|147748640|gb|EDK55715.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei FMH]
 gi|147754579|gb|EDK61643.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei JHU]
 gi|148028299|gb|EDK86259.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei 2002721280]
 gi|156105360|gb|ABU49179.1| BpsR3 [Burkholderia pseudomallei]
 gi|157810944|gb|EDO88114.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 406e]
 gi|157934581|gb|EDO90251.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei Pasteur 52237]
 gi|160697626|gb|EDP87596.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei ATCC 10399]
 gi|169651208|gb|EDS83901.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei S13]
 gi|184215723|gb|EDU12704.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 1655]
 gi|217391747|gb|EEC31774.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 576]
 gi|225931880|gb|EEH27881.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei Pakistan 9]
 gi|235002711|gb|EEP52135.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei MSHR346]
 gi|238521303|gb|EEP84756.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei GB8 horse 4]
 gi|242137058|gb|EES23461.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 1106b]
 gi|243061949|gb|EES44135.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei PRL-20]
 gi|254215303|gb|EET04688.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 1710a]
 gi|261827149|gb|ABM99449.2| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei NCTC 10229]
          Length = 230

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 36/221 (16%), Positives = 69/221 (31%), Gaps = 5/221 (2%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++   +   +       +  + I           +     +Y  +  +          D 
Sbjct: 11  DVRTLVETFRQAALQIGYQHHAIVELSGASHPASIDVVSLHYPSEWVEHYTRNDYFAIDP 70

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
                     P  W  +          +  +          GI+ P+     +   V  +
Sbjct: 71  VHRAAFRYSTPFSWNDV---ATANLRERHLLMEAEDAGLDNGISIPLHQPLGRVLLVSLS 127

Query: 136 SEFLMLANEVIIE-AHGACYQVITDFLELFK-KRSSAARNLTERETSCLQLAGDGYTSEE 193
                   +     A+    Q    F  +   +    + +LT+RE  CL     G +S  
Sbjct: 128 GTAPTHDADAKWRNAYLLGMQFNLQFQSMRTCRPIPPSVHLTDREQMCLTWVARGKSSWV 187

Query: 194 IAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           IA  L +S +TV+ ++ +A  KL+  +R  A  KA R G I
Sbjct: 188 IANMLDISKYTVDFHIENAMEKLNTRSRTFAAVKATRQGLI 228


>gi|301382983|ref|ZP_07231401.1| transcriptional regulator PsyR [Pseudomonas syringae pv. tomato
           Max13]
 gi|302062866|ref|ZP_07254407.1| transcriptional regulator PsyR [Pseudomonas syringae pv. tomato
           K40]
 gi|302131657|ref|ZP_07257647.1| transcriptional regulator PsyR [Pseudomonas syringae pv. tomato
           NCPPB 1108]
          Length = 247

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 40/230 (17%), Positives = 71/230 (30%), Gaps = 15/230 (6%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           L++L        + I    +A +T   A     R+     L NY                
Sbjct: 24  LRQLIEDFENDLHHIGEFTYAYFTTPKA-----RKAKPIILSNYPDSWLKSYIASNYHLI 78

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
           D  + H    + P  W+  +       +     R        +G  F +         + 
Sbjct: 79  DPIIKHAWHSITPFFWREARNAVQCVETDDFLKRSAK-YQLSSGATFTLHDASGLFAALS 137

Query: 134 FTSEFLMLANEVII-----EAHGACYQVITDF---LELFKKRSSAAR-NLTERETSCLQL 184
             +       +  I     +   +  +            +     A   L+ RET  L+ 
Sbjct: 138 LCNAKQQHDFDQRIRDKTADIQMSLIRFHDRLIKTRAPHELFPPTANCKLSSRETDILKW 197

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              G    EIAE   +S  TV  ++ + + KL+     QA+ KAI+ G +
Sbjct: 198 VAMGKAYSEIAEIFSISERTVKFHMSNVSSKLEVRTAKQAVYKAIKMGMV 247


>gi|28871016|ref|NP_793635.1| transcriptional regulator PsyR [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|13182979|gb|AAK15017.1|AF234628_3 PsmR [Pseudomonas syringae pv. maculicola]
 gi|28854266|gb|AAO57330.1| transcriptional regulator PsyR [Pseudomonas syringae pv. tomato
           str. DC3000]
          Length = 247

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 40/230 (17%), Positives = 71/230 (30%), Gaps = 15/230 (6%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           L++L        + I    +A +T   A     R+     L NY                
Sbjct: 24  LRQLIEDFENDLHHIGDFTYAYFTTPKA-----RKAKPIILSNYPDSWLKSYIASNYHLI 78

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
           D  + H    + P  W+  +       +     R        +G  F +         + 
Sbjct: 79  DPIIKHAWHSITPFFWREARNAVQCVETDDFLKRSAK-YQLSSGATFTLHDASGLFAALS 137

Query: 134 FTSEFLMLANEVII-----EAHGACYQVITDF---LELFKKRSSAAR-NLTERETSCLQL 184
             +       +  I     +   +  +            +     A   L+ RET  L+ 
Sbjct: 138 LCNAKQQHDFDQRIRDKAADIQMSLIRFHDRLIKTRAPHELFPPTANCKLSSRETDILKW 197

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              G    EIAE   +S  TV  ++ + + KL+     QA+ KAI+ G +
Sbjct: 198 VAMGKAYSEIAEIFSISERTVKFHMSNVSSKLEVRTAKQAVYKAIKMGMV 247


>gi|187918993|ref|YP_001888024.1| LuxR family transcriptional regulator [Burkholderia phytofirmans
           PsJN]
 gi|187717431|gb|ACD18654.1| transcriptional regulator, LuxR family [Burkholderia phytofirmans
           PsJN]
          Length = 234

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 35/231 (15%), Positives = 66/231 (28%), Gaps = 13/231 (5%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           ++   E    +  +          +  +        R +       Y        +    
Sbjct: 7   AADEAEWFGAIAGLAETWGFDKLLIAMLPRPT---IRLEDAYVRSTYSPTWRRTYDEQGL 63

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
            + D  + H  +   P+IW     +    +               +GI  P+     + G
Sbjct: 64  VHIDPTVAHCATRATPLIWS---PDIFKTAPQLSMYEEARAHGLRSGITLPIHGPNQEAG 120

Query: 131 YVIFTSEFLMLANEVIIEAHGACYQVITDFL-------ELFKKRSSAARNLTERETSCLQ 183
            + F ++                  V+   L        L     +    LT RE  CL+
Sbjct: 121 MMCFVNDNNPNDEFWRHINVALPNLVLLRDLVIDTSQRHLNTHAQTLLPKLTPRERECLK 180

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G ++ EI+  L  S   VN ++ +   K    +R  A   A + G I
Sbjct: 181 WTARGKSTWEISHILNCSEAVVNFHMKNIRTKFGVNSRRAAAVIAAQLGLI 231


>gi|149187186|ref|ZP_01865484.1| LuxR, transcriptional regulator [Vibrio shilonii AK1]
 gi|148838722|gb|EDL55661.1| LuxR, transcriptional regulator [Vibrio shilonii AK1]
          Length = 259

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 49/226 (21%), Positives = 95/226 (42%), Gaps = 12/226 (5%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
            ++LS +L  +   I   ++ L+ ++        +     L N  L            Y 
Sbjct: 23  FEDLSGKLAEVTEVIGFEHY-LFAVSV--PVTVMRAENVVLTNQPLAWRQFYEDNEVMYF 79

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
           D  + H  + +LP+ W+S+    + +      ++L        GI  P+R      G + 
Sbjct: 80  DQVVLHCRNSMLPLQWRSLLANDIPDDKN--VIKLASDFGLGDGITIPLRANHGCLGLIS 137

Query: 134 FT---SEFLMLANEVIIEAH---GACYQVITDFLELFKKRSSAAR-NLTERETSCLQLAG 186
           F+       +     I+  +        +      + +K+    + +LT RE  CL    
Sbjct: 138 FSNRKGTRKIDHESTILSTYVGSLVADYINDIRNHVCEKQFGQVKSSLTLREQICLAWVA 197

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFG 232
           +G +S E+A+ +G S  TVN ++ +A+ KL+A +R QA++KA+  G
Sbjct: 198 EGKSSWEVAQIIGCSERTVNFHIQNASEKLNAFSRTQAVSKALLTG 243


>gi|83716463|ref|YP_440275.1| ATP-dependent transcription regulator LuxR [Burkholderia
           thailandensis E264]
 gi|83650288|gb|ABC34352.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia thailandensis E264]
          Length = 425

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 45/217 (20%), Positives = 76/217 (35%), Gaps = 17/217 (7%)

Query: 26  NRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLL 85
            ++  +NFA                 C L  +  +     +       D  + H     +
Sbjct: 218 RQLGFKNFAY-----RHQISGAASSRCMLDGFPTEWRLRYDAADYLSIDPVVQHCRCRTV 272

Query: 86  PIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFL------ 139
           P+IW      T      +L            G++ PV         +   ++        
Sbjct: 273 PLIWHDELYTTG---RAKLMRDEAKSYGLVYGLSCPVHDRSGAISMLSMATDDPFEHDAN 329

Query: 140 --MLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEK 197
             +    +        +  + + L+   +R  +   LT RE   LQ AG G T+ EI++ 
Sbjct: 330 DILRLLSLSQLLASFVHAAMHELLDCRLRRQGSCD-LTARERESLQWAGRGKTAWEISKI 388

Query: 198 LGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           LG+S  TV  +L +A  K+ A NR QA+  A   G I
Sbjct: 389 LGISERTVVFHLSNAARKIGANNRAQAVVIASARGLI 425


>gi|115360652|ref|YP_777789.1| LuxR family transcriptional regulator [Burkholderia ambifaria AMMD]
 gi|115285980|gb|ABI91455.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           AMMD]
          Length = 237

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 35/219 (15%), Positives = 65/219 (29%), Gaps = 14/219 (6%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNI 67
            + + S  E   ++      I    F          +P  ++ +    N+        + 
Sbjct: 12  IEATHSEHEAFGKIASAVKEI---GFEYSAYCLQTPWPLSRRKVLVFSNFPEPWQRRYHD 68

Query: 68  LIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
                 D  L        P+IW     E   +                 G +        
Sbjct: 69  ARYIDVDPLLRRGRQSYAPVIWSDAVFEGTPQ-----LWEEAQAHGLRYGYSLAAVSNCG 123

Query: 128 KNGYVIFTSEFLMLANEVI----IEAHGACYQVITDFLELFKKRSSAAR--NLTERETSC 181
            +G +        L    +    ++                  + S      LT+RE   
Sbjct: 124 VSGMMSMARSHTPLTVRELQQQELKMRWLVNAAHLAITRAVLPKLSPEGDIELTDREVEV 183

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVN 220
           L+   DG T+ EI+  + +SV+TVN ++ +A  KL+  N
Sbjct: 184 LKWVADGKTAAEISMIMLISVYTVNFHVKNAVTKLNTSN 222


>gi|115359785|ref|YP_776923.1| LuxR family transcriptional regulator [Burkholderia ambifaria AMMD]
 gi|115285073|gb|ABI90589.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           AMMD]
          Length = 229

 Score =  143 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 42/225 (18%), Positives = 74/225 (32%), Gaps = 10/225 (4%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           + EL   L  I +     +        +    +  +    L NY      +         
Sbjct: 11  MDELGRMLIDIGHLAGFDHVCYQEYRMSGGTLKNCRT---LSNYPEAWLSLYRDRAYLTI 67

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
           D    H  S L+P+IW    +     +  +             G++FP          V 
Sbjct: 68  DPIAQHALSSLMPLIW---GDRIFATTEQREFRDEGRIYGLNDGVSFPAHSRHGDVACVS 124

Query: 134 FTSEFLMLA----NEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGY 189
           F  +   L        +         ++ D     +   S A  L+ RE   L+   +G 
Sbjct: 125 FVRQARALDDGDMPCDVPSWGALVANLMLDACRRLEAVQSDAPCLSTRELEILKWVAEGK 184

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           ++ +I+  + L+ H V  ++ S   K D   R QA+  A RFG +
Sbjct: 185 STWDISRIVSLTEHGVLHHIRSIMKKFDVPTRRQAVLMASRFGLL 229


>gi|152970958|ref|YP_001336067.1| DNA-binding transcriptional activator SdiA [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|150955807|gb|ABR77837.1| transcriptional activator for cell division (LuxR/UhpA family)
           [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
          Length = 228

 Score =  143 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 35/231 (15%), Positives = 69/231 (29%), Gaps = 13/231 (5%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           +  ++ +E+   L   Q   +A  +  YT+      P  +  +     Y           
Sbjct: 6   QSMATGEEVYNLL---QRETEALEYDYYTLCVRHPVPFTRPRVTFQSTYPRAWMSHYQAE 62

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  L          +   +     +                  G+   + L  H 
Sbjct: 63  NYFAIDPVLR-----PENFMRGHLPWNDSLFRDAPALWDGARDHGLQKGVTQCLTLPNHA 117

Query: 129 NGYVIFTSEFL-----MLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
            G++  ++              +         ++T      +         + RE   L+
Sbjct: 118 QGFLSVSANNRLPGGYPEDELELRLRTLTELSLLTLLRLEDEMVMPPEMKFSRRELEILK 177

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              +G TS E+A  L +S +TVN +  +   K +A N+ Q    A+  G I
Sbjct: 178 WTAEGKTSAEVAMILSISENTVNFHQKNMQRKFNAPNKTQIACYAVATGLI 228


>gi|116254615|ref|YP_770451.1| putative transcriptional regulatory protein [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|417645|sp|Q03316|RHIR_RHILV RecName: Full=Regulatory protein rhiR
 gi|7259800|gb|AAA26360.2| rhiR [Rhizobium leguminosarum]
 gi|115259263|emb|CAK10396.1| Putative transcriptional regulatory protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 247

 Score =  143 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 39/228 (17%), Positives = 75/228 (32%), Gaps = 7/228 (3%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           + S  ++   L L     +   F+ + I+       R      L N+ +   D       
Sbjct: 22  AKSKDDV---LLLFGKISQYFGFSYFAISGIPSPIERIDSYFVLGNWSVGWFDRYRENNY 78

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
            + D  +    +     +W     +  ++   +  +          G + P+        
Sbjct: 79  VHADPIVHLSKTCDHAFVWSEALRDQKLDRQSRRVMDEAREFKLIDGFSVPLHTAAGFQS 138

Query: 131 YVIFTSEFLMLANEVIIEAHGACYQVITDFLEL----FKKRSSAARNLTERETSCLQLAG 186
            V F +E + L+       +       +           ++  A   +T RE   +    
Sbjct: 139 IVSFGAEKVELSTCDRSALYLMAAYAHSLLRAQIGNDASRKIQALPMITTREREIIHWCA 198

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            G T+ EIA  LG S  T+   + +   KL+ VN  Q IA++ R   I
Sbjct: 199 AGKTAIEIATILGRSHRTIQNVILNIQRKLNVVNTPQMIAESFRLRII 246


>gi|331019185|gb|EGH99241.1| transcriptional regulator PsyR [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 247

 Score =  143 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 46/230 (20%), Positives = 75/230 (32%), Gaps = 15/230 (6%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           L++L        + I    +A +T   A     R+     L NY                
Sbjct: 24  LRQLIEDFENDLHHIGDFTYAYFTTPKA-----RKAKPIILSNYPDSWLKSYIASNYHLI 78

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
           D  + H    + P  W+  +       +     R        +G  F +         + 
Sbjct: 79  DPIIKHAWHSITPFFWREARNAVQCVETDDFLKRSAK-YQLSSGATFTLHDASGLFAALS 137

Query: 134 FTSEFLMLANEVIIE--AHGACYQVITDFLELFKKRSS-------AARNLTERETSCLQL 184
             +       +  I   A      +I     L K R+        A R L+ RET  L+ 
Sbjct: 138 LCNAKQQHDFDQRIRDKAADIQMSLIRFHDRLIKTRAPHELFPPTANRKLSSRETDILKW 197

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              G    EIAE   +S  TV  ++ + + KL+     QA+ KAI+ G +
Sbjct: 198 VAMGKAYSEIAEIFSISERTVKFHMSNVSSKLEVRTAKQAVYKAIKMGMV 247


>gi|83720643|ref|YP_442349.1| ATP-dependent transcription regulator LuxR [Burkholderia
           thailandensis E264]
 gi|83654468|gb|ABC38531.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia thailandensis E264]
          Length = 241

 Score =  143 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 45/240 (18%), Positives = 77/240 (32%), Gaps = 17/240 (7%)

Query: 3   ENTLTG-KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDS 61
           E+ L G   + S  E    +      +    F        + +P  +  I    N+    
Sbjct: 10  EDLLAGLDSARSEDEAFRSIETAATALD---FEYCAYGLRVPWPLSRPRIETRSNFPEQW 66

Query: 62  GDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFP 121
                       D  L H      P++       +                    G A  
Sbjct: 67  KRRYVEAGFLDVDPILAHGRRSQQPVVLNETLFAS-----SHQMWVEAQSFGLRFGWAQS 121

Query: 122 VRLGFHKNGYVIFTSEFLMLANEVI-------IEAHGACYQVITDFLELFKKRSSAARNL 174
               +   G +        + +  +              +  +   + L K  +   R L
Sbjct: 122 SFDAYGGMGMLALVRSREPVTHAELDAKEYRMRWLVRTAHAALGRMM-LPKLMADPERGL 180

Query: 175 TERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           TERE   L+ A DG TS EI++ L +SV TVN ++ +A +KL   N+  A+ +A   G +
Sbjct: 181 TEREVEVLKWAADGKTSGEISKILAISVDTVNFHVKNAILKLRTANKTAAVVRAAMLGLL 240


>gi|172152203|emb|CAP91064.1| BraR protein [Burkholderia kururiensis]
          Length = 234

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 38/228 (16%), Positives = 68/228 (29%), Gaps = 10/228 (4%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
             + +     +     +  F+   +        R +      NY              Y 
Sbjct: 7   ASDETQWFDAVAGLAGSWGFSQVLLAILPRPGMRLEDAYVRSNYASSWRQAYTDQGFAYI 66

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
           D  + H      P++W      T  + S              AG+  P+     + G + 
Sbjct: 67  DPTVSHCTKHSSPLVWSPDLFATTPQKS---MYEEASAHGLRAGVTLPIHGPRQEAGMLC 123

Query: 134 FTSEFLMLA-NEVIIEAHGACYQVITDF------LELFKKRSSAARNLTERETSCLQLAG 186
           F ++          I+       ++ D         L     +    LT RE  CL+   
Sbjct: 124 FVNDSNPNDKFWQHIDTALPNLVLMRDLVIDTSQRHLSAHAQTLIPKLTPRERECLKWTA 183

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            G ++ EI+  L  S   VN ++ +   K    +R  A   A + G I
Sbjct: 184 LGKSTWEISHILNCSEAVVNFHMKNIRAKFGVNSRRAAAVIATQLGLI 231


>gi|162148611|ref|YP_001603072.1| LuxR family transcriptional regulator [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161787188|emb|CAP56781.1| putative transcriptional regulator, luxR family [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 239

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 42/227 (18%), Positives = 77/227 (33%), Gaps = 8/227 (3%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++S++  EL          I     A   +           L+     Y        +  
Sbjct: 18  RRSTTASELRAAFVRATKSISDCYIASGRVKGGAPVNAETALV----TYPDAWLKHYHER 73

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  + +     +P  W+++Q+ +V +    L +          GI   +      
Sbjct: 74  KYLDIDPTIVNAGRSYVPYRWEALQDISVKQRQMFLDI---AETGIKGGITMSLHTPDRA 130

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSS-AARNLTERETSCLQLAGD 187
                F     +  +  ++       Q      +L +          + RE  CL     
Sbjct: 131 AFVTSFAFTKAVSEDRDLVALGFINSQYYETLSKLSEAELPGPVPTFSRREKECLLWVSR 190

Query: 188 GYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           G T+ +I+  LG+S +T+NAYL +  +KL    RIQA+ +AI    I
Sbjct: 191 GKTTWDISVILGISENTINAYLKNVILKLGCSGRIQAVLRAIDLNLI 237


>gi|167563421|ref|ZP_02356337.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia oklahomensis EO147]
 gi|167570595|ref|ZP_02363469.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia oklahomensis C6786]
          Length = 237

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 43/231 (18%), Positives = 72/231 (31%), Gaps = 16/231 (6%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           + S  E    +      +    F        + +P  +  I    N+             
Sbjct: 15  ARSEDEAFRSIEAATTALD---FEYCAYALRVPWPLSRPRIETRSNFPEQWKRRYGEAGF 71

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
              D  L H      PI+       +                    G A      +   G
Sbjct: 72  LDVDPILAHGRRSQQPIVLTEALFAS-----AHQMWVEAQSFGLRFGWAQSNFDAYGGMG 126

Query: 131 YVIFTSEFLMLANEVI-------IEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
            +        +    +              +  +   + L K  +   R LTERE   L+
Sbjct: 127 MLALVRSSEPMTEAELGAKEYRMRWLVRTAHAALGRMM-LPKLMADPERGLTEREVEVLK 185

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A DG TS EI++ L +SV TVN ++ +A +KL   N+  A+ +A   G +
Sbjct: 186 WAADGKTSGEISKILAISVDTVNFHVKNAILKLRTANKTAAVVRAAMLGLL 236


>gi|317047630|ref|YP_004115278.1| LuxR family transcriptional regulator [Pantoea sp. At-9b]
 gi|316949247|gb|ADU68722.1| transcriptional regulator, LuxR family [Pantoea sp. At-9b]
          Length = 240

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 38/238 (15%), Positives = 71/238 (29%), Gaps = 13/238 (5%)

Query: 2   SENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDS 61
            E  +  +  +++ +L   L   Q  I+   F  +        P  +  I     Y  D 
Sbjct: 11  GETEIQFQAVTAVLQLKALL---QKHIETLGFDYFAFLIQHPVPFTRPRIFLFSTYPEDW 67

Query: 62  GDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFP 121
                       D  L         + W                          +G +  
Sbjct: 68  VKHYESENYYAVDPVLLLCQRPGHGVEWTRDLFTGAGN-----LWAEANAYGLMSGFSCS 122

Query: 122 VRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAAR-----NLTE 176
                   G +   S        + +E     + +    L + ++ +  A      + ++
Sbjct: 123 AMASNRAIGILSIASGQQSKTQHLRVELEVKLHFLAELSLRVLERLNDNAMVVLSNDFSQ 182

Query: 177 RETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           RE   L+   +G TS EI+  L +S HTVN +  +   + +  N+ Q    A   G I
Sbjct: 183 RELEILKWTAEGKTSAEISLILAISEHTVNFHQKNMQKRFNVSNKTQIACYAAAIGLI 240


>gi|218674909|ref|ZP_03524578.1| transcriptional activator protein [Rhizobium etli GR56]
          Length = 241

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 42/233 (18%), Positives = 81/233 (34%), Gaps = 11/233 (4%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNI 67
              S +LQ+L   L  +++     +  L+ +  +        L+     Y  +       
Sbjct: 14  ISASPTLQDLETTLDEVRHIYAISHMVLH-VTRSSGMADSNPLLML--TYPPEWVKQYRD 70

Query: 68  LIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
                 D  +     G LP+ W + + ++    +           +   G+  PVR    
Sbjct: 71  RDYFSIDPVVRLGRRGFLPVEWSASKWDS--GRAYGFFKEAMAFGVGRQGVTLPVRGPQG 128

Query: 128 KNGYVIFTSEFLMLAN-----EVIIEAHGACYQVITDFLELFK-KRSSAARNLTERETSC 181
           +      TS            + + +     + +    + L   +  +    L+ RE  C
Sbjct: 129 ERSLFTVTSNHPDAYWRQFRMDSMRDLQFLAHHLHDRVMVLSGMREIADFPQLSRRELQC 188

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           L++   G  +++I  +L +SV  V  YL SA  KL      +A+AKA     I
Sbjct: 189 LEMTASGLMAKQICARLSISVSAVQLYLASARRKLTVATTSEAVAKATALELI 241


>gi|161724871|emb|CAO85746.1| rR protein [Pseudomonas putida]
          Length = 240

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 45/229 (19%), Positives = 72/229 (31%), Gaps = 20/229 (8%)

Query: 15  QELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGD 74
            EL  +L  +++      +A Y          R      + NY                D
Sbjct: 23  DELQLQLCDVKD----LKYAYYAATH-----NRNVEPIIISNYPPSWVKSYKDNKSYLID 73

Query: 75  DFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
             + H    + P  W      +  E  G    R        +G  F +R        +  
Sbjct: 74  PIIKHGLREITPFSWHEALANSGPE--GVDFFRRATRYRICSGTTFTLRDASGTFCALSV 131

Query: 135 TSEFLMLANEVIIE-----AHGACYQVITDFLELFKK----RSSAARNLTERETSCLQLA 185
                 +  +  +            +  +  +   K      S+A   L+ RE   LQL 
Sbjct: 132 CDAGSQVDFDRRMAKQQSQLQMLLIKFHSWLMTSRKTDQLFSSAADGPLSTRELGVLQLV 191

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             G T  EIA   G+S  TV  ++ + + KL   N  QA+ +A R G I
Sbjct: 192 MRGKTYREIATDCGISERTVKFHMSNISGKLQVGNAKQAVYEAKRQGII 240


>gi|145666435|gb|ABP88722.1| transcriptional activator protein [Pseudomonas corrugata]
          Length = 242

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 79/235 (33%), Gaps = 12/235 (5%)

Query: 3   ENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSG 62
           EN ++G    S +E +  L  I +R+    FA   +      P     I    NY  +  
Sbjct: 17  ENNISGV---SEEEYTEILGWIFSRLGIEKFAYVHL---EPTPFNNSKISIYSNYPSEWV 70

Query: 63  DIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPV 122
           D          D  + +      P  W  I  E                     G   P+
Sbjct: 71  DTYRKNSLYKSDPVMANTAITATPFFWNEIPAEIDNNPE---IFDQSASYGIKQGYTVPI 127

Query: 123 RLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQ---VITDFLELFKKRSSAARNLTERET 179
                  G +  +SE       +I+ ++    +   VI +     +    +   L+ RE 
Sbjct: 128 HEPGRAFGSLHLSSEENDPDFPIIVRSNLFIIKTLSVIANQYRPMETTIESNLKLSPREI 187

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+    G   +EI   + ++  TV  +    T K+D  N  QA+ KA++  ++
Sbjct: 188 EFLRWLALGKNYKEIGLIMNITERTVKFHAKQMTEKMDCTNVKQAMIKAVQLNFV 242


>gi|83941288|ref|ZP_00953750.1| transcriptional regulatory protein [Sulfitobacter sp. EE-36]
 gi|83847108|gb|EAP84983.1| transcriptional regulatory protein [Sulfitobacter sp. EE-36]
          Length = 244

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 41/228 (17%), Positives = 81/228 (35%), Gaps = 4/228 (1%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++ SS+  L   +         R    ++I+           +        +   +    
Sbjct: 11  REVSSVSALWLLVQRFAKAQDFRTVTYHSIDVQSLGDSSFGAVAI--GIPAEFHRMYTEE 68

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D F     S + P  W+ + + T +    +  +          G+   V     +
Sbjct: 69  HLYLDDPFPPFAASQITPFFWRDLPQLTTLTEKQKAYLNRAREFGFADGLVCQVFGPQAR 128

Query: 129 NGYVI--FTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAG 186
           N  V   F  +    ++  +++ H A       F  L    ++  R L+ RE   L+   
Sbjct: 129 NALVSIGFHHDRPRPSDAEVLDLHVASQFAHMRFCALVAGPAAPNRRLSPRELELLRWIA 188

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            G ++  IA+ +G+S HTV+  +     KLD  +R +A  + + FG I
Sbjct: 189 RGKSNTSIAQIMGVSRHTVDTIMRRLFGKLDVTDRTRAAVRGVAFGLI 236


>gi|187927560|ref|YP_001898047.1| LuxR family transcriptional regulator [Ralstonia pickettii 12J]
 gi|187724450|gb|ACD25615.1| transcriptional regulator, LuxR family [Ralstonia pickettii 12J]
          Length = 253

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 53/242 (21%), Positives = 81/242 (33%), Gaps = 22/242 (9%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALD----------FPRRQQLIC--ELHNYD 58
           + S  E++  +      +    F    +  A D              + L        Y 
Sbjct: 14  AGSHAEIAAFMERHAGNLGYGRFFYSPLLVAGDARHFFKDDHNVVAAEMLYTKNIFSTYP 73

Query: 59  LDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGI 118
                          D  +    +  LPI W +      ++++               GI
Sbjct: 74  ASWIRRYQEAGHVAADPVVKLITTSNLPIHWDADD----LQAARSPVFDEAREHGLATGI 129

Query: 119 AFPVRLGFHKNGYVIFTSEFLMLANEVIIEA-----HGACYQVITDFLELFKKRS-SAAR 172
             P+    H       TS+     ++   +A           +      L    S +   
Sbjct: 130 TIPINGFDHTRALFSVTSDQAPERSQRHTDAISGLAVLTALHLHEAVRRLDASMSNAPIP 189

Query: 173 NLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFG 232
           +LT RE  CLQ A  G TS EIA  L +S  TV  ++G+AT KL A NR QA+A+AI   
Sbjct: 190 SLTSREKECLQWAAAGKTSWEIARILSVSERTVIFHIGNATKKLGATNRRQAVARAISLR 249

Query: 233 YI 234
            I
Sbjct: 250 LI 251


>gi|288733198|emb|CBI71275.1| UnaR protein [Burkholderia unamae]
          Length = 234

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 42/224 (18%), Positives = 68/224 (30%), Gaps = 10/224 (4%)

Query: 18  SPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFL 77
           +     +     +  F+   +        R +      NY        N     Y D  +
Sbjct: 11  AAWFDAVTKLASSWGFSQLMLAILPRPGMRLEDAFIRTNYSAAWRQTYNDHGMAYFDPTV 70

Query: 78  FHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSE 137
            H  +   P+IW     E       Q            AGI  P+     + G + F ++
Sbjct: 71  THCTTRSSPLIWS---PELFATEQQQSMYEEARAYGLRAGITLPIHGPRQEVGMLCFVND 127

Query: 138 FLMLA--NEVIIEAH-----GACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYT 190
                   + +  A           + T    L     S    LT RE  CL+    G +
Sbjct: 128 ASPSDGFWDDVNRALPNLVLLRDLVLDTSHRHLTDHVQSLIPKLTPREKECLKWTALGKS 187

Query: 191 SEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           + EI+  L  S   VN ++ +   K    +R  A   A + G I
Sbjct: 188 TWEISHILNCSEAVVNFHMKNIRGKFGVNSRRAAAVIATQMGLI 231


>gi|163760010|ref|ZP_02167094.1| putative transcription regulator protein [Hoeflea phototrophica
           DFL-43]
 gi|162282968|gb|EDQ33255.1| putative transcription regulator protein [Hoeflea phototrophica
           DFL-43]
          Length = 247

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 42/222 (18%), Positives = 70/222 (31%), Gaps = 9/222 (4%)

Query: 22  HLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFN 81
             +   +    F  + +            +     +  D  ++         D  L +  
Sbjct: 25  ERLSKVVAGLGFDFFKLVRQAGPESGAVDMILAEQWPSDWPELYAKRKYATIDPTLRYLG 84

Query: 82  SGLLPIIWQS---IQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEF 138
                  W+      +E       +  +          G  FPV       GY+     +
Sbjct: 85  HSQGGFRWREPMEAYQEDPHYKRMERMMADARRFGLEDGYVFPVHGRRGLVGYLTIAGGY 144

Query: 139 LMLANEVIIEAHGACYQVITDFLELFKKRS------SAARNLTERETSCLQLAGDGYTSE 192
           + L    +        +   + +EL    +           +T+RE   L+  G G TS 
Sbjct: 145 VELLRSEMAMMDALAKKAFWELVELLDPAAHERLNRPVTMQMTKREMQTLEYLGCGMTSN 204

Query: 193 EIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           E+   LGLS HTV+ Y+     KL A NR   +A A R G I
Sbjct: 205 EMGTALGLSAHTVDWYMNGIQEKLHAKNRHHVVAIAFRLGLI 246


>gi|328542321|ref|YP_004302430.1| N-acyl homoserine lactone transcriptional regulator, LuxR-like
           protein [polymorphum gilvum SL003B-26A1]
 gi|326412068|gb|ADZ69131.1| Putative N-acyl homoserine lactone transcriptional regulator,
           LuxR-like protein [Polymorphum gilvum SL003B-26A1]
          Length = 230

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 35/228 (15%), Positives = 66/228 (28%), Gaps = 7/228 (3%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           +++++         +    F  +            +    L  +                
Sbjct: 1   MEDVASLEAAFSKSLWDLGFREWAYQVIRTDALPDEKPLILTTFPDAWYSHYIDNGYHRV 60

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
           D  + +  S + P  W ++          +             G+  P+           
Sbjct: 61  DPVILNGPSQVAPFTWSAMSFGMEPSPEQRRLFAEATEFGLGEGVGIPIHGARGSLAMAS 120

Query: 134 FTSEFLMLANEVII-----EAHGACYQVITDFLELFK--KRSSAARNLTERETSCLQLAG 186
             S+        ++     + H           EL    +      +LT RE  CL    
Sbjct: 121 MVSDHGARGLARLMSTVGKDVHLMSLAFHNHARELLALGRSGRTTVSLTRRERECLLWIA 180

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            G ++ EI+  LG+S  TV  +L +   K+   N   A+ KAI  G I
Sbjct: 181 AGKSAWEISRILGISARTVYFHLDNVRAKMGVTNVYHAVVKAIMEGMI 228


>gi|16519915|ref|NP_444035.1| LuxR-type transcription regulator BxrH [Sinorhizobium fredii
           NGR234]
 gi|2495427|sp|P55629|Y4QH_RHISN RecName: Full=Putative HTH-type transcriptional regulator y4qH
 gi|2182594|gb|AAB92463.1| LuxR-type transcription regulator BxrH [Sinorhizobium fredii
           NGR234]
          Length = 326

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 39/221 (17%), Positives = 67/221 (30%), Gaps = 3/221 (1%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRR-QQLICELHNYDLDSGDIPNILIETYGDD 75
           L   L     +   +  A   + S      R +    E+ NY     +    +       
Sbjct: 104 LFDLLSAFAFKFGCKWLAYGPLTSDHKALNRVKCDSEEILNYPDGWRERCLEMGYETIAP 163

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
            +     G  PI W  +  +       +            +GI  P+R        + F 
Sbjct: 164 VIKESRMGAGPIRWSDMYSDASTTEYERRMFDEAAMFGLRSGITVPLRGPRGSCAIMSFA 223

Query: 136 SE-FLMLANEVIIEAHGACYQVITDFLELFK-KRSSAARNLTERETSCLQLAGDGYTSEE 193
                   +  I     A         ++           L+ RE  C+     G +S +
Sbjct: 224 RHCEREFHDRTIAYLQLAATHFHLRVAKIANLNAVQKIPALSLREKECVLWVARGKSSWD 283

Query: 194 IAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           I   + +S +TVN ++ +   KL   +R  A  KAI  G I
Sbjct: 284 IGVIMRISENTVNFHIKNVMRKLGTSSRTVAAIKAISLGII 324


>gi|330878281|gb|EGH12430.1| transcriptional regulator PsyR [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 247

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 44/230 (19%), Positives = 73/230 (31%), Gaps = 15/230 (6%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           L++L        + I    +A +T   A     R+     L NY                
Sbjct: 24  LRQLIEDFENDLHHIGDFTYAYFTTPKA-----RKAKPIILSNYPDSWLKSYIASNYHLI 78

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
           D  + H    + P  W+  +       +     R        +G  F +         + 
Sbjct: 79  DPIIKHAWHSITPFFWREARNAVQCVETDDFLKRSAK-YQLSSGATFTLHDASGLFAALS 137

Query: 134 FTSEFLMLANEVIIE--AHGACYQVITDFLELFKKRSS-------AARNLTERETSCLQL 184
             +       +  I   A      +I     L K R+            L+ RET  L+ 
Sbjct: 138 LCNAKQQHDFDQRIRDKAADIQMSLIRFHDRLIKTRAPHELFPPTVNCKLSSRETDILKW 197

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              G    EIAE   +S  TV  ++ + + KL+     QA+ KAI+ G +
Sbjct: 198 VAMGKAYSEIAEIFSISERTVKFHMSNVSSKLEVRTAKQAVYKAIKMGMV 247


>gi|163744442|ref|ZP_02151802.1| transcriptional regulator, LuxR family protein [Oceanibulbus
           indolifex HEL-45]
 gi|161381260|gb|EDQ05669.1| transcriptional regulator, LuxR family protein [Oceanibulbus
           indolifex HEL-45]
          Length = 239

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 44/222 (19%), Positives = 75/222 (33%), Gaps = 13/222 (5%)

Query: 19  PRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLF 78
             L+++   +   N +          P           YD               D  + 
Sbjct: 23  EILNVLAQDMGLNNLSYL---GFHKDPCGGSDPVIHTTYDPAWLARYQEENYHLIDPVVD 79

Query: 79  HFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFA-GIAFPVRLGFHKNGYVIFTSE 137
               G LP+ W  +     ++   +              G++ P+R   H    +   S+
Sbjct: 80  SALEGTLPVDWSELP---KVDRVTRDFFGEAMEFGVRQNGVSIPIRDHVHGKAVLTLNSD 136

Query: 138 FLMLANEV-----IIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSE 192
             +          I +A      + +D +            L+ RE   L+ A  G T+ 
Sbjct: 137 LRIHEWRKYKRGIIADAIYLGCLLQSDLVAGIAG-GEPGPRLSRREKEVLKWAAVGKTAW 195

Query: 193 EIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           E A+ + +S  TVN +L +A  KLD  N+  A+AKAIR   I
Sbjct: 196 ETAQIMTVSNSTVNHHLYNACAKLDVANKTHAVAKAIRAQLI 237


>gi|83854765|ref|ZP_00948295.1| transcriptional regulator, LuxR family protein [Sulfitobacter sp.
           NAS-14.1]
 gi|83842608|gb|EAP81775.1| transcriptional regulator, LuxR family protein [Sulfitobacter sp.
           NAS-14.1]
          Length = 248

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 41/228 (17%), Positives = 80/228 (35%), Gaps = 4/228 (1%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++ SS+  L   +         R    ++I+           +        +   +    
Sbjct: 15  REVSSVSALWLLVQRFAKAQDFRTVTYHSIDVQSLGDTSFGAVAI--GIPAEFHRMYTEE 72

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D F     S + P  W+ + + T +    +  +          G+   V     +
Sbjct: 73  HLYLDDPFPPFAASQITPFFWRDLPQLTTLTEKQKAYLNRAREFGFADGLVCQVFGPQAR 132

Query: 129 NGYVI--FTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAG 186
           N  V   F  +     +  +++ H A       F  L    ++  R L+ RE   L+   
Sbjct: 133 NALVSIGFHPDRPRPTDAEVLDLHVASQFAHMRFCALVAGPAAPNRRLSPRELELLRWIA 192

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            G ++  IA+ +G+S HTV+  +     KLD  +R +A  + + FG I
Sbjct: 193 RGKSNTSIAQIMGVSRHTVDTIMRRLFGKLDVTDRTRAAVRGLAFGLI 240


>gi|146454419|gb|ABQ41883.1| LuxR [Acidovorax citrulli]
          Length = 242

 Score =  142 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 43/231 (18%), Positives = 72/231 (31%), Gaps = 9/231 (3%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRR--QQLICELHNYDLDSGDIPNI 67
           ++ +  EL          +  ++F+L  +    D        +    HNY          
Sbjct: 12  QALTQTELLACFEQAVLLLGYQHFSLCYVQLRQDGSGTSQPPIGVLSHNYPSRWVSHYIA 71

Query: 68  LIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
                 D    H    + P  W+ +   +         +          G+  P+     
Sbjct: 72  RNYYLEDPVRRHAPQAMSPYRWKDV---SAQGDREAHIMDEATDAGLADGLGLPIHEPGG 128

Query: 128 KNGYVIFTSEF---LMLANEVIIEAHGACYQVITDFL-ELFKKRSSAARNLTERETSCLQ 183
           +       S     L     V   A    +  +        + +   A  LT RE  CL 
Sbjct: 129 RIFLATVASHQQLTLGNDACVRAYALVTAFHALYTMRFATEQTQIPTAVKLTSREAECLT 188

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G +S EI   + +S HTVN +L +A  K D  +R+ A  +A   G I
Sbjct: 189 WVAYGKSSREIGRIMRISEHTVNFHLKNAMAKFDTASRVTAAVRAANLGLI 239


>gi|238895474|ref|YP_002920209.1| DNA-binding transcriptional activator SdiA [Klebsiella pneumoniae
           NTUH-K2044]
 gi|262043448|ref|ZP_06016571.1| regulatory protein SdiA [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330001006|ref|ZP_08303866.1| regulatory protein SdiA [Klebsiella sp. MS 92-3]
 gi|238547791|dbj|BAH64142.1| LuxR/UhpA-family transcriptional activator for cell division
           [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
 gi|259039190|gb|EEW40338.1| regulatory protein SdiA [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328537810|gb|EGF64005.1| regulatory protein SdiA [Klebsiella sp. MS 92-3]
          Length = 240

 Score =  142 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 35/231 (15%), Positives = 69/231 (29%), Gaps = 13/231 (5%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           +  ++ +E+   L   Q   +A  +  YT+      P  +  +     Y           
Sbjct: 18  QSMATGEEVYNLL---QRETEALEYDYYTLCVRHPVPFTRPRVTFQSTYPRAWMSHYQAE 74

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  L          +   +     +                  G+   + L  H 
Sbjct: 75  NYFAIDPVLR-----PENFMRGHLPWNDSLFRDAPALWDGARDHGLQKGVTQCLTLPNHA 129

Query: 129 NGYVIFTSEFL-----MLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
            G++  ++              +         ++T      +         + RE   L+
Sbjct: 130 QGFLSVSANNRLPGGYPEDELELRLRTLTELSLLTLLRLEDEMVMPPEMKFSRRELEILK 189

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              +G TS E+A  L +S +TVN +  +   K +A N+ Q    A+  G I
Sbjct: 190 WTAEGKTSAEVAMILSISENTVNFHQKNMQRKFNAPNKTQIACYAVATGLI 240


>gi|170769400|ref|ZP_02903853.1| regulatory protein SdiA [Escherichia albertii TW07627]
 gi|170121724|gb|EDS90655.1| regulatory protein SdiA [Escherichia albertii TW07627]
          Length = 228

 Score =  142 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 35/235 (14%), Positives = 78/235 (33%), Gaps = 13/235 (5%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++    +E+   +    ++++   +  Y++      P  +  +    NY       
Sbjct: 2   LLRFQRMEVAEEVYHEIEHQAHQLE---YDFYSLCVRHPVPFTRPKVAFYTNYPEAWVRY 58

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L              +     +    Q             G+     L
Sbjct: 59  YQEKNFLAIDPAL-----NPENFRQGHLLWNDDLYREAQPLWEAARAHGLRRGVTHYFML 113

Query: 125 GFHKNGYVIFTSE---FLMLANEVI-IEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F+      + +  + + ++      + +   + L  +   +   + ++RE 
Sbjct: 114 PNRALGFLSFSRSSTREIPVPGDELQLKMQLLVRESLMALMRLNDEMVMTPEMHFSKREK 173

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+   +G TS EIA  L +S +TVN +  +   K++A N+ Q    A   G I
Sbjct: 174 EILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 228


>gi|120612451|ref|YP_972129.1| LuxR family transcriptional regulator [Acidovorax citrulli AAC00-1]
 gi|120590915|gb|ABM34355.1| transcriptional regulator, LuxR family [Acidovorax citrulli
           AAC00-1]
 gi|227167429|gb|ACP19743.1| LuxR-like protein [Acidovorax citrulli]
          Length = 242

 Score =  142 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 42/231 (18%), Positives = 72/231 (31%), Gaps = 9/231 (3%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRR--QQLICELHNYDLDSGDIPNI 67
           ++ +  EL          +  ++F+L  +    D        +    HNY          
Sbjct: 12  QALTQTELLACFEQAVLLLGYQHFSLCYVQLRQDGSGTSQPPIGVLSHNYPSRWVSHYIA 71

Query: 68  LIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
                 D    H    + P  W+ +   +         +          G+  P+     
Sbjct: 72  RNYYLEDPVRRHAPQAMSPYRWKDV---SAQGDREAHIMDEATDAGLADGLGLPIHEPGG 128

Query: 128 KNGYVIFTSEFLMLANEVII----EAHGACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
           +       S   +               A + + T      + +   A  LT RE  CL 
Sbjct: 129 RIFLATVASHQQLTLGNDACVRTYALVTAFHALYTMRFATEQTQIPTAVKLTSREAECLT 188

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G +S EI   + +S HTVN +L +A  K D  +R+ A  +A   G I
Sbjct: 189 WVAYGKSSWEIGRIMRISEHTVNFHLKNAMAKFDTASRVTAAVRAANLGLI 239


>gi|76811685|ref|YP_334182.1| ATP-dependent transcription regulator LuxR [Burkholderia
           pseudomallei 1710b]
 gi|124386221|ref|YP_001028861.1| ATP-dependent transcription regulator LuxR [Burkholderia mallei
           NCTC 10229]
 gi|126450742|ref|YP_001081227.1| ATP-dependent transcription regulator LuxR [Burkholderia mallei
           NCTC 10247]
 gi|167003830|ref|ZP_02269610.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei PRL-20]
 gi|167720437|ref|ZP_02403673.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei DM98]
 gi|167816634|ref|ZP_02448314.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 91]
 gi|167825038|ref|ZP_02456509.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 9]
 gi|167846546|ref|ZP_02472054.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei B7210]
 gi|167895126|ref|ZP_02482528.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 7894]
 gi|167903510|ref|ZP_02490715.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei NCTC 13177]
 gi|167919762|ref|ZP_02506853.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei BCC215]
 gi|242317090|ref|ZP_04816106.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1106b]
 gi|254195948|ref|ZP_04902374.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei S13]
 gi|76581138|gb|ABA50613.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1710b]
 gi|124294241|gb|ABN03510.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei NCTC 10229]
 gi|126243612|gb|ABO06705.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei NCTC 10247]
 gi|169652693|gb|EDS85386.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei S13]
 gi|242140329|gb|EES26731.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1106b]
 gi|243060693|gb|EES42879.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei PRL-20]
          Length = 237

 Score =  142 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 45/240 (18%), Positives = 77/240 (32%), Gaps = 17/240 (7%)

Query: 3   ENTLTG-KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDS 61
           E+ L G   + S +E    +      +    F        + +P  +  I    N+    
Sbjct: 6   EDLLAGLDSARSEEEAFRSVETAAAALD---FEYCAYGLRVPWPLSRPRIETRSNFPEQW 62

Query: 62  GDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFP 121
                       D  L H      P++       +                    G A  
Sbjct: 63  KRRYVEAGFLDVDPILAHGRRSQQPVVLAETLFAS-----AHQMWVEAQSFGLRFGWAQS 117

Query: 122 VRLGFHKNGYVIFTSEFLMLANEVI-------IEAHGACYQVITDFLELFKKRSSAARNL 174
               +   G +        +    +              +  +   + L K  +   R L
Sbjct: 118 SFDAYGGMGMLALVRSREPVTAAELDAKEYRMRWLVRTAHAALGRMM-LPKLMADPERGL 176

Query: 175 TERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           TERE   L+ A DG TS EI++ L +SV TVN ++ +A +KL   N+  A+ +A   G +
Sbjct: 177 TEREVEVLKWAADGKTSGEISKILAISVDTVNFHVKNAILKLRTANKTAAVVRAAMLGLL 236


>gi|167739431|ref|ZP_02412205.1| LuxR family regulatory protein [Burkholderia pseudomallei 14]
 gi|167911761|ref|ZP_02498852.1| LuxR family regulatory protein [Burkholderia pseudomallei 112]
 gi|254191335|ref|ZP_04897839.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pasteur 52237]
 gi|157939007|gb|EDO94677.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pasteur 52237]
          Length = 237

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 45/240 (18%), Positives = 77/240 (32%), Gaps = 17/240 (7%)

Query: 3   ENTLTG-KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDS 61
           E+ L G   + S +E    +      +    F        + +P  +  I    N+    
Sbjct: 6   EDLLAGLDSARSEEEAFRSVETAAAALD---FEYCAYGLRVPWPLSRPRIETRSNFPEQW 62

Query: 62  GDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFP 121
                       D  L H      P++       +                    G A  
Sbjct: 63  KRRYVEAGFLDVDPILAHGRRSQQPVVLAETLFAS-----AHQMWVEAQSFGLRFGWAQS 117

Query: 122 VRLGFHKNGYVIFTSEFLMLANEVI-------IEAHGACYQVITDFLELFKKRSSAARNL 174
               +   G +        +    +              +  +   + L K  +   R L
Sbjct: 118 SFDAYGGMGMLALVRSCEPVTAAELDAKEYRMRWLVRTAHAALGRMM-LPKLMADPERGL 176

Query: 175 TERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           TERE   L+ A DG TS EI++ L +SV TVN ++ +A +KL   N+  A+ +A   G +
Sbjct: 177 TEREVEVLKWAADGKTSGEISKILAISVDTVNFHVKNAILKLRTANKTAAVVRAAMLGLL 236


>gi|222109223|ref|YP_002551488.1| two-component transcriptional regulator LuxR family [Agrobacterium
           vitis S4]
 gi|221738497|gb|ACM39362.1| two-component transcriptional regulator LuxR family [Agrobacterium
           vitis S4]
          Length = 240

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 46/223 (20%), Positives = 73/223 (32%), Gaps = 4/223 (1%)

Query: 13  SLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETY 72
           S+  L      +   I  R F  Y            +     + +     +    L    
Sbjct: 18  SVDNLFSDFGTV---IAKRGFHSYIYTGLPAVGDDVKHYVVKNAWPPGWTEQFEGLNYFA 74

Query: 73  GDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYV 132
            D       S   P  W++ +EET   +  +   +         GI FP+         +
Sbjct: 75  DDPVSRWSLSQSKPFTWKTAREETKATARTKEIQQEADRYRLCDGIVFPMFDPNSWQSVI 134

Query: 133 IFTSEF-LMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTS 191
              ++    LA E I + +            L ++   A   LT+RE   LQ    G T 
Sbjct: 135 SLATDDKGGLAKENIGDLYLLSSYCAMTANNLLRRAEQADHRLTDREKEILQWVSRGKTD 194

Query: 192 EEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            EI   L ++  +V   L      L   NR Q +++AIR G I
Sbjct: 195 WEIGTILRMTEGSVTQRLARIRDTLGVKNRPQTVSQAIRLGLI 237


>gi|254486014|ref|ZP_05099219.1| transcription regulator, LuxR family, putative [Roseobacter sp.
           GAI101]
 gi|214042883|gb|EEB83521.1| transcription regulator, LuxR family, putative [Roseobacter sp.
           GAI101]
          Length = 248

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 39/228 (17%), Positives = 74/228 (32%), Gaps = 4/228 (1%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           +++ S   +   +       + R  A  ++            I           +     
Sbjct: 15  RQADSPGAIWAIVQRYARAHEIRMIAYGSVEVQTYGETTFPGIQF--GMPTAFKESYIKE 72

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                +       S   P  W   Q+   ++ +    +        + GIAF V     +
Sbjct: 73  QLYLDNPLPRLAMSRPDPFYWSDAQDLDDLQPAEIAYLDKLKEAGIWPGIAFQVFGPESR 132

Query: 129 NGYVIFTSE--FLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAG 186
           N  V    E     L+ + ++E   A       F  L     S    L+ RE   L+   
Sbjct: 133 NAAVGMCFEPGAPRLSPDALLELQLASQCAHQRFCALTDGPKSPYARLSPRELEVLRWIA 192

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            G ++  +A+ +G+S HTV+        KL+  +R +A  + I  G +
Sbjct: 193 QGKSNSVMADIMGISRHTVDTITRRMFEKLEVTDRTRAAVRGISAGLL 240


>gi|218514308|ref|ZP_03511148.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli 8C-3]
          Length = 254

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 49/218 (22%), Positives = 75/218 (34%), Gaps = 7/218 (3%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++   +  +    + R F +  +        +      + ++  +   + +         
Sbjct: 27  DIFRFMKRVTEAYRCRAFMVLNLPPITSLDLQG--NTVITSWPAELLALYDQEGLMVNSP 84

Query: 76  FLFHFNSGLLPIIWQSIQEE-TVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
            L    +   P  +   ++  +  +    L V L           FP        G V F
Sbjct: 85  VLRRLRTSARPFSYDMSRQNWSRDDGKSDLVVGLFERFRMTRCAYFPTHEPSGLRGAVSF 144

Query: 135 TSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEI 194
             +    +   + E       V     E+    +     LT+RE  CL     G TS EI
Sbjct: 145 AGDREPFSPTEMRELCYIAIHVFDRLAEIRNLDTRVTDALTDREIDCLNWTAAGKTSAEI 204

Query: 195 AEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFG 232
           AE L LS HTVN YL  AT KLD VNR Q    A R G
Sbjct: 205 AEILVLSEHTVNHYLNRATKKLDTVNRTQ----ARRQG 238


>gi|304397142|ref|ZP_07379021.1| transcriptional regulator, LuxR family [Pantoea sp. aB]
 gi|304355291|gb|EFM19659.1| transcriptional regulator, LuxR family [Pantoea sp. aB]
          Length = 240

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 35/225 (15%), Positives = 64/225 (28%), Gaps = 13/225 (5%)

Query: 15  QELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGD 74
            +L P L      +    F  +        P  +  I     Y                D
Sbjct: 24  SDLKPLLQQFTESL---GFDYFAFLIQHPVPFSRPRIHLHSTYPKLWVKRYEKQNYYAVD 80

Query: 75  DFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
             L         ++W                 R        +G +          G +  
Sbjct: 81  PVLSLCQRPGRGLMWTEEMFAGAGN-----LWREAREYGLQSGFSCSAMAPNRALGILSI 135

Query: 135 TSEFLML----ANEVIIEAHGACYQVITDFLELFKKRSSAARN-LTERETSCLQLAGDGY 189
           +S+  +       E+ ++ H      +              +   ++RE   L+  G+G 
Sbjct: 136 SSQQPIPLKLCHEELEVKLHLLAELSLDTLERFSDDAMMVLKKEFSQRELEILKWTGEGK 195

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           T+ EI+  L +S HTVN +  +   + +  N+ Q    A   G I
Sbjct: 196 TAVEISLILSISEHTVNFHQKNMQKRFNVSNKTQIACYAAAIGLI 240


>gi|85707086|ref|ZP_01038174.1| autoinducer-binding transcriptional regulator LuxR [Roseovarius sp.
           217]
 gi|85668372|gb|EAQ23245.1| autoinducer-binding transcriptional regulator LuxR [Roseovarius sp.
           217]
          Length = 224

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 75/224 (33%), Gaps = 15/224 (6%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDF 76
               L  +++R +  + A   +N                 Y  D             D  
Sbjct: 7   FRQFLDDLRDRFELDHVAYAGMNPISGASHGHM------TYGEDWTAHYLQNKYYEIDPT 60

Query: 77  LFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTS 136
           L      + P+ W  ++          +        +   G+  P+   +   G +    
Sbjct: 61  LLKARHSIAPVDWHRLE---RGAEFQTIFRDARDFGISDRGLTIPIHGPYGDVGGLSINR 117

Query: 137 EFLMLANEVII-----EAHGACYQVITDFLELFK-KRSSAARNLTERETSCLQLAGDGYT 190
           +       ++I     +   A   +    ++     R   + +L+ RE   LQ    G +
Sbjct: 118 DCSDREWHLLISEIIGDLQSAAVHMHDMVIQADPLTRMLNSPSLSTREIEILQWTAAGKS 177

Query: 191 SEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            ++I + L +S  TV  +L SA  KL+A+   QAI +AI  G I
Sbjct: 178 QQDIGDILSISHRTVEVHLRSARQKLNALTTPQAIGRAINLGLI 221


>gi|190894996|ref|YP_001985289.1| transcriptional activator protein [Rhizobium etli CIAT 652]
 gi|190700657|gb|ACE94739.1| transcriptional activator protein [Rhizobium etli CIAT 652]
 gi|327193288|gb|EGE60194.1| transcriptional activator protein [Rhizobium etli CNPAF512]
          Length = 241

 Score =  141 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 41/233 (17%), Positives = 80/233 (34%), Gaps = 11/233 (4%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNI 67
              S +LQ+L   L  +++     +  L+    A            +  Y  +       
Sbjct: 14  ISASPTLQDLETTLDEVRHIYAISHMVLHVTRFAG---ATDSNPLLMLTYPPEWVKQYRD 70

Query: 68  LIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
                 D  +     G LP+ W +   ++    +           +   G+  PVR    
Sbjct: 71  RDYFSIDPVVRLGRRGFLPVEWSASGWDS--GRAYGFFKEAMAFGVGRQGVTLPVRGPQG 128

Query: 128 KNGYVIFTSEFLMLAN-----EVIIEAHGACYQVITDFLELFK-KRSSAARNLTERETSC 181
           +      TS            + + +     + +    + L   ++ +    L+ RE  C
Sbjct: 129 ERSLFTVTSNHPDAYWRQFRMDSMRDLQFLAHHLHDRAMVLSGMRKVADLPRLSRRELQC 188

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           L++  +G  +++I  +L +SV  V  YL SA  KL      +A+A+A     I
Sbjct: 189 LEMTANGLLAKQICARLSISVSAVQLYLASARRKLTVATTSEAVARATALELI 241


>gi|15598673|ref|NP_252167.1| transcriptional regulator RhlR [Pseudomonas aeruginosa PAO1]
 gi|116051496|ref|YP_789670.1| transcriptional regulator RhlR [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218890275|ref|YP_002439139.1| transcriptional regulator RhlR [Pseudomonas aeruginosa LESB58]
 gi|1710203|sp|P54292|RHLR_PSEAE RecName: Full=Regulatory protein rhlR; AltName: Full=Elastase
           modulator
 gi|9949621|gb|AAG06865.1|AE004768_10 transcriptional regulator RhlR [Pseudomonas aeruginosa PAO1]
 gi|151538|gb|AAA25983.1| rhlR [Pseudomonas aeruginosa]
 gi|452505|gb|AAA62130.1| regulatory protein [Pseudomonas aeruginosa]
 gi|1117918|gb|AAC44036.1| RhlR [Pseudomonas aeruginosa PAO1]
 gi|115586717|gb|ABJ12732.1| acylhomoserine lactone dependent transcriptional regulator
           [Pseudomonas aeruginosa UCBPP-PA14]
 gi|161724881|emb|CAO85753.1| RhlR protein [Pseudomonas aeruginosa]
 gi|211908969|gb|ACJ12779.1| rhamnosyl transferase I [actinobacterium MSA10]
 gi|211908971|gb|ACJ12780.1| rhamnosyl transferase I [actinobacterium MSA19]
 gi|218770498|emb|CAW26263.1| transcriptional regulator RhlR [Pseudomonas aeruginosa LESB58]
 gi|281331824|emb|CBI71035.1| transcriptional regulator [Pseudomonas aeruginosa]
 gi|281331826|emb|CBI71036.1| transcriptional regulator [Pseudomonas aeruginosa]
 gi|281331828|emb|CBI71037.1| transcriptional regulator [Pseudomonas aeruginosa]
 gi|281331830|emb|CBI71038.1| transcriptional regulator [Pseudomonas aeruginosa]
 gi|281331832|emb|CBI71039.1| transcriptional regulator [Pseudomonas aeruginosa]
 gi|281331834|emb|CBI71040.1| transcriptional regulator [Pseudomonas aeruginosa]
 gi|281331836|emb|CBI71041.1| transcriptional regulator [Pseudomonas aeruginosa]
 gi|281331838|emb|CBI71042.1| transcriptional regulator [Pseudomonas aeruginosa]
 gi|281331840|emb|CBI71043.1| transcriptional regulator [Pseudomonas aeruginosa]
 gi|299772610|gb|ADJ38517.1| transcriptional regulator RhlR [Pseudomonas sp. BSFD5]
          Length = 241

 Score =  141 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 33/220 (15%), Positives = 68/220 (30%), Gaps = 10/220 (4%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNI 67
             +   + +      +++  ++   F  Y        P  +        Y     +   +
Sbjct: 15  RSEMQPIHDSQGVFAVLEKEVRRLGFDYYAYGVRHTIPFTRPKTEVHGTYPKAWLERYQM 74

Query: 68  LIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
                 D  + +       ++W     +       ++            G   P+R   +
Sbjct: 75  QNYGAVDPAILNGLRSSEMVVWSDSLFD-----QSRMLWNEARDWGLCVGATLPIRAPNN 129

Query: 128 KNGYVIFTSEFLMLA---NEVIIEAHGACYQVITDFLELFKKRSSAARN--LTERETSCL 182
               +    +   ++    E I        +++T  L   +     +    L+ RE   L
Sbjct: 130 LLSVLSVARDQQNISSFEREEIRLRLRCMIELLTQKLTDLEHPMLMSNPVCLSHREREIL 189

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRI 222
           Q   DG +S EIA  L +S  TVN +  +   K DA N+ 
Sbjct: 190 QWTADGKSSGEIAIILSISESTVNFHHKNIQKKFDAPNKT 229


>gi|254242162|ref|ZP_04935484.1| transcriptional regulator RhlR [Pseudomonas aeruginosa 2192]
 gi|126195540|gb|EAZ59603.1| transcriptional regulator RhlR [Pseudomonas aeruginosa 2192]
          Length = 242

 Score =  141 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 33/220 (15%), Positives = 68/220 (30%), Gaps = 10/220 (4%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNI 67
             +   + +      +++  ++   F  Y        P  +        Y     +   +
Sbjct: 15  RSEMQPIHDSQGVFAVLEKEVRRLGFDYYAYGVRHTIPFTRPKTEVHGTYPKAWLERYQM 74

Query: 68  LIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
                 D  + +       ++W     +       ++            G   P+R   +
Sbjct: 75  QNYGAVDPAILNGLRSSEMVVWSDSLFD-----QSRMLWNEARDWGLCVGATLPIRAPNN 129

Query: 128 KNGYVIFTSEFLMLA---NEVIIEAHGACYQVITDFLELFKKRSSAARN--LTERETSCL 182
               +    +   ++    E I        +++T  L   +     +    L+ RE   L
Sbjct: 130 LLSVLSVARDQQNISSFEREEIRLRLRCMIELLTQKLTDLEHPMLMSNPVCLSHREREIL 189

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRI 222
           Q   DG +S EIA  L +S  TVN +  +   K DA N+ 
Sbjct: 190 QWTADGKSSGEIAIILSISESTVNFHHKNIQKKFDAPNKT 229


>gi|83747411|ref|ZP_00944450.1| SolR [Ralstonia solanacearum UW551]
 gi|207744773|ref|YP_002261165.1| transcriptional activator protein solr [Ralstonia solanacearum
           IPO1609]
 gi|83725868|gb|EAP73007.1| SolR [Ralstonia solanacearum UW551]
 gi|206596183|emb|CAQ63110.1| transcriptional activator protein solr [Ralstonia solanacearum
           IPO1609]
          Length = 236

 Score =  141 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 42/229 (18%), Positives = 68/229 (29%), Gaps = 11/229 (4%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
            + ++       I +  +   F      + +  P  +  +     Y              
Sbjct: 13  RTAEDERQLFREIASIARQLGFDYCCYGARMPLPVSKPAVAIFDTYPAGWMQHYQANGFL 72

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  +    S    I+W        I                  G+A          G 
Sbjct: 73  DIDPTVRAGASSGDMIVWP-----VSIRDEAARLWSDARDAGLNVGVARSSWTAHGAFGL 127

Query: 132 VIFTSEFLMLANEVIIEA----HGACYQVITDFLELFKKRSSAARN--LTERETSCLQLA 185
           +        L    +       H       T        +     N  LT RE   L   
Sbjct: 128 LTLARHADPLTAAELGRLSIATHWLANLAHTLMSPFLVPKLVPESNAVLTAREREVLCWT 187

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           G+G T+ EI + L +S  TVN ++ +  +KL A N++QA+ KAI  G I
Sbjct: 188 GEGKTAYEIGQILHISERTVNFHVNNVLLKLAATNKVQAVVKAIATGLI 236


>gi|107103010|ref|ZP_01366928.1| hypothetical protein PaerPA_01004079 [Pseudomonas aeruginosa PACS2]
 gi|152989609|ref|YP_001347033.1| transcriptional regulator RhlR [Pseudomonas aeruginosa PA7]
 gi|150964767|gb|ABR86792.1| transcriptional regulator RhlR [Pseudomonas aeruginosa PA7]
          Length = 224

 Score =  141 bits (357), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 33/214 (15%), Positives = 67/214 (31%), Gaps = 10/214 (4%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           + +      +++  ++   F  Y        P  +        Y     +   +      
Sbjct: 4   IHDSQGVFAVLEKEVRRLGFDYYAYGVRHTIPFTRPKTEVHGTYPKAWLERYQMQNYGAV 63

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
           D  + +       ++W     +       ++            G   P+R   +    + 
Sbjct: 64  DPAILNGLRSSEMVVWSDSLFD-----QSRMLWNEARDWGLCVGATLPIRAPNNLLSVLS 118

Query: 134 FTSEFLMLA---NEVIIEAHGACYQVITDFLELFKKRSSAARN--LTERETSCLQLAGDG 188
              +   ++    E I        +++T  L   +     +    L+ RE   LQ   DG
Sbjct: 119 VARDQQNISSFEREEIRLRLRCMIELLTQKLTDLEHPMLMSNPVCLSHREREILQWTADG 178

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRI 222
            +S EIA  L +S  TVN +  +   K DA N+ 
Sbjct: 179 KSSGEIAIILSISESTVNFHHKNIQKKFDAPNKT 212


>gi|608485|gb|AAA89073.1| VSMR [Pseudomonas aeruginosa]
          Length = 241

 Score =  141 bits (357), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 33/218 (15%), Positives = 68/218 (31%), Gaps = 10/218 (4%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
           +   + +      +++  ++   F  Y        P  +        Y     +   +  
Sbjct: 17  EMQPIHDSQGVFAVLEKEVRRLGFDYYAYGVRHTIPFTRPKTEVHGTYPKAWLERYQMQN 76

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
               D  + +       ++W     +       ++            G   P+R   +  
Sbjct: 77  YGAVDPAILNGLRSSEMVVWSDRLFD-----QSRMLWNEARDWGLCVGATLPIRAPNNLL 131

Query: 130 GYVIFTSEFLMLA---NEVIIEAHGACYQVITDFLELFKKRSSAARN--LTERETSCLQL 184
             +    +   ++    E I        +++T  L   +     +    L+ RE   LQ 
Sbjct: 132 SVLSVARDQQNISSFEREEIRLRLRCMIELLTQKLTDLEHPMLMSNPVCLSHREREILQW 191

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRI 222
             DG +S EIA  L +S  TVN +  +   K DA N+ 
Sbjct: 192 TADGKSSGEIAIILSISESTVNFHHKNIQKKFDAPNKT 229


>gi|121663597|emb|CAM12356.1| quorum sensing LuxR family sensor regulator [Burkholderia glumae]
          Length = 349

 Score =  141 bits (356), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 39/220 (17%), Positives = 65/220 (29%), Gaps = 11/220 (5%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           ++ +      H +    K   F        +  P  Q L+     Y              
Sbjct: 13  NTAENEQQLFHQVSAYSKRLGFEYCCYGIRVPQPGSQPLVEIFDTYPPGWMAHYQARNYI 72

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  +    +    IIW                 R         G+A          G 
Sbjct: 73  EIDPTVRDGAASPNMIIWPDADAAEQPS-----LWRDARDFGMSVGVAQSSWAARGVFGL 127

Query: 132 VIFTSEFLMLANEVIIEAHGACYQVITDFLELFKK------RSSAARNLTERETSCLQLA 185
           +        L    I         +      L  +        +A+ +LT+RE   L   
Sbjct: 128 LTIARRSDRLTPAEINSLTLQANWLANLSHSLMGRFLVPKLSPAASISLTKREREVLSWT 187

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAI 225
            +G T+ EI E+L +S  TV  ++ +   KL A N++QA+
Sbjct: 188 SEGRTASEIGEQLNISERTVTFHINNILAKLGAANKVQAV 227


>gi|296388005|ref|ZP_06877480.1| transcriptional regulator RhlR [Pseudomonas aeruginosa PAb1]
 gi|313108838|ref|ZP_07794823.1| acylhomoserine lactone dependent transcriptional regulator
           [Pseudomonas aeruginosa 39016]
 gi|310881325|gb|EFQ39919.1| acylhomoserine lactone dependent transcriptional regulator
           [Pseudomonas aeruginosa 39016]
          Length = 234

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 33/220 (15%), Positives = 68/220 (30%), Gaps = 10/220 (4%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNI 67
             +   + +      +++  ++   F  Y        P  +        Y     +   +
Sbjct: 8   RSEMQPIHDSQGVFAVLEKEVRRLGFDYYAYGVRHTIPFTRPKTEVHGTYPKAWLERYQM 67

Query: 68  LIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
                 D  + +       ++W     +       ++            G   P+R   +
Sbjct: 68  QNYGAVDPAILNGLRSSEMVVWSDSLFD-----QSRMLWNEARDWGLCVGATLPIRAPNN 122

Query: 128 KNGYVIFTSEFLMLA---NEVIIEAHGACYQVITDFLELFKKRSSAARN--LTERETSCL 182
               +    +   ++    E I        +++T  L   +     +    L+ RE   L
Sbjct: 123 LLSVLSVARDQQNISSFEREEIRLRLRCMIELLTQKLTDLEHPMLMSNPVCLSHREREIL 182

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRI 222
           Q   DG +S EIA  L +S  TVN +  +   K DA N+ 
Sbjct: 183 QWTADGKSSGEIAIILSISESTVNFHHKNIQKKFDAPNKT 222


>gi|92109527|ref|YP_571814.1| LuxR family transcriptional regulator [Nitrobacter hamburgensis
           X14]
 gi|91802609|gb|ABE64982.1| transcriptional regulator, LuxR family [Nitrobacter hamburgensis
           X14]
          Length = 228

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 42/226 (18%), Positives = 76/226 (33%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           +++ +  E+   L  +             + +        +       +     D  +  
Sbjct: 2   EQTRTAAEIEDCLLGLAAGFGFTGLFGGIVPTRPAPLAELRSRILFQRFPAQWLDRYSRK 61

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
              + D  + H      P  W    E      + +L            G   P+     +
Sbjct: 62  GYVFRDPIIQHLFHERAPFTWHEGYESCPQRRNVRLIRGEAAEFGLRDGYVVPISTIDGE 121

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDG 188
              + F     +  +  +   + A    +   L         + NLT RE  CL  AG+G
Sbjct: 122 IASLSFGGPGTLPVSADLSVLNFAASYALGRHLHRIATWQRVSSNLTAREWDCLLWAGEG 181

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            T+ E +  LG+S  TV  ++ +A  KL AV++  AIA AIR   +
Sbjct: 182 KTNWETSAILGISRSTVTKHIMAARAKLGAVSKAHAIATAIRTKLL 227


>gi|218460014|ref|ZP_03500105.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli Kim 5]
          Length = 198

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 43/195 (22%), Positives = 66/195 (33%), Gaps = 9/195 (4%)

Query: 49  QLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRL 108
           +       +      I         D  + +      P  W+         +  +   ++
Sbjct: 3   RAAPLAGRWPERWLQIYAAKKYIRIDPMVRYLAHAQRPFRWRESMAAFNGSTHRRRMEQM 62

Query: 109 ---EGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELF- 164
                G     G  FP+       G +    + + L+   I        +     LEL  
Sbjct: 63  MVDAFGHGLEDGYLFPIHGRNGILGSLSLGGKPIELSPVEIALLEAVARKTFWRLLELTG 122

Query: 165 -----KKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAV 219
                +    A   LT RE   L    +G TS EI++ L +S HTV+ Y+     KL A 
Sbjct: 123 EAEALETVLPAETPLTRREMEILHYLAEGMTSMEISKMLKISNHTVDWYMNGLQNKLKAK 182

Query: 220 NRIQAIAKAIRFGYI 234
           NR QA+A A R G I
Sbjct: 183 NRQQAVALAFRHGLI 197


>gi|254690492|ref|ZP_05153746.1| Transcriptional activator, LUXR family protein [Brucella abortus
           bv. 6 str. 870]
          Length = 235

 Score =  141 bits (356), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 46/234 (19%), Positives = 81/234 (34%), Gaps = 17/234 (7%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           + + S  +L   +    + +    F   +   ++ +            +           
Sbjct: 11  QSADSADQLFEIVKNYAHDL---GFEYVSYVMSIPYLNGSLKWVRFGAFPDGWEQRYLAQ 67

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  L    + + P+IW      +  +                 GI+ P       
Sbjct: 68  NYAEIDPLLRRGVNSIDPLIWSQNFFASAPQ-----IWADAVKYGLKVGISQPCWAAQGV 122

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELF--KKRSSAA------RNLTERETS 180
            G + F      L    I        Q++T+ L L   ++    A       +LT RE  
Sbjct: 123 FGLLSFVRSGPALTPGEISML-RRQLQMVTNLLHLSMYERVDVPAISCIGDVSLTLRERE 181

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            L+   +G T+E I   L +S  TVN ++ +   KL AVN++QA+AKA  FG +
Sbjct: 182 ILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNKVQAVAKARTFGLL 235


>gi|34499545|ref|NP_903760.1| LuxR/UhpA family transcriptional regulator [Chromobacterium
           violaceum ATCC 12472]
 gi|327200688|pdb|3QP6|A Chain A, Crystal Structure Of Cvir (Chromobacterium Violaceum
           12472) Bound To C6-Hsl
 gi|34332902|gb|AAQ61750.2| transcriptional activator, LuxR/UhpA family of regulators
           [Chromobacterium violaceum ATCC 12472]
          Length = 265

 Score =  141 bits (355), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 36/224 (16%), Positives = 71/224 (31%), Gaps = 5/224 (2%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
             +  EL   L  I ++  +    L           ++       +Y  D  +  +    
Sbjct: 34  IETEGELKAFLDNILSQAPSDRIILVLGRLNNQNQIQRMEKVLNVSYPSDWLNQYSQENF 93

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPV-RLGFHKN 129
              D  +   + G  P+IW   +      S  +  +         +GI F       +  
Sbjct: 94  AQHDPIMR-IHLGQGPVIW-EERFSRAKGSEEKRFIAEASSNGMGSGITFSAASDRNNVG 151

Query: 130 GYVIFTSEFLMLANEVIIEAHGACYQVITDFLELF--KKRSSAARNLTERETSCLQLAGD 187
             +    +       ++   +     +    + +      S +   L++RE         
Sbjct: 152 SILSIGGKEPGRNAALVAMLNCLTPHLHQAAVRIANLPPASPSNMPLSQREYDIFHWMSR 211

Query: 188 GYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRF 231
           G T+ EIA  L +S  TV  ++ +   KL+A NR  AI   +  
Sbjct: 212 GKTNWEIATILNISERTVKFHVANVIRKLNANNRTHAIVLGMHL 255


>gi|53725659|ref|YP_102421.1| ATP-dependent transcription regulator LuxR [Burkholderia mallei
           ATCC 23344]
 gi|121600864|ref|YP_993677.1| ATP-dependent transcription regulator LuxR [Burkholderia mallei
           SAVP1]
 gi|126442199|ref|YP_001059696.1| ATP-dependent transcription regulator LuxR [Burkholderia
           pseudomallei 668]
 gi|126451641|ref|YP_001066980.1| ATP-dependent transcription regulator LuxR [Burkholderia
           pseudomallei 1106a]
 gi|134277810|ref|ZP_01764525.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 305]
 gi|217421088|ref|ZP_03452593.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 576]
 gi|226200000|ref|ZP_03795550.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pakistan 9]
 gi|237813089|ref|YP_002897540.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei MSHR346]
 gi|238562977|ref|ZP_00439585.2| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei GB8 horse 4]
 gi|254177786|ref|ZP_04884441.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei ATCC 10399]
 gi|254184304|ref|ZP_04890894.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1655]
 gi|254199322|ref|ZP_04905688.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei FMH]
 gi|254205635|ref|ZP_04911987.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei JHU]
 gi|254261005|ref|ZP_04952059.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1710a]
 gi|254296964|ref|ZP_04964417.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 406e]
 gi|254357791|ref|ZP_04974064.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei 2002721280]
 gi|52429082|gb|AAU49675.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei ATCC 23344]
 gi|121229674|gb|ABM52192.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei SAVP1]
 gi|126221692|gb|ABN85198.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 668]
 gi|126225283|gb|ABN88823.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1106a]
 gi|134251460|gb|EBA51539.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 305]
 gi|147748918|gb|EDK55992.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei FMH]
 gi|147753078|gb|EDK60143.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei JHU]
 gi|148026918|gb|EDK84939.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei 2002721280]
 gi|157806879|gb|EDO84049.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 406e]
 gi|160698825|gb|EDP88795.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei ATCC 10399]
 gi|184214835|gb|EDU11878.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1655]
 gi|217396500|gb|EEC36517.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 576]
 gi|225928056|gb|EEH24093.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pakistan 9]
 gi|237504732|gb|ACQ97050.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei MSHR346]
 gi|238521581|gb|EEP85031.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei GB8 horse 4]
 gi|254219694|gb|EET09078.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1710a]
          Length = 241

 Score =  141 bits (355), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 45/240 (18%), Positives = 77/240 (32%), Gaps = 17/240 (7%)

Query: 3   ENTLTG-KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDS 61
           E+ L G   + S +E    +      +    F        + +P  +  I    N+    
Sbjct: 10  EDLLAGLDSARSEEEAFRSVETAAAALD---FEYCAYGLRVPWPLSRPRIETRSNFPEQW 66

Query: 62  GDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFP 121
                       D  L H      P++       +                    G A  
Sbjct: 67  KRRYVEAGFLDVDPILAHGRRSQQPVVLAETLFAS-----AHQMWVEAQSFGLRFGWAQS 121

Query: 122 VRLGFHKNGYVIFTSEFLMLANEVI-------IEAHGACYQVITDFLELFKKRSSAARNL 174
               +   G +        +    +              +  +   + L K  +   R L
Sbjct: 122 SFDAYGGMGMLALVRSREPVTAAELDAKEYRMRWLVRTAHAALGRMM-LPKLMADPERGL 180

Query: 175 TERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           TERE   L+ A DG TS EI++ L +SV TVN ++ +A +KL   N+  A+ +A   G +
Sbjct: 181 TEREVEVLKWAADGKTSGEISKILAISVDTVNFHVKNAILKLRTANKTAAVVRAAMLGLL 240


>gi|256368654|ref|YP_003106160.1| transcriptional regulator, LuxR autoinducer regulated family
           [Brucella microti CCM 4915]
 gi|255998812|gb|ACU47211.1| transcriptional regulator, LuxR autoinducer regulated family
           [Brucella microti CCM 4915]
          Length = 235

 Score =  141 bits (355), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 46/234 (19%), Positives = 80/234 (34%), Gaps = 17/234 (7%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           + + S  +L   +    + +    F   +   ++              +           
Sbjct: 11  QSADSADQLFEIIKNYAHDL---GFEYVSYVMSIPSLNGSLKWVRFGAFPDGWEQRYLAQ 67

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  L    + + P+IW      +  +                 GI+ P       
Sbjct: 68  NYAEIDPLLRRGVNSIDPLIWSQNFFASAPQ-----IWADAVKYGLKVGISQPCWAAQGV 122

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELF--KKRSSAA------RNLTERETS 180
            G + F      L    I        Q++T+ L L   ++    A       +LT RE  
Sbjct: 123 FGLLSFVRSGPALTPGEISML-RRQLQMVTNLLHLSMYERVDVPAISCIGDVSLTLRERE 181

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            L+   +G T+E I   L +S  TVN ++ +   KL AVN++QA+AKA  FG +
Sbjct: 182 ILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNKVQAVAKARTFGLL 235


>gi|260756046|ref|ZP_05868394.1| autoinducer-binding domain-containing protein [Brucella abortus bv.
           6 str. 870]
 gi|260676154|gb|EEX62975.1| autoinducer-binding domain-containing protein [Brucella abortus bv.
           6 str. 870]
          Length = 238

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 46/234 (19%), Positives = 81/234 (34%), Gaps = 17/234 (7%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           + + S  +L   +    + +    F   +   ++ +            +           
Sbjct: 14  QSADSADQLFEIVKNYAHDL---GFEYVSYVMSIPYLNGSLKWVRFGAFPDGWEQRYLAQ 70

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  L    + + P+IW      +  +                 GI+ P       
Sbjct: 71  NYAEIDPLLRRGVNSIDPLIWSQNFFASAPQ-----IWADAVKYGLKVGISQPCWAAQGV 125

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELF--KKRSSAA------RNLTERETS 180
            G + F      L    I        Q++T+ L L   ++    A       +LT RE  
Sbjct: 126 FGLLSFVRSGPALTPGEISML-RRQLQMVTNLLHLSMYERVDVPAISCIGDVSLTLRERE 184

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            L+   +G T+E I   L +S  TVN ++ +   KL AVN++QA+AKA  FG +
Sbjct: 185 ILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNKVQAVAKARTFGLL 238


>gi|259415201|ref|ZP_05739123.1| transcriptional regulator, LuxR family [Silicibacter sp. TrichCH4B]
 gi|259349111|gb|EEW60865.1| transcriptional regulator, LuxR family [Silicibacter sp. TrichCH4B]
          Length = 239

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 41/239 (17%), Positives = 87/239 (36%), Gaps = 27/239 (11%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNI 67
            + S++L+E+   L   +N ++  +     ++ +         I       +   D  + 
Sbjct: 14  IESSANLEEIGEVLARFRNLLEVDHVFYRWVDRSGS-------ISGCSTLPVAWQDRYSA 66

Query: 68  LIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
           +     D  +    +   P+ W+ +     +  +           +   G + PVR    
Sbjct: 67  MGYHRIDPVVIGCYTAFHPVDWRDLDWSARL--AAAFRKDSLAFGVGSQGYSVPVRGPAG 124

Query: 128 ------------KNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLT 175
                          +  FT +    + ++I+ AH    + +   +  +       + L+
Sbjct: 125 QYAVFSITKTCKGEVWDKFTRKH---SRDLILVAHYVNRRALDFEMSFY---PLPEQPLS 178

Query: 176 ERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            RE+  L L  +G +    AE + +S HT+  Y+  A  KL A N   A+A+A+  G I
Sbjct: 179 MRESEALSLLAEGMSRARAAEAMDISEHTLRVYIEGARSKLQAQNTTHAVARAVTMGLI 237


>gi|149203939|ref|ZP_01880907.1| autoinducer-binding transcriptional regulator LuxR [Roseovarius sp.
           TM1035]
 gi|149142381|gb|EDM30426.1| autoinducer-binding transcriptional regulator LuxR [Roseovarius sp.
           TM1035]
          Length = 224

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 43/225 (19%), Positives = 74/225 (32%), Gaps = 17/225 (7%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDF 76
               L  ++NR +  + A   +N                 Y  D             D  
Sbjct: 7   FRQFLDDLRNRFELDHVAYAGMNPISGQSHGHM------TYGADWTSHYLQHKYYEIDPT 60

Query: 77  LFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFA-GIAFPVRLGFHKNGYVIFT 135
           L      + P+ W  +  E   E       +          G+  P+   +   G +   
Sbjct: 61  LLKARHSIAPVDWNRL--ERGAEFQTIF--QAARDFGISDRGLTIPIHGPYGDVGGLSIN 116

Query: 136 SEFLMLANEVIIE-----AHGACYQVITDFLELFK-KRSSAARNLTERETSCLQLAGDGY 189
            +      +++I         A   +    ++     R     +L+ RE   LQ    G 
Sbjct: 117 RDCSEREWQLLISGIIGNLQAAAVHMHDMVIQSDPLTRMLNTPSLSTREIEILQWTAAGK 176

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           + ++I + L +S  TV  +L SA  KL+A+   QAI +AI  G I
Sbjct: 177 SQQDIGDILSISHRTVEVHLRSARQKLNALTTPQAIGRAINLGLI 221


>gi|296156923|ref|ZP_06839760.1| transcriptional regulator, LuxR family [Burkholderia sp. Ch1-1]
 gi|295892809|gb|EFG72590.1| transcriptional regulator, LuxR family [Burkholderia sp. Ch1-1]
          Length = 234

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 37/231 (16%), Positives = 68/231 (29%), Gaps = 13/231 (5%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           ++   E    +  +          +  +        R +       Y        +    
Sbjct: 7   AADEAEWFGAIAGLAETWGFDKLLIAMLPRPT---IRLEDAYVRSTYSPIWRRTYDEQGL 63

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
            + D  + H  +   P+IW     +    +S Q            AG+  P+     + G
Sbjct: 64  VHIDPTVSHCATRATPLIWS---PDIFTTASQQSMYEEARAHGLRAGVTLPIHGPNQEAG 120

Query: 131 YVIFTSEFLMLANEVIIEAHGACYQVITDFL-------ELFKKRSSAARNLTERETSCLQ 183
            + F ++                  V+   L        L     +    LT RE  CL+
Sbjct: 121 MMCFVNDSNPSDEFWRHINVALPNLVLLRDLVIDTSQRHLNTHAQTLLPKLTPRERECLK 180

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G ++ EI+  L  S   VN ++ +   K    +R  A   A + G I
Sbjct: 181 WTARGKSTWEISHILNCSEAVVNFHMKNIRTKFGVNSRRAAAVIATQLGLI 231


>gi|53719957|ref|YP_108943.1| LuxR family regulatory protein [Burkholderia pseudomallei K96243]
 gi|52210371|emb|CAH36350.1| LuxR family regulatory protein [Burkholderia pseudomallei K96243]
 gi|156105364|gb|ABU49181.1| BpsR5 [Burkholderia pseudomallei]
          Length = 241

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 45/240 (18%), Positives = 77/240 (32%), Gaps = 17/240 (7%)

Query: 3   ENTLTG-KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDS 61
           E+ L G   + S +E    +      +    F        + +P  +  I    N+    
Sbjct: 10  EDLLAGLDSARSEEEAFRSVETAAAALD---FEYCAYGLRVPWPLSRPRIETRSNFPEQW 66

Query: 62  GDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFP 121
                       D  L H      P++       +                    G A  
Sbjct: 67  KRRYVEAGFLDVDPILAHGRRSQQPVVLAETLFAS-----AHQMWVEAQSFGLRFGWAQS 121

Query: 122 VRLGFHKNGYVIFTSEFLMLANEVI-------IEAHGACYQVITDFLELFKKRSSAARNL 174
               +   G +        +    +              +  +   + L K  +   R L
Sbjct: 122 SFDAYGGMGMLALVRSCEPVTAAELDAKEYRMRWLVRTAHAALGRMM-LPKLMADPERGL 180

Query: 175 TERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           TERE   L+ A DG TS EI++ L +SV TVN ++ +A +KL   N+  A+ +A   G +
Sbjct: 181 TEREVEVLKWAADGKTSGEISKILAISVDTVNFHVKNAILKLRTANKTAAVVRAAMLGLL 240


>gi|126724411|ref|ZP_01740254.1| transcriptional regulator, LuxR family protein [Rhodobacterales
           bacterium HTCC2150]
 gi|126705575|gb|EBA04665.1| transcriptional regulator, LuxR family protein [Rhodobacterales
           bacterium HTCC2150]
          Length = 238

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 46/231 (19%), Positives = 83/231 (35%), Gaps = 15/231 (6%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
           +S++       +  +   +     +  T++           +    NY  +       + 
Sbjct: 14  QSNTSDNYLTFIDQLCEHMDFDFASYATMSPVTG------SVLGYANYPDEWKMHYMRMN 67

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
               D  +      + P+ W  +   +  ES   +  R     L   G+  PVR  F   
Sbjct: 68  LHRVDPTIHQSARSIAPVDWTRL---SRGESFNSVFYRANDFGLTDQGLTVPVRGPFGDV 124

Query: 130 GYVIFTSEFLMLAN-----EVIIEAHGACYQVITDFLELF-KKRSSAARNLTERETSCLQ 183
           G +  T             + I E   A   +    ++     R+    +L+ RET  LQ
Sbjct: 125 GLLSVTRSCSEREWKLLTRDKISELQMAAVHLHDSVMQSDVLSRALRRPSLSARETEVLQ 184

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G T ++I + L +S  TV  ++ SA  KL A+  IQA+ +AI +  I
Sbjct: 185 WTAIGKTQQDIGDILSISHRTVEVHMRSAREKLGALTTIQAVGRAIGYQII 235


>gi|192290718|ref|YP_001991323.1| LuxR family transcriptional regulator [Rhodopseudomonas palustris
           TIE-1]
 gi|192284467|gb|ACF00848.1| transcriptional regulator, LuxR family [Rhodopseudomonas palustris
           TIE-1]
          Length = 240

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 70/227 (30%), Gaps = 3/227 (1%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNI 67
            +++ +   ++  L          +     I +     + Q     LH +          
Sbjct: 16  VERADTPDAVALALLAAVQVHGFSHVIAGVIPTPGTSAKEQIANVVLHQWPDVWSRRYFS 75

Query: 68  LIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
               + D  +    S ++P  W  + +      +G   +          G   P+     
Sbjct: 76  KGYIFTDPAIRRVTSSMVPFSWTELWDHD--SPAGHRILGEAAEFGLKEGFTVPMVTLDG 133

Query: 128 KNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGD 187
            +  +        L   +                 L ++  +    LT RE   L    +
Sbjct: 134 HSAGLSIAGAMTELPPHLRGPVQMMAIYSFARAAHLRERPPAPV-TLTIREADVLHWIAE 192

Query: 188 GYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           G T  EIA  L +S H V+        K   VNR+QA+ +A+R G I
Sbjct: 193 GKTDWEIARILQVSEHLVDKVARQIKSKFQVVNRVQAVVQAMRAGVI 239


>gi|6716341|gb|AAF26601.1|AF110468_3 PsyR [Pseudomonas syringae pv. tabaci]
          Length = 246

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 39/230 (16%), Positives = 67/230 (29%), Gaps = 16/230 (6%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           L++L        + I    +A ++         R      L NY                
Sbjct: 24  LRQLIEDFENDLHHIGDFTYAYFSTPKT-----RNVKPVILSNYPDSWLKSYVASNYHLI 78

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
           D  + H    + P  W+    E          ++        +G  F +         + 
Sbjct: 79  DPIIKHAWHSITPFFWREA--ECCSGRRTDDFLKRSAKYQLSSGATFTLHDASWLFAALS 136

Query: 134 FTSEFLMLANEVIIE---------AHGACYQVITDFLELFKKRSSAARNLTERETSCLQL 184
             +       +  I                ++I            A   L+ RET  L+ 
Sbjct: 137 LCNARQQNDFDQRIREKAADIQMSLIRFHDRLIKTRAPHELFPQPAQCKLSTRETGVLKW 196

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              G +  EIAE   +S  TV  ++ + + KL      QA+ KAI  G +
Sbjct: 197 VAMGKSYSEIAEIFSISERTVKFHMSNVSSKLKVRTAKQAVYKAINMGMV 246


>gi|218663810|ref|ZP_03519740.1| hypothetical protein RetlI_33506 [Rhizobium etli IE4771]
          Length = 253

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 36/236 (15%), Positives = 64/236 (27%), Gaps = 13/236 (5%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQL------ICELHNYDLD 60
               ++   +L   L        A NF +  +        R            + NY  +
Sbjct: 21  QADSAAQPDQLFDLLAAF-----ALNFDIPWVAYGPLAADRWAFKRVKYDPQVVLNYPDE 75

Query: 61  SGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAF 120
                + +        +           W  +  +       +            +GI  
Sbjct: 76  WQKRCSEMAYDRVGPVVKESRKQRRAFQWSEVYNDVYTTEGERRIFDEAAAFGLRSGITV 135

Query: 121 PVRLGFHKNGYVIFT-SEFLMLANEVIIEAHGACYQVITDFLELFKKR-SSAARNLTERE 178
           P+           F         N  I     A     +   +            L+ RE
Sbjct: 136 PLHGPDGSFAITSFAQHSSGQFQNRAISYLQLAALHFHSRVGKFADSNCIDEGAVLSGRE 195

Query: 179 TSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             C+     G +S +I   LG+S +TV+ ++ +   KLD  +R  A   A   G I
Sbjct: 196 RECIAWVARGKSSSDIGTILGISKNTVDFHIKNVMRKLDTASRTVAAITAATLGII 251


>gi|91779483|ref|YP_554691.1| LuxR family transcriptional regulator [Burkholderia xenovorans
           LB400]
 gi|91692143|gb|ABE35341.1| transcriptional regulator, LuxR family [Burkholderia xenovorans
           LB400]
          Length = 234

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 36/231 (15%), Positives = 67/231 (29%), Gaps = 13/231 (5%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           ++   E    +  +          +  +        R +       Y        +    
Sbjct: 7   AADEAEWFGTIAGLVETWGFEKLLIAMLPRPT---IRLEDAYVRSTYSPIWRRTYDEQGL 63

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
            + D  + H  +   P+IW     +    +  Q            AG+  P+     + G
Sbjct: 64  VHIDPTVSHCATRATPLIWS---PDIFTTAPQQSMYEEARAHGLRAGVTLPIHGPNQEAG 120

Query: 131 YVIFTS-EFLMLANEVIIEAHGACYQVITDF------LELFKKRSSAARNLTERETSCLQ 183
            + F +           I        ++ D         L     +    LT RE  CL+
Sbjct: 121 MMCFVNDSNPNDEFWQHINVALPNLVLLRDLVIDTSQRHLNTHAQTLLPKLTPRERECLK 180

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G ++ EI+  L  S   VN ++ +   K    +R  A   A + G I
Sbjct: 181 WTARGKSTWEISHILNCSEAVVNFHMKNIRTKFGVNSRRAAAVIATQLGLI 231


>gi|208401188|gb|ACI26687.1| RhlR transcriptional regulator [Pseudomonas aeruginosa]
 gi|209171245|gb|ACI42868.1| RhlR [Pseudomonas aeruginosa]
          Length = 241

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 33/219 (15%), Positives = 68/219 (31%), Gaps = 10/219 (4%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNI 67
             +   + +      +++  ++   F  Y        P  +        Y     +   +
Sbjct: 15  RSEMQPIHDSQGVFAVLEKEVRRLGFDYYAYGVRHTIPFTRPKTEVHGTYPKAWLERYQM 74

Query: 68  LIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
                 D  + +       ++W     +       ++            G   P+R   +
Sbjct: 75  QNYGAVDPAILNGLRSSEMVVWSDSLFD-----QSRMLWNEARDWGLCVGATLPIRAPNN 129

Query: 128 KNGYVIFTSEFLMLA---NEVIIEAHGACYQVITDFLELFKKRSSAARN--LTERETSCL 182
               +    +   ++    E I        +++T  L   +     +    L+ RE   L
Sbjct: 130 LLSVLSVARDQQNISSFEREEIRLRLRCMIELLTQKLTDLEHPMLMSNPVCLSHREREIL 189

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNR 221
           Q   DG +S EIA  L +S  TVN +  +   K DA N+
Sbjct: 190 QWTADGKSSGEIAIILSISESTVNFHHKNIQKKFDAPNK 228


>gi|99078080|ref|YP_611338.1| LuxR family transcriptional regulator [Ruegeria sp. TM1040]
 gi|99035218|gb|ABF62076.1| transcriptional regulator, LuxR family [Ruegeria sp. TM1040]
          Length = 239

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 40/233 (17%), Positives = 82/233 (35%), Gaps = 15/233 (6%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNI 67
            + S++L+E+   L   +N +   + +   ++ +         +           D  + 
Sbjct: 14  IESSANLEEIGEVLAQFRNLVDLDHVSYRWVDRSGS-------VSGCSTLPTAWQDRYSA 66

Query: 68  LIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
           +     D  +    +   P+ W+ +     + S+ +         +   G + PVR    
Sbjct: 67  MSYHRIDPVVIGCYTAFHPVDWRDLDWSARLASAYR--KDSIAFGVGNQGYSVPVRGPAG 124

Query: 128 KNGYVIFTSEFLMLANEVI-----IEAHGACYQVITDFLELFKKRSS-AARNLTERETSC 181
           +   +  T        +        +     + V    LE          + L+ RE+  
Sbjct: 125 QYAILSITKSCEGEVWDKFTQKHSRDLILLAHYVNRRALEFEVSYYPTPEQPLSMRESEA 184

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           L L  +G +    AE + +S HT+  Y+  A  KL A N   A+A+A+  G I
Sbjct: 185 LSLLAEGMSRARAAEAMAISEHTLRVYIEGARSKLQAQNTTHAVARAVTMGLI 237


>gi|213418834|ref|ZP_03351900.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhi str. E01-6750]
          Length = 192

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 38/197 (19%), Positives = 62/197 (31%), Gaps = 10/197 (5%)

Query: 43  DFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSG 102
             P  +  I     Y                D  L   N     + W  +          
Sbjct: 1   PVPFTRPKISLRTTYPQAWVTHYQSENYFAIDPVLKPENFRQGHLHWDDVLFH-----EA 55

Query: 103 QLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLAN----EVIIEAHGACYQVIT 158
           Q             G+   V L     G++ F+   L  ++    EV +       + ++
Sbjct: 56  QAMWDAAQRFGLRRGVTQCVMLPNRALGFLSFSRSSLRCSSFTYDEVELRLQLLARESLS 115

Query: 159 DFLELFKK-RSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLD 217
               L      +     ++RE   L+   +G TS EIA  L +S +TVN +  +   K +
Sbjct: 116 ALTRLEDDMVMAPEMRFSKREKEILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFN 175

Query: 218 AVNRIQAIAKAIRFGYI 234
           A N+ Q    A   G I
Sbjct: 176 APNKTQIACYAAATGLI 192


>gi|23501101|ref|NP_697228.1| LuxR family transcriptional regulator [Brucella suis 1330]
 gi|62289164|ref|YP_220957.1| LuxR family transcriptional regulator [Brucella abortus bv. 1 str.
           9-941]
 gi|82699104|ref|YP_413678.1| transcriptional regulator LuxR family protein [Brucella melitensis
           biovar Abortus 2308]
 gi|163842459|ref|YP_001626863.1| transcriptional activator protein solR [Brucella suis ATCC 23445]
 gi|254694980|ref|ZP_05156808.1| Transcriptional activator, LUXR family protein [Brucella abortus
           bv. 3 str. Tulya]
 gi|254696612|ref|ZP_05158440.1| Transcriptional activator, LUXR family protein [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|254700994|ref|ZP_05162822.1| Transcriptional activator, LUXR family protein [Brucella suis bv. 5
           str. 513]
 gi|254705366|ref|ZP_05167194.1| Transcriptional activator, LUXR family protein [Brucella suis bv. 3
           str. 686]
 gi|254707120|ref|ZP_05168948.1| Transcriptional activator, LUXR family protein [Brucella
           pinnipedialis M163/99/10]
 gi|254709336|ref|ZP_05171147.1| Transcriptional activator, LUXR family protein [Brucella
           pinnipedialis B2/94]
 gi|254713241|ref|ZP_05175052.1| Transcriptional activator, LUXR family protein [Brucella ceti
           M644/93/1]
 gi|254716405|ref|ZP_05178216.1| Transcriptional activator, LUXR family protein [Brucella ceti
           M13/05/1]
 gi|254731525|ref|ZP_05190103.1| Transcriptional activator, LUXR family protein [Brucella abortus
           bv. 4 str. 292]
 gi|256030859|ref|ZP_05444473.1| Transcriptional activator, LUXR family protein [Brucella
           pinnipedialis M292/94/1]
 gi|256045980|ref|ZP_05448852.1| Transcriptional activator, LUXR family protein [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256060329|ref|ZP_05450502.1| Transcriptional activator, LUXR family protein [Brucella neotomae
           5K33]
 gi|256112692|ref|ZP_05453613.1| Transcriptional activator, LUXR family protein [Brucella melitensis
           bv. 3 str. Ether]
 gi|256158890|ref|ZP_05456740.1| Transcriptional activator, LUXR family protein [Brucella ceti
           M490/95/1]
 gi|256254264|ref|ZP_05459800.1| Transcriptional activator, LUXR family protein [Brucella ceti
           B1/94]
 gi|256258748|ref|ZP_05464284.1| Transcriptional activator, LUXR family protein [Brucella abortus
           bv. 9 str. C68]
 gi|260169762|ref|ZP_05756573.1| Transcriptional activator, LUXR family protein [Brucella sp. F5/99]
 gi|23346971|gb|AAN29143.1| transcriptional regulator, LuxR autoinducer regulated family
           [Brucella suis 1330]
 gi|62195296|gb|AAX73596.1| transcriptional regulator, LuxR autoinducer regulated family
           [Brucella abortus bv. 1 str. 9-941]
 gi|82615205|emb|CAJ10146.1| Bacterial regulatory protein, LuxR family:Autoinducer binding
           domain [Brucella melitensis biovar Abortus 2308]
 gi|163673182|gb|ABY37293.1| Transcriptional activator protein solR [Brucella suis ATCC 23445]
          Length = 235

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 46/234 (19%), Positives = 80/234 (34%), Gaps = 17/234 (7%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           + + S  +L   +    + +    F   +   ++              +           
Sbjct: 11  QSADSADQLFEIVKNYAHDL---GFEYVSYVMSIPSLNGSLKWVRFGAFPDGWEQRYLAQ 67

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  L    + + P+IW      +  +                 GI+ P       
Sbjct: 68  NYAEIDPLLRRGVNSIDPLIWSQNFFASAPQ-----IWADAVKYGLKVGISQPCWAAQGV 122

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELF--KKRSSAA------RNLTERETS 180
            G + F      L    I        Q++T+ L L   ++    A       +LT RE  
Sbjct: 123 FGLLSFVRSGPALTPGEISML-RRQLQMVTNLLHLSMYERVDVPAISCIGDVSLTLRERE 181

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            L+   +G T+E I   L +S  TVN ++ +   KL AVN++QA+AKA  FG +
Sbjct: 182 ILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNKVQAVAKARTFGLL 235


>gi|300716150|ref|YP_003740953.1| regulatory protein [Erwinia billingiae Eb661]
 gi|299061986|emb|CAX59102.1| Regulatory protein [Erwinia billingiae Eb661]
          Length = 240

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 40/227 (17%), Positives = 77/227 (33%), Gaps = 10/227 (4%)

Query: 13  SLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETY 72
           ++ ++S    LI+ +  A  F  Y +      P  +  I    +Y               
Sbjct: 19  NVSDISEITALIEQQTLALGFDFYALYIRHPVPFTRPKIFIYSSYPKKWVSAYQKGNFAA 78

Query: 73  GDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYV 132
            D  + +       ++W        +   GQ            +G +          G +
Sbjct: 79  IDPVIENCQVPGKIVLWDE-----PLSRRGQKVFDAAKEYGIHSGFSACAMAKNRSIGIL 133

Query: 133 IFTS----EFLMLANEVIIEAHGACYQVITDFLELFKKRSSAA-RNLTERETSCLQLAGD 187
              S    E +ML  E  ++       ++    ++     S     L++RE   L+   +
Sbjct: 134 SMASGKTFEKIMLTPEKQLKLQYLSVLIMEALQQVKDISMSVMNMELSQRELEILKWTAE 193

Query: 188 GYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           G TS EI+  L +S +TVN +      + +A N+ Q  + A   G +
Sbjct: 194 GKTSAEISLILSISENTVNFHQKKMQKRFNAPNKTQVASYAAAIGLL 240


>gi|17988041|ref|NP_540675.1| transcriptional activator, LUXR family [Brucella melitensis bv. 1
           str. 16M]
 gi|161618178|ref|YP_001592065.1| transcriptional activator protein solR [Brucella canis ATCC 23365]
 gi|189023440|ref|YP_001934208.1| LuxR family transcriptional regulator [Brucella abortus S19]
 gi|225626726|ref|ZP_03784765.1| Transcriptional activator protein solR [Brucella ceti str. Cudo]
 gi|237814657|ref|ZP_04593655.1| Transcriptional activator protein solR [Brucella abortus str. 2308
           A]
 gi|260546462|ref|ZP_05822202.1| transcriptional activator [Brucella abortus NCTC 8038]
 gi|260563261|ref|ZP_05833747.1| transcriptional activator [Brucella melitensis bv. 1 str. 16M]
 gi|260567174|ref|ZP_05837644.1| transcriptional activator [Brucella suis bv. 4 str. 40]
 gi|260759270|ref|ZP_05871618.1| autoinducer-binding domain-containing protein [Brucella abortus bv.
           4 str. 292]
 gi|260760992|ref|ZP_05873335.1| autoinducer-binding domain-containing protein [Brucella abortus bv.
           2 str. 86/8/59]
 gi|260885067|ref|ZP_05896681.1| autoinducer-binding domain-containing protein [Brucella abortus bv.
           9 str. C68]
 gi|261215322|ref|ZP_05929603.1| autoinducer-binding domain-containing protein [Brucella abortus bv.
           3 str. Tulya]
 gi|261218189|ref|ZP_05932470.1| autoinducer-binding domain-containing protein [Brucella ceti
           M13/05/1]
 gi|261221416|ref|ZP_05935697.1| autoinducer-binding domain-containing protein [Brucella ceti B1/94]
 gi|261314598|ref|ZP_05953795.1| autoinducer-binding domain-containing protein [Brucella
           pinnipedialis M163/99/10]
 gi|261316846|ref|ZP_05956043.1| autoinducer-binding domain-containing protein [Brucella
           pinnipedialis B2/94]
 gi|261320963|ref|ZP_05960160.1| autoinducer-binding domain-containing protein [Brucella ceti
           M644/93/1]
 gi|261324304|ref|ZP_05963501.1| autoinducer-binding domain-containing protein [Brucella neotomae
           5K33]
 gi|261751515|ref|ZP_05995224.1| autoinducer-binding domain-containing protein [Brucella suis bv. 5
           str. 513]
 gi|261756080|ref|ZP_05999789.1| autoinducer-binding domain-containing protein [Brucella suis bv. 3
           str. 686]
 gi|261759304|ref|ZP_06003013.1| transcriptional activator [Brucella sp. F5/99]
 gi|265987917|ref|ZP_06100474.1| autoinducer-binding domain-containing protein [Brucella
           pinnipedialis M292/94/1]
 gi|265992391|ref|ZP_06104948.1| autoinducer-binding domain-containing protein [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|265994134|ref|ZP_06106691.1| autoinducer-binding domain-containing protein [Brucella melitensis
           bv. 3 str. Ether]
 gi|265997378|ref|ZP_06109935.1| autoinducer-binding domain-containing protein [Brucella ceti
           M490/95/1]
 gi|297247581|ref|ZP_06931299.1| LuxR family transcriptional regulator [Brucella abortus bv. 5 str.
           B3196]
 gi|17983788|gb|AAL52939.1| transcriptional activator, luxr family [Brucella melitensis bv. 1
           str. 16M]
 gi|161334989|gb|ABX61294.1| Transcriptional activator protein solR [Brucella canis ATCC 23365]
 gi|189019012|gb|ACD71734.1| Transcriptional activator, LUXR family [Brucella abortus S19]
 gi|225618383|gb|EEH15426.1| Transcriptional activator protein solR [Brucella ceti str. Cudo]
 gi|237789494|gb|EEP63704.1| Transcriptional activator protein solR [Brucella abortus str. 2308
           A]
 gi|260096569|gb|EEW80445.1| transcriptional activator [Brucella abortus NCTC 8038]
 gi|260153277|gb|EEW88369.1| transcriptional activator [Brucella melitensis bv. 1 str. 16M]
 gi|260156692|gb|EEW91772.1| transcriptional activator [Brucella suis bv. 4 str. 40]
 gi|260669588|gb|EEX56528.1| autoinducer-binding domain-containing protein [Brucella abortus bv.
           4 str. 292]
 gi|260671424|gb|EEX58245.1| autoinducer-binding domain-containing protein [Brucella abortus bv.
           2 str. 86/8/59]
 gi|260874595|gb|EEX81664.1| autoinducer-binding domain-containing protein [Brucella abortus bv.
           9 str. C68]
 gi|260916929|gb|EEX83790.1| autoinducer-binding domain-containing protein [Brucella abortus bv.
           3 str. Tulya]
 gi|260920000|gb|EEX86653.1| autoinducer-binding domain-containing protein [Brucella ceti B1/94]
 gi|260923278|gb|EEX89846.1| autoinducer-binding domain-containing protein [Brucella ceti
           M13/05/1]
 gi|261293653|gb|EEX97149.1| autoinducer-binding domain-containing protein [Brucella ceti
           M644/93/1]
 gi|261296069|gb|EEX99565.1| autoinducer-binding domain-containing protein [Brucella
           pinnipedialis B2/94]
 gi|261300284|gb|EEY03781.1| autoinducer-binding domain-containing protein [Brucella neotomae
           5K33]
 gi|261303624|gb|EEY07121.1| autoinducer-binding domain-containing protein [Brucella
           pinnipedialis M163/99/10]
 gi|261739288|gb|EEY27284.1| transcriptional activator [Brucella sp. F5/99]
 gi|261741268|gb|EEY29194.1| autoinducer-binding domain-containing protein [Brucella suis bv. 5
           str. 513]
 gi|261745833|gb|EEY33759.1| autoinducer-binding domain-containing protein [Brucella suis bv. 3
           str. 686]
 gi|262551846|gb|EEZ07836.1| autoinducer-binding domain-containing protein [Brucella ceti
           M490/95/1]
 gi|262765115|gb|EEZ11036.1| autoinducer-binding domain-containing protein [Brucella melitensis
           bv. 3 str. Ether]
 gi|263003457|gb|EEZ15750.1| autoinducer-binding domain-containing protein [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|264660114|gb|EEZ30375.1| autoinducer-binding domain-containing protein [Brucella
           pinnipedialis M292/94/1]
 gi|297174750|gb|EFH34097.1| LuxR family transcriptional regulator [Brucella abortus bv. 5 str.
           B3196]
          Length = 238

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 46/234 (19%), Positives = 80/234 (34%), Gaps = 17/234 (7%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           + + S  +L   +    + +    F   +   ++              +           
Sbjct: 14  QSADSADQLFEIVKNYAHDL---GFEYVSYVMSIPSLNGSLKWVRFGAFPDGWEQRYLAQ 70

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  L    + + P+IW      +  +                 GI+ P       
Sbjct: 71  NYAEIDPLLRRGVNSIDPLIWSQNFFASAPQ-----IWADAVKYGLKVGISQPCWAAQGV 125

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELF--KKRSSAA------RNLTERETS 180
            G + F      L    I        Q++T+ L L   ++    A       +LT RE  
Sbjct: 126 FGLLSFVRSGPALTPGEISML-RRQLQMVTNLLHLSMYERVDVPAISCIGDVSLTLRERE 184

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            L+   +G T+E I   L +S  TVN ++ +   KL AVN++QA+AKA  FG +
Sbjct: 185 ILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNKVQAVAKARTFGLL 238


>gi|7385146|gb|AAF61717.1|AF232768_2 acylhomoserine lactone dependent transcriptional activator
           [Pseudomonas fluorescens]
          Length = 242

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 36/216 (16%), Positives = 61/216 (28%), Gaps = 15/216 (6%)

Query: 28  IKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPI 87
           ++  ++A +      +          + NY                D  + H      P 
Sbjct: 33  LQGASYAYFAAPRNREVA-----PLIVSNYPARWLKAYKNANYHLIDPIIHHGLKSCAPF 87

Query: 88  IWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVII 147
            W    +    E S +L  R         G  F +         +   +       E  +
Sbjct: 88  SWSDALQAAPCERSRELFRRS-SQYRICTGATFTLHDAGGMFSSLSLCNSGPQAEFERRM 146

Query: 148 E-----AHGACYQVITDFLELFKK----RSSAARNLTERETSCLQLAGDGYTSEEIAEKL 198
                    A  +     L L              L+ RE   L+    G    EIA   
Sbjct: 147 ADQQGHLQMALIRFHGRLLSLRAMDELFPEPQTGPLSARELGVLKWVMMGKAYREIAVIC 206

Query: 199 GLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +S  TV  ++ + + KL   N  QA+ +A R G +
Sbjct: 207 AISERTVKFHMSNISGKLQVCNAKQAVYEAQRQGIL 242


>gi|330973884|gb|EGH73950.1| LuxR transcriptional regulator [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 247

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 35/230 (15%), Positives = 65/230 (28%), Gaps = 19/230 (8%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           +++    LH I +      +A ++                L NY                
Sbjct: 28  IEDFENDLHRIGDFT----YAYFSSPKTRTV-----KPVILSNYPDSWLKSYIASNYHLI 78

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
           D  + H    + P  W+  +       +     R        +G  F +         + 
Sbjct: 79  DPIIKHAWHSITPFFWREARHAIQGVETDDFLKRSAK-YQLSSGATFTLHDASGLFAALS 137

Query: 134 FTSEFLMLANEVII-----EAHGACYQVITDFLELFKK----RSSAARNLTERETSCLQL 184
             +       +  I     +   +  +                      L+ RE   L+ 
Sbjct: 138 LCNARQQTDFDQRIRDKAADIQMSLIRFHDRLTRTQAPHELFPQPTRCKLSSREIGVLKW 197

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              G    EIAE   +S  TV  ++ + + KL+     QA+ KAI  G +
Sbjct: 198 VAMGKAYSEIAEIFSISERTVKFHMSNVSSKLEVRTAKQAVYKAINMGMV 247


>gi|270261276|ref|ZP_06189549.1| transcriptional regulatory protein [Serratia odorifera 4Rx13]
 gi|270044760|gb|EFA17851.1| transcriptional regulatory protein [Serratia odorifera 4Rx13]
          Length = 238

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 41/214 (19%), Positives = 74/214 (34%), Gaps = 12/214 (5%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
            S+ +    L  ++   +A  F  Y+      +P  +  +    NY  +  +    L   
Sbjct: 14  DSVHDRELFLRRLEPCAQALGFEYYSYIVFSCYPASRPKMLIEGNYPAEYLEDYRKLRVY 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  +   +   L   W     +   E    L  R+        G +  ++  + + G 
Sbjct: 74  LQDPVIDQAHHSTLQFHWDEEFYQDRPE----LWWRMAQ-FGIREGWSQSIKDCYGRLGI 128

Query: 132 VIFTSEFLMLANEVIIEAH-----GACYQVITDFLELFKKRSSAA--RNLTERETSCLQL 184
           + F  + +   +      +                E     +  A    LT RE   L+ 
Sbjct: 129 LTFAGKKIPEQSPEAGARNETFFLWLAQIAHKTLREALISVNDEAIKDVLTLREKDILRW 188

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDA 218
             +G TSEEIA  +GLS  TVN ++G++  KL  
Sbjct: 189 CSEGKTSEEIAMLMGLSERTVNFHIGNSIKKLSV 222


>gi|254718404|ref|ZP_05180215.1| Transcriptional activator, LUXR family protein [Brucella sp. 83/13]
 gi|306840172|ref|ZP_07472955.1| LuxR family transcriptional regulator [Brucella sp. NF 2653]
 gi|306844457|ref|ZP_07477047.1| LuxR family transcriptional regulator [Brucella sp. BO1]
 gi|306275270|gb|EFM57020.1| LuxR family transcriptional regulator [Brucella sp. BO1]
 gi|306404737|gb|EFM61033.1| LuxR family transcriptional regulator [Brucella sp. NF 2653]
          Length = 235

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 46/234 (19%), Positives = 80/234 (34%), Gaps = 17/234 (7%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           + + S  +L   +    + +    F   +   ++              +           
Sbjct: 11  QSADSADQLFEIVKNYAHDL---GFEYVSYVMSIPSLNGSLKWVRFGAFPDGWEQRYLAQ 67

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  L    + + P+IW      +  +                 GI+ P       
Sbjct: 68  NYAEIDPLLRRGVNSIDPLIWSQNFFASAPQ-----IWADAVKYGLKVGISQPCWAAQGV 122

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELF--KKRSSAA------RNLTERETS 180
            G + F      L    I        Q++T+ L L   ++    A       +LT RE  
Sbjct: 123 FGLLSFVRTGPALTPGEISML-RRQLQMVTNLLHLSMYERVDVPAISCIGDVSLTLRERE 181

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            L+   +G T+E I   L +S  TVN ++ +   KL AVN++QA+AKA  FG +
Sbjct: 182 ILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNKVQAVAKARTFGLL 235


>gi|1730567|sp|P54303|PHZR_PSECL RecName: Full=Transcriptional activator protein phzR
 gi|496217|gb|AAA21841.1| positive regulatory protein [Pseudomonas chlororaphis subsp.
           aureofaciens]
          Length = 241

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 71/226 (31%), Gaps = 13/226 (5%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           ++     +    ++   F  +        P  +       NY  D             D 
Sbjct: 22  DMQEFTAVALRALRELRFDFFRYGMCSVTPFMRPRTYMYGNYPEDWVQRYQAANYAVIDP 81

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
            + H      PI+  +       +                 G+A P      + G +   
Sbjct: 82  TVKHSKVSSSPILASNELFRGCPD-----LWSEANDSNLRHGLAQPSFNTQGRVGVLSLA 136

Query: 136 SEFLMLANEVIIEAHGACYQVITDF-------LELFKKRSSAARNLTERETSCLQLAGDG 188
            +   ++ +   EA     +            LE   +  +     + RE   L+   DG
Sbjct: 137 RKDNPISLQE-FEALKVVTKAFAAAVHEKISELESDVRVFNTDVEFSGRECDVLRWTADG 195

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            TSEEI   +G+   TVN +  +   K+ A NR+QA   A+  GYI
Sbjct: 196 KTSEEIGVIMGVCTDTVNYHHRNIQRKIGASNRVQASRYAVAMGYI 241


>gi|91976651|ref|YP_569310.1| regulatory protein, LuxR [Rhodopseudomonas palustris BisB5]
 gi|91683107|gb|ABE39409.1| regulatory protein, LuxR [Rhodopseudomonas palustris BisB5]
          Length = 240

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 70/227 (30%), Gaps = 3/227 (1%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNI 67
            +++ +   ++  L          +     I +     + Q     LH +          
Sbjct: 16  VERADTPDAVALALLAAVQVHGFSHVIAGVIPTPGTSAKEQIANVVLHQWPDVWSRRYFS 75

Query: 68  LIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
               + D  +    S ++P  W  + +      +G   +          G   P+     
Sbjct: 76  KGYIFTDPAIRRVTSSMVPFSWTELWDHD--SPAGHRILGEAAEFGLKEGFTVPMVTLDG 133

Query: 128 KNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGD 187
            +  +        L   +                 L ++  +    LT RE   L    +
Sbjct: 134 HSAGLSIAGAITELPPHLRGPVQMMAIYSFARAAHLRERPPAPV-TLTIREADVLHWIAE 192

Query: 188 GYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           G T  EIA  L +S H V+        K   VNR+QA+ +A+R G I
Sbjct: 193 GKTDWEIARILQVSEHLVDKVARQIKSKFQVVNRVQAVVQAMRAGVI 239


>gi|225851721|ref|YP_002731954.1| transcriptional activator protein solR [Brucella melitensis ATCC
           23457]
 gi|265999658|ref|ZP_06111771.1| transcriptional activator [Brucella melitensis bv. 2 str. 63/9]
 gi|225640086|gb|ACN99999.1| Transcriptional activator protein solR [Brucella melitensis ATCC
           23457]
 gi|263095176|gb|EEZ18845.1| transcriptional activator [Brucella melitensis bv. 2 str. 63/9]
          Length = 238

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 46/234 (19%), Positives = 80/234 (34%), Gaps = 17/234 (7%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           + + S  +L   +    + +    F   +   ++              +           
Sbjct: 14  QSADSADQLFGIVKNYAHDL---GFEYVSYVMSIPSLNGSLKWVRFGAFPDGWEQRYLAQ 70

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  L    + + P+IW      +  +                 GI+ P       
Sbjct: 71  NYAEIDPLLRRGVNSIDPLIWSQNFFASAPQ-----IWADAVKYGLKVGISQPCWAAQGV 125

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELF--KKRSSAA------RNLTERETS 180
            G + F      L    I        Q++T+ L L   ++    A       +LT RE  
Sbjct: 126 FGLLSFVRSGPALTPGEISML-RRQLQMVTNLLHLSMYERVDVPAISCIGDVSLTLRERE 184

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            L+   +G T+E I   L +S  TVN ++ +   KL AVN++QA+AKA  FG +
Sbjct: 185 ILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNKVQAVAKARTFGLL 238


>gi|265983368|ref|ZP_06096103.1| autoinducer-binding domain-containing protein [Brucella sp. 83/13]
 gi|264661960|gb|EEZ32221.1| autoinducer-binding domain-containing protein [Brucella sp. 83/13]
          Length = 238

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 46/234 (19%), Positives = 80/234 (34%), Gaps = 17/234 (7%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           + + S  +L   +    + +    F   +   ++              +           
Sbjct: 14  QSADSADQLFEIVKNYAHDL---GFEYVSYVMSIPSLNGSLKWVRFGAFPDGWEQRYLAQ 70

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  L    + + P+IW      +  +                 GI+ P       
Sbjct: 71  NYAEIDPLLRRGVNSIDPLIWSQNFFASAPQ-----IWADAVKYGLKVGISQPCWAAQGV 125

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELF--KKRSSAA------RNLTERETS 180
            G + F      L    I        Q++T+ L L   ++    A       +LT RE  
Sbjct: 126 FGLLSFVRTGPALTPGEISML-RRQLQMVTNLLHLSMYERVDVPAISCIGDVSLTLRERE 184

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            L+   +G T+E I   L +S  TVN ++ +   KL AVN++QA+AKA  FG +
Sbjct: 185 ILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNKVQAVAKARTFGLL 238


>gi|238026711|ref|YP_002910942.1| acylhomoserine lactone dependent transcriptional activator
           [Burkholderia glumae BGR1]
 gi|237875905|gb|ACR28238.1| Acylhomoserine lactone dependent transcriptional activator
           [Burkholderia glumae BGR1]
          Length = 241

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 41/206 (19%), Positives = 64/206 (31%), Gaps = 11/206 (5%)

Query: 33  FALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSI 92
           FA   I+         +L C L +Y +              D  + H    + P  W   
Sbjct: 36  FAYVMIDK-----NSLELGCFLSSYPIRLQQEYRRRALHRVDPVVLHAIQSVAPFSWAEA 90

Query: 93  QEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIE---- 148
             +  +    +    L        G  F V   +   G + F +          IE    
Sbjct: 91  FRQQRVPDPSEFDA-LRREFGLHDGYVFTVHDPYQYVGMLSFFNRGGRPEFRAEIERVKG 149

Query: 149 -AHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNA 207
               A     +              +LT RE + L+ A  G +  EIA+  G+   TV  
Sbjct: 150 AMQLALVLFHSRINAKPPDSRHRVESLTLRERTVLKWAAMGKSYSEIADICGIRERTVKY 209

Query: 208 YLGSATVKLDAVNRIQAIAKAIRFGY 233
           ++ +   KLD     QA+  A R G 
Sbjct: 210 HMANVVQKLDVSTAKQAVIVASRLGL 235


>gi|83594724|ref|YP_428476.1| LuxR family transcriptional regulator [Rhodospirillum rubrum ATCC
           11170]
 gi|83577638|gb|ABC24189.1| transcriptional regulator, LuxR family [Rhodospirillum rubrum ATCC
           11170]
          Length = 260

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 45/237 (18%), Positives = 72/237 (30%), Gaps = 13/237 (5%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           +  +   + +    L+        F     +         +L   LHNY     +     
Sbjct: 14  EALNGTSDSADLTTLLTGTFARLGFPHSCYHVVRLEGAGARLPYVLHNYKDSWSEHYFRE 73

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  L       LP +W        +    +             G + P+R    +
Sbjct: 74  GFLEIDPVLATCPDRQLPFLWSEAIAPESLSHDQRRMFSDARDAGLHDGYSVPIRGSHGE 133

Query: 129 NGYVIFTSEFLMLANEVII-----EAHGACYQVITDFL------ELFKKRSSAARNLTER 177
              V    E    A   +I       H                  L  +R      L+ R
Sbjct: 134 FATVTVIPEQGGDAARRLIGEQKHLVHLLALYFDRHARSTVINARLSSRRRKTV--LSPR 191

Query: 178 ETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           E   L+ A  G TS EIAE  G+S  +V  +L +A  KL   ++  A+ KA+  G +
Sbjct: 192 EQEMLRWAALGKTSWEIAEIAGISTKSVEFHLDNAKKKLGTYSKTHAVVKALTLGLV 248


>gi|66044867|ref|YP_234708.1| LuxR transcriptional regulator [Pseudomonas syringae pv. syringae
           B728a]
 gi|33413265|emb|CAD97431.1| AHL regulator [Pseudomonas syringae pv. syringae]
 gi|63255574|gb|AAY36670.1| regulatory protein, LuxR:Autoinducer-binding [Pseudomonas syringae
           pv. syringae B728a]
          Length = 247

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 35/230 (15%), Positives = 66/230 (28%), Gaps = 19/230 (8%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           +++    LH I +      +A ++                L NY                
Sbjct: 28  IEDFENDLHRIGDFT----YAYFSSPKTRTV-----KPVILSNYPDSWLKSYIASNYHLI 78

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
           D  + H    + P  W+  +       +     R        +G  F +         + 
Sbjct: 79  DPIIKHAWHSITPFFWREARHAIQGVETDDFLKRSAK-YQLSSGATFTLHDASGLFAALS 137

Query: 134 FTSEFLMLANEVII-----EAHGACYQVITDFLELFKK----RSSAARNLTERETSCLQL 184
             +       +  I     +   +  +      +               L+ RE   L+ 
Sbjct: 138 LCNARQQTDFDQRIRDKAADIQMSLIRFHDRLTKTQAPHELFPQPTRCKLSSREIGVLKW 197

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              G    EIAE   +S  TV  ++ + + KL+     QA+ KAI  G +
Sbjct: 198 VAMGKAYSEIAEIFSISERTVKFHMSNVSSKLEVRTAKQAVYKAINMGMV 247


>gi|50956580|gb|AAT90827.1| acylhomoserine lactone dependent transcriptional activator
           [uncultured proteobacterium QS1]
          Length = 223

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 43/227 (18%), Positives = 73/227 (32%), Gaps = 14/227 (6%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           EL+P L    + +   N++ Y +  +     +      + NY  D   +         D 
Sbjct: 3   ELAPSLENALSCLGEFNYSYYVVRKS-----KNTKPIIVSNYPDDWLMLYEARSYHLYDP 57

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
            + +      P  W   Q     +   +L  +        +G  F +         +   
Sbjct: 58  VINYGMRRFAPFSWCDAQASDTADIGKELF-QSAEKYQISSGFTFVLHDAAELFASLSVC 116

Query: 136 SEFLMLANEVI-----IEAHGACYQVITDFLE---LFKKRSSAARNLTERETSCLQLAGD 187
                            E   A        L    + +     A  L+ RE   LQ  G 
Sbjct: 117 RSGRGSDFGQRVADHSAEIQMALINFHDHILSTQTVDELFPLPANLLSAREIEILQWVGK 176

Query: 188 GYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           G    E+A    +S HTV  ++   + KL+ +N  QA+ +AIR G I
Sbjct: 177 GKAYFEVAIICAISEHTVKFHISKISTKLNVLNAKQAVYEAIRRGII 223


>gi|261855565|ref|YP_003262848.1| LuxR family transcriptional regulator [Halothiobacillus
           neapolitanus c2]
 gi|261836034|gb|ACX95801.1| transcriptional regulator, LuxR family [Halothiobacillus
           neapolitanus c2]
          Length = 237

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 39/234 (16%), Positives = 78/234 (33%), Gaps = 13/234 (5%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNI 67
             +  S +        I++   A  F        L+     Q +  ++NY  +       
Sbjct: 9   VSQIQSAENEESAFKKIEDEALALGFENAAYGLRLNLNITNQKVVMMNNYSQNWKRRYTD 68

Query: 68  LIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
                 D  + H N  L+P++W        I  +               G +        
Sbjct: 69  ENYISIDPVVKHGNKSLMPVVWS----SNKITENKNF-WEDAYSHNLKYGWSQASADQVG 123

Query: 128 KNGYVIFTSEFLMLANEVIIEAHG-------ACYQVITDFLELFKKRSSAARNLTERETS 180
           + G +  T     ++   + E            +  +++ +   KK       LT RE  
Sbjct: 124 RRGLLTLTRGHEPISELELKELQYRLTWLTQISHHCMSEIIT-TKKMPETMITLTMREKD 182

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            L+    G TS E +  + ++  TVN ++ ++  KL+ +N+  A  +A   G +
Sbjct: 183 VLRWTAAGKTSGETSTIMNITERTVNFHIANSMQKLNCINKTSATVRAAMLGLL 236


>gi|299529754|ref|ZP_07043189.1| transcriptional regulator, luxR family protein [Comamonas
           testosteroni S44]
 gi|298722272|gb|EFI63194.1| transcriptional regulator, luxR family protein [Comamonas
           testosteroni S44]
          Length = 239

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 43/231 (18%), Positives = 72/231 (31%), Gaps = 9/231 (3%)

Query: 6   LTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIP 65
           L  + + SL  +   +  +   +    F L++ +SA D    +++     ++      + 
Sbjct: 14  LAIEGARSLAAIQDTVRAVGAPLGYDRFVLFSASSARD-DAVERIYWIEGDWFGTGAPVD 72

Query: 66  NILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLP-FAGIAFPVRL 124
                        H      P  W          + G+    +     P   G+  PV  
Sbjct: 73  AE-TYVRHCPVTRHILETNQPFFWT-----KTNGAQGERYSVVRAPQGPGIHGLQVPVFG 126

Query: 125 GFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFK-KRSSAARNLTERETSCLQ 183
                G +    E +  + +  +               L +         L++RE   L 
Sbjct: 127 LLGLEGAMSLGGERIDASPQARLALELIAQTAFRTARRLLELPAQEELGPLSDREREVLA 186

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G    EIA  LGLS  TV  +L     +L      QAI  AIR G I
Sbjct: 187 WTAAGRRQTEIAATLGLSERTVENHLRRIRKRLGVATTAQAIRMAIRNGEI 237


>gi|182375406|emb|CAQ15951.1| vR protein [Pseudomonas fuscovaginae]
          Length = 239

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 42/225 (18%), Positives = 80/225 (35%), Gaps = 10/225 (4%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           +       +   ++   ++        +   +      + N+     D+ +    +  D 
Sbjct: 15  DARTWFQSLVLSVQKLGYSQVLYALKPNKEAQNSTARIMSNFPDAWRDLYDNENYSSIDP 74

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
            + H  S  LPI+W+    +       +             G+  P+     + G +  +
Sbjct: 75  VVSHSFSSSLPILWEDKLYK---TRREKEFAEDARRAGLSHGLTLPIHGPQGQVGMLSLS 131

Query: 136 ------SEFLMLANEVIIEAHGACYQVITDFLELF-KKRSSAARNLTERETSCLQLAGDG 188
                 +E+L +    I  A       +T    LF    SS A +LT RE   L  A   
Sbjct: 132 CAPMPQNEYLQVLQHSIAAASMLRDYAVTSGSSLFLHNSSSTAPHLTPRELEILHWAWAE 191

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGY 233
            T+ EI + L L+  TV  +  +   KL+  +R  A+A+AI+   
Sbjct: 192 KTTWEIGKILSLAEPTVEFHFKNIRRKLNVSSRRLAVARAIQLDL 236


>gi|171320496|ref|ZP_02909525.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           MEX-5]
 gi|171094259|gb|EDT39337.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           MEX-5]
          Length = 234

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 39/215 (18%), Positives = 67/215 (31%), Gaps = 9/215 (4%)

Query: 24  IQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSG 83
           + +   A      T      FP   + I  + N  +   +          D         
Sbjct: 25  LTHAASALGLEYATYAMRRPFPICNRQIVMVSNCPVRWRERYIDAQFINIDPVFKAAIGS 84

Query: 84  LLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLAN 143
             P++W +        +S               G +   R      G +  +     +  
Sbjct: 85  DEPVVWSA-----QHGASRSRFWDEALSFGIAHGWSSVSRGADGTLGILTLSRSSDPIEP 139

Query: 144 EVIIEAHGACYQVITDFLELFKKRSSAARN----LTERETSCLQLAGDGYTSEEIAEKLG 199
              I      + +             A       LT+RET  L+   DG T+ EI+  L 
Sbjct: 140 AEKILNQSTVHWLAHAAHLAMAPFLPAGDEFDPTLTQRETDVLKWTADGKTAYEISLILS 199

Query: 200 LSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +S  TVN ++ +   KL   N++ A+AKA   G +
Sbjct: 200 ISESTVNFHVKNIVAKLGTANKVHAVAKAALMGML 234


>gi|260777849|ref|ZP_05886742.1| transcriptional activator protein luxR [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260605862|gb|EEX32147.1| transcriptional activator protein luxR [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 240

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 92/231 (39%), Gaps = 11/231 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           +   S++ +   L  + + + +     + +  + D   +      + N+  D  +    L
Sbjct: 12  QTIDSIESMGRLLEQLNHIVNSE---YFVLGVSFDPHIKNGRFIVVDNFPADCREDSCNL 68

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
              Y D       S  +P +W    ++  I S    S  L        GI+ P+     +
Sbjct: 69  GLMYVDPICKFGASNCMPSVW-ESSKQIDIHSQELFS--LSHIQGIEQGISIPIHGLNGE 125

Query: 129 NGYVIFTSEFL---MLANEVIIEAHGACYQVITDFLELFKKRSSAARN--LTERETSCLQ 183
            G + F +  +       +V++ A      ++ +   L     +      LT RE  CL 
Sbjct: 126 VGMLSFATSDVIAYPTHTDVLLFAQLIVPLIVQNLSRLSHASQTEHSQAMLTNREIQCLT 185

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A DG ++ EIA+ +  +  TV  +L +A  KL A NR QA+ +A+  G+I
Sbjct: 186 WAADGKSASEIADIVDCTERTVKFHLSNACKKLGATNRCQAVTRALLGGHI 236


>gi|209518837|ref|ZP_03267650.1| transcriptional regulator, LuxR family [Burkholderia sp. H160]
 gi|209500722|gb|EEA00765.1| transcriptional regulator, LuxR family [Burkholderia sp. H160]
          Length = 269

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 37/231 (16%), Positives = 69/231 (29%), Gaps = 13/231 (5%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           +++  E    +  +          +  +                  Y        +    
Sbjct: 42  AANEAEWFGVITGLSETWGFDRILVAMLPRPTMRLE---DAYLRSTYAPAWRQAYDEQGM 98

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
            + D  + H  S   P+IW     E     + Q            AG+  P+     + G
Sbjct: 99  VHFDPTVAHCLSRSGPLIWT---PEIFATPAQQSLYEEARSYGLGAGVTLPIHGPNQEAG 155

Query: 131 YVIFTSEFLMLA-NEVIIEAHGACYQVITDFL------ELFKKRSSAARNLTERETSCLQ 183
            + F ++          + A      ++ D +       L     +    LT RE  CL+
Sbjct: 156 MMCFVNDDKPSDGFRRHVNAALPNLVLLRDLVIDTSRQHLNSHAQTLLPKLTPRERECLK 215

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G ++ EI+  L  S   VN ++ +   K    +R  A   A + G I
Sbjct: 216 WTARGKSTWEISHILSCSEAVVNFHMKNIRTKFGVNSRRAAAVIAAQLGLI 266


>gi|86361169|ref|YP_473056.1| LuxR family transcriptional regulator [Rhizobium etli CFN 42]
 gi|86285271|gb|ABC94329.1| transcriptional regulator (activator) protein, LuxR family
           [Rhizobium etli CFN 42]
          Length = 241

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 41/233 (17%), Positives = 83/233 (35%), Gaps = 11/233 (4%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNI 67
              S +LQ+L   L  +++     +  L+ +  +        L+     Y  +       
Sbjct: 14  ISASPTLQDLETALDEVRHIYAISHMVLH-VTRSSGATVSNPLLML--TYPPEWVKQYRD 70

Query: 68  LIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
                 D  +     G LP+ W + + ++    +           +   G+  PVR    
Sbjct: 71  RDYFSIDPVVRLGRRGFLPVEWSASKWDS--GRAYGFFKEAMAFGVGRQGVTLPVRGPQG 128

Query: 128 KNGYVIFTSEFLMLANEV-----IIEAHGACYQVITDFLELFK-KRSSAARNLTERETSC 181
           +      TS              + +     + +    + L   +  +   +L+ RE  C
Sbjct: 129 ERSLFTVTSNHPDAYWRQFRMDCMRDLQFLAHHLHDRAMVLAGMREIADVAHLSRRELQC 188

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           L++   G+ +++I+ +L +S+  V  YL SA  KL      +A+AKA     I
Sbjct: 189 LEMTASGFLAKQISARLCISISAVQLYLASARRKLTVATTSEAVAKATALELI 241


>gi|66047443|ref|YP_237284.1| regulatory protein, LuxR [Pseudomonas syringae pv. syringae B728a]
 gi|63258150|gb|AAY39246.1| regulatory protein, LuxR [Pseudomonas syringae pv. syringae B728a]
          Length = 254

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 51/248 (20%), Positives = 93/248 (37%), Gaps = 14/248 (5%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARN--FALYTINSALDFPRRQQLICELHNYD 58
           +S+     + +S+L +      L+ + +      +    +  + D       +  L N  
Sbjct: 5   LSDFNSRLQSASTLDQQMDCALLLASDLGFDAVIYDYSPVPVSHDGALITPSLLSLRNTP 64

Query: 59  LDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEE-----TVIESSGQLSVRLEGGLL 113
            D   +         D       + + P +W  +        T I    +  VR      
Sbjct: 65  ADWHALWCSQGYYQIDPVQHLAVASVSPFVWSYLPRAETVLKTFITDMHKPVVRYLHDSH 124

Query: 114 PFAGIAFPVRLGFHKNGYVI-FTSEFLMLA----NEVIIEAHGACYQVITDFLELFKK-- 166
              G+  P+ +       +    ++   +A     + + E     +        LF +  
Sbjct: 125 MTCGVTVPIHMPKGGFATLTGLCTDGSDVALEDARQSLAEFGLLAHAFQEVAYPLFDQKI 184

Query: 167 RSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIA 226
           RS  A  LT RE  CL  + +G T+ EIA++L  SV TV  +L SA  KL A NR+QA+ 
Sbjct: 185 RSCNAIRLTPRERECLSWSAEGLTAREIADQLNRSVATVTLHLNSAMQKLGAKNRVQAVV 244

Query: 227 KAIRFGYI 234
           +A+ +  +
Sbjct: 245 RAVHYRLL 252


>gi|193890916|gb|ACF28617.1| quorum sensing regulator [Mesorhizobium tianshanense]
          Length = 275

 Score =  138 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 52/242 (21%), Positives = 74/242 (30%), Gaps = 12/242 (4%)

Query: 1   MSENTLTGKKSSSLQE---LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNY 57
           MS    T ++   L +   +   L  I  R   +  A       LD    +Q       Y
Sbjct: 34  MSGLDATLEEIGQLGDAEKIPALLQRIAERYGLKTVAYLG-TGTLDRRVPRQEPFIAVTY 92

Query: 58  DLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAG 117
             +  +          D  +      LLPI W    +                  L   G
Sbjct: 93  PPEWVERYRARGYINIDPAIQIGLRRLLPIDWDEFGKAEGDLRQ--FFGEASEFGLGLRG 150

Query: 118 IAFPVRLGFHKNGYVIFTSEFLMLANEVIIEAHG-----ACYQVITDFLELFKKRSSAAR 172
           I+FPV            T++F                      +    L        +  
Sbjct: 151 ISFPVHGCGGDRALFSVTADFSKREWHWARRTAFRHFPIIAAHLHEAVLRTD-GVFRSQP 209

Query: 173 NLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFG 232
            L+ RE  CL+   +G T  E    LGLS HTV  YL SA  KL A +   A + A + G
Sbjct: 210 RLSPRELECLRWTSEGKTVWECGVILGLSPHTVRCYLESARHKLGASSNTHAASLATKSG 269

Query: 233 YI 234
            +
Sbjct: 270 LL 271


>gi|206562058|ref|YP_002232821.1| N-acylhomoserine lactone dependent regulatory protein [Burkholderia
           cenocepacia J2315]
 gi|198038098|emb|CAR54046.1| N-acylhomoserine lactone dependent regulatory protein [Burkholderia
           cenocepacia J2315]
          Length = 237

 Score =  138 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 38/209 (18%), Positives = 62/209 (29%), Gaps = 10/209 (4%)

Query: 31  RNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQ 90
             F           P  +  +  + N+  +             D  +    S   P++W 
Sbjct: 33  LGFRYCVYGLRRTLPLARPDMQIVGNHPREWEHRYVKFGYVTIDPIIKRVASQPRPVVWN 92

Query: 91  SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIEAH 150
           +       E                 G +          G +    +   L  + I    
Sbjct: 93  AFD-----EPGDTAFWHDAACFGMRYGWSHGGYDRAGNLGVLTLVRDTTPLDADEISRLR 147

Query: 151 G----ACYQVITDFL-ELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTV 205
                  +      +  L    +     LT RE   L    DG T+ EI    G++  TV
Sbjct: 148 APCASLSHAAHAYLMPRLADPIAPVGTGLTLREREVLAWTADGKTAYEIGMIFGIAERTV 207

Query: 206 NAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             +L +A VKLDA+N+  A  KA   G +
Sbjct: 208 KFHLQNAVVKLDAMNKTHAATKAAMLGLL 236


>gi|85376480|gb|ABC70477.1| acylhomoserine lactone-dependent transcriptional regulator
           [Pseudomonas sp. M18]
          Length = 215

 Score =  138 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 33/208 (15%), Positives = 65/208 (31%), Gaps = 10/208 (4%)

Query: 20  RLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFH 79
              +++  ++   F  Y        P  +        Y     +   +      D  + +
Sbjct: 1   VFAVLEKEVRRLGFDYYAYGVRHTIPFTRPKTEVHGTYPKAWLERYQMQNYGAVDPAILN 60

Query: 80  FNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFL 139
                  ++W     +       ++            G   P+R   +    +    +  
Sbjct: 61  GLRSSEMVVWSDSLFD-----QSRMLWNEARDWGLCVGATLPIRAPNNLLSVLSVARDQQ 115

Query: 140 MLA---NEVIIEAHGACYQVITDFLELFKKRSSAARN--LTERETSCLQLAGDGYTSEEI 194
            ++    E I        +++T  L   +     +    L+ RE   LQ   DG +S EI
Sbjct: 116 NISSFEREEIRLRLRCMIELLTQKLTDLEHPMLMSNPVCLSHREREILQWTADGKSSGEI 175

Query: 195 AEKLGLSVHTVNAYLGSATVKLDAVNRI 222
           A  L +S  TVN +  +   K DA N+ 
Sbjct: 176 AIILSISESTVNFHHKNIQKKFDAPNKT 203


>gi|90420983|ref|ZP_01228887.1| possible transcriptional regulator, lysR family [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90334761|gb|EAS48537.1| possible transcriptional regulator, lysR family [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 294

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 57/219 (26%), Positives = 85/219 (38%), Gaps = 2/219 (0%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
            L+  L  +       + A+ ++ S  D     +L   L N+    G     L       
Sbjct: 77  ALTQLLGDVATDFGFSHAAVLSVPSTDDGGTATRL--LLSNWSESFGQAYEQLGLHRSKL 134

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
            +    +  +P +W         E     + R+       AG  FPV      NG + F 
Sbjct: 135 VVGALKTDPMPFVWDIDTLYGADEPDPSPAARMLMEAEYLAGAFFPVHGLTAFNGALSFA 194

Query: 136 SEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIA 195
                L  E I E H   + +         + +     L+ RE  CL+LA  G TS EI 
Sbjct: 195 GRSCALPAEAIRELHLFAFALFGMLAAARFEENRRNNPLSVRERDCLKLAMLGKTSSEIG 254

Query: 196 EKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L LS +T++ YL +A  KLDA NR  A+A A + GY+
Sbjct: 255 IILSLSEYTISQYLTAAQRKLDASNRTHAVALAAQLGYL 293


>gi|316933442|ref|YP_004108424.1| autoinducer-binding domain-containing protein [Rhodopseudomonas
           palustris DX-1]
 gi|315601156|gb|ADU43691.1| Autoinducer-binding domain protein [Rhodopseudomonas palustris
           DX-1]
          Length = 239

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 36/224 (16%), Positives = 69/224 (30%), Gaps = 4/224 (1%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           + + + ++  L                + S       Q     +  +        +    
Sbjct: 19  APTSEAVADILLASVRSFGFTKVVAGVVPSPQVSAEEQLSNVLMSRWPAAWSRRYSSKGY 78

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
              D  +    S +    W  +   + +  + +  +          G   P+     +  
Sbjct: 79  LTEDPTIQRVRSSIEAFEWSEL---SAVSIAARNIMEEAADFGLNHGFTVPLHTLDGEYA 135

Query: 131 YVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYT 190
            +    +   L                   +   K+  +A+  LT RE   L    +G T
Sbjct: 136 ALSIAGDRCELPASFRGVVQLMATYAFAKAI-GQKRAINASPRLTIREADVLHWIAEGKT 194

Query: 191 SEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             EI++ LG+S H V+        K  AVNR+Q I+ A+R G I
Sbjct: 195 DWEISQILGVSEHLVDKVARQLKDKFGAVNRVQMISCAMRLGVI 238


>gi|270341116|emb|CAQ15948.2| vR protein [Pseudomonas fuscovaginae]
          Length = 239

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 38/226 (16%), Positives = 73/226 (32%), Gaps = 10/226 (4%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           +       +    +   ++        +   +      + N+  D     +    +  D 
Sbjct: 15  DARTWFESLVFSARKLGYSKVLYALKPNKEAQNNAAEIMSNFPDDWRRRYDNENYSIIDP 74

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF- 134
            +FH  S  LPI W+    +T      +             G+  P+     + G +   
Sbjct: 75  TVFHSFSSSLPIPWEDKLYKTQ---KEKEFAEEARWAGLSHGMTLPIHGPQGQVGMLSLS 131

Query: 135 TSEFLMLANEVIIEAHGACYQVITDFL------ELFKKRSSAARNLTERETSCLQLAGDG 188
                    +  ++       ++ D+          +     A +LT RE   L  A   
Sbjct: 132 CDPMSEPEYQKTLKNSLGAATLLRDYAVTSSFNHFQQGSGYTAPHLTPRELEILHWAWAE 191

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            T+ EI + L LS  TV  +  +   KL   +R  A+A+AI+   I
Sbjct: 192 KTTWEIGKILSLSEPTVEFHFKNIRRKLKVTSRRLAVARAIQLDLI 237


>gi|299065227|emb|CBJ36393.1| Transcriptional activator protein solR [Ralstonia solanacearum
           CMR15]
          Length = 236

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 43/229 (18%), Positives = 75/229 (32%), Gaps = 13/229 (5%)

Query: 13  SLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETY 72
           + Q+       I + ++   F        +  P  +  +     Y               
Sbjct: 14  TAQDERQLFRQIASVVRQLGFDYCCYGIRVPLPVSKPAVAIFDTYPAGWMAHYQASGFLE 73

Query: 73  GDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYV 132
            D  +    S    I+W        I                  G+A          G +
Sbjct: 74  VDPTVRAGASSSDLIVWP-----VSIRDEAARLWSDARDFGLNVGVARSSWTAHGAFGLL 128

Query: 133 IFTSEFLMLANEVI-------IEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLA 185
                   L+   +              + +++ FL + K    ++  LT RE   L   
Sbjct: 129 TLARGADPLSAAELEQLSATTNWLANLAHALMSPFL-MPKLVPESSAALTAREREVLCWT 187

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           G+G T+ EI + L +S  TVN ++ +  +KL A N++QA+ KAI  G I
Sbjct: 188 GEGKTAYEIGQILRISERTVNFHVNNVLLKLAATNKVQAVVKAIAIGLI 236


>gi|107027317|ref|YP_624828.1| LuxR family transcriptional regulator [Burkholderia cenocepacia AU
           1054]
 gi|116691286|ref|YP_836819.1| LuxR family transcriptional regulator [Burkholderia cenocepacia
           HI2424]
 gi|170736675|ref|YP_001777935.1| LuxR family transcriptional regulator [Burkholderia cenocepacia
           MC0-3]
 gi|105896691|gb|ABF79855.1| transcriptional regulator, LuxR family [Burkholderia cenocepacia AU
           1054]
 gi|116649286|gb|ABK09926.1| transcriptional regulator, LuxR family [Burkholderia cenocepacia
           HI2424]
 gi|169818863|gb|ACA93445.1| transcriptional regulator, LuxR family [Burkholderia cenocepacia
           MC0-3]
          Length = 237

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 38/209 (18%), Positives = 62/209 (29%), Gaps = 10/209 (4%)

Query: 31  RNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQ 90
             F           P  +  +  + N+  +             D  +    S   P++W 
Sbjct: 33  LGFRYCVYGLRRTLPLARPDLQIVGNHPREWEHRYVKFGYVTIDPIIKRVASQPRPVVWN 92

Query: 91  SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIEAH 150
           +       E                 G +          G +    +   L  + I    
Sbjct: 93  AFD-----EPGDTAFWHDAACFGMRYGWSHGGYDRAGNLGVLTLVRDTTPLDADEISRLR 147

Query: 151 G----ACYQVITDFL-ELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTV 205
                  +      +  L    +     LT RE   L    DG T+ EI    G++  TV
Sbjct: 148 APCASLAHAAHAYLMPRLADPIAPVGTGLTLREREVLAWTADGKTAYEIGMIFGIAERTV 207

Query: 206 NAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             +L +A VKLDA+N+  A  KA   G +
Sbjct: 208 KFHLQNAVVKLDAMNKTHAATKAAMLGLL 236


>gi|104781941|ref|YP_608439.1| LuxR family transcriptional regulator [Pseudomonas entomophila L48]
 gi|95110928|emb|CAK15646.1| putative transcriptional regulator, luxR family [Pseudomonas
           entomophila L48]
          Length = 235

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 39/230 (16%), Positives = 75/230 (32%), Gaps = 9/230 (3%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
             +++++L  +   +  +   +    F L++ N+A D    +++     ++  D   +  
Sbjct: 12  QIEQATTLALIQSAVRSVARPLGYDRFVLFSANAARD-EVVERIHWVEGDWFGDGLRVD- 69

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLL-PFAGIAFPVRLG 125
                       H  +   P  W   +        G+    +   +     G+  PV   
Sbjct: 70  AQTYIRHCPVNRHLLTAREPFFWSKRE-----GEGGERYHVVRAPVGTGVHGLQVPVFGP 124

Query: 126 FHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARN-LTERETSCLQL 184
               G +      +  +    +               L +         L+ERE   L  
Sbjct: 125 AGLEGAMSLGGLHIDASPATRMCLALLANAAFHAARRLLEAPVGQEVGVLSERERQVLAW 184

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              G    +IA  LGLSV TV  +L +A  +L      QAI  A+  G +
Sbjct: 185 TAAGQRQADIAATLGLSVRTVENHLRAARRRLGVATTAQAIRIALGSGVL 234


>gi|77463693|ref|YP_353197.1| LuxR family transcriptional regulator [Rhodobacter sphaeroides
           2.4.1]
 gi|126462526|ref|YP_001043640.1| autoinducer-binding domain-containing protein [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221639538|ref|YP_002525800.1| Autoinducer-binding domain-containing protein [Rhodobacter
           sphaeroides KD131]
 gi|332558550|ref|ZP_08412872.1| Autoinducer-binding domain protein [Rhodobacter sphaeroides WS8N]
 gi|2360976|gb|AAC46021.1| autoinducer sythesis regulator [Rhodobacter sphaeroides]
 gi|77388111|gb|ABA79296.1| transcriptional regulator, LuxR family [Rhodobacter sphaeroides
           2.4.1]
 gi|126104190|gb|ABN76868.1| Autoinducer-binding domain protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|221160319|gb|ACM01299.1| Autoinducer-binding domain protein [Rhodobacter sphaeroides KD131]
 gi|332276262|gb|EGJ21577.1| Autoinducer-binding domain protein [Rhodobacter sphaeroides WS8N]
          Length = 233

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 46/230 (20%), Positives = 77/230 (33%), Gaps = 12/230 (5%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           S+   + +  L  I    +   F   +  +          +    NY             
Sbjct: 7   STVATDDASFLDYIDQLCQKLGFDYASYATTSPMTGA---VQGYANYPDSWKMHYMRRNL 63

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
              D  +      + P+ W   +     E    +    E   +   G+  PVR  +   G
Sbjct: 64  HRVDPTIHKSALSIAPVDWSRFE---RDERFRAVFFAAEDFGITPQGLTVPVRGPYGDRG 120

Query: 131 YVIFTSEFLMLANE-----VIIEAHGACYQVITDFLELFK-KRSSAARNLTERETSCLQL 184
            +  T        E     VI E   A   +    +      R+     L+ RE   LQ 
Sbjct: 121 LLSVTRNCARPEWEKHKRAVIGELQVAAVHLHDAVMRSDVISRALRQPRLSTREIEVLQW 180

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           A  G +  +I + LG+S  TV  +L SA  KL  ++ +QA+ +AI  G +
Sbjct: 181 AAAGKSQTDIGDILGISHRTVEVHLRSAREKLGTLSTVQAVGRAIGLGLV 230


>gi|264678731|ref|YP_003278638.1| transcriptional regulator, luxR family [Comamonas testosteroni
           CNB-2]
 gi|262209244|gb|ACY33342.1| transcriptional regulator, luxR family [Comamonas testosteroni
           CNB-2]
          Length = 239

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 43/231 (18%), Positives = 72/231 (31%), Gaps = 9/231 (3%)

Query: 6   LTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIP 65
           L  + + SL  +   +  +   +    F L++ +SA D    +++     ++      + 
Sbjct: 14  LAIEGARSLAAIQDTVRAVGAPLGYDRFVLFSASSARD-DAVERIYWIEGDWFGTGAPVD 72

Query: 66  NILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLP-FAGIAFPVRL 124
                        H      P  W          + G+    +     P   G+  PV  
Sbjct: 73  AE-TYVRHCPVTRHILETNQPFFWT-----KTNGAQGERYSVVRAPQGPGIHGLQVPVFG 126

Query: 125 GFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFK-KRSSAARNLTERETSCLQ 183
                G +    E +  + +  +               L +         L++RE   L 
Sbjct: 127 LLGLEGAMSLGGERIDASPQARLALELIAQIAFRTARRLLELPAQEELGPLSDREREVLA 186

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G    EIA  LGLS  TV  +L     +L      QAI  AIR G I
Sbjct: 187 WTAAGRRQTEIAATLGLSERTVENHLRRIRKRLGVATTAQAIRVAIRNGEI 237


>gi|17548004|ref|NP_521406.1| transcriptional activator SOLR transcription regulator protein
           [Ralstonia solanacearum GMI1000]
 gi|20140008|sp|P58590|SOLR1_RALSO RecName: Full=Transcriptional activator protein solR
 gi|17430310|emb|CAD17075.1| transcriptional activator solr. transcription regulator protein
           [Ralstonia solanacearum GMI1000]
          Length = 236

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 44/229 (19%), Positives = 75/229 (32%), Gaps = 13/229 (5%)

Query: 13  SLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETY 72
           + Q+       I + ++   F        +  P  +  +     Y     +         
Sbjct: 14  TAQDERQLFRQIASVVRQLGFDYCCYGIRVPLPVSKPAVAIFDTYPAGWMEHYQASGFLE 73

Query: 73  GDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYV 132
            D  +    S    IIW        I                  G+A          G +
Sbjct: 74  IDPTVRTGASSSDLIIWP-----VSIRDEAARLWSDARDFGLNIGVARSSWTAHGAFGLL 128

Query: 133 IFTSEFLMLANEVI-------IEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLA 185
                   L    +              + +++ FL + K    ++  LT RE   L   
Sbjct: 129 TLARRADPLTAAELEQLSATTNWLANLAHALMSPFL-MPKLVPESSAALTAREREVLCWT 187

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           G+G T+ EI + L +S  TVN ++ +  +KL A N++QA+ KAI  G I
Sbjct: 188 GEGKTAYEIGQILRISERTVNFHVNNVLLKLAATNKVQAVVKAIAIGLI 236


>gi|254249338|ref|ZP_04942658.1| regulatory protein, LuxR [Burkholderia cenocepacia PC184]
 gi|124875839|gb|EAY65829.1| regulatory protein, LuxR [Burkholderia cenocepacia PC184]
          Length = 288

 Score =  138 bits (347), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 38/209 (18%), Positives = 62/209 (29%), Gaps = 10/209 (4%)

Query: 31  RNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQ 90
             F           P  +  +  + N+  +             D  +    S   P++W 
Sbjct: 84  LGFRYCVYGLRRTLPLARPDLQIVGNHPREWEHRYVKFGYVTIDPIIKRVASQPRPVVWN 143

Query: 91  SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIEAH 150
           +       E                 G +          G +    +   L  + I    
Sbjct: 144 AFD-----EPGDTAFWHDAACFGMRYGWSHGGYDRAGNLGVLTLVRDTTPLDADEISRLR 198

Query: 151 G----ACYQVITDFL-ELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTV 205
                  +      +  L    +     LT RE   L    DG T+ EI    G++  TV
Sbjct: 199 APCASLAHAAHAYLMPRLADPIAPVGTGLTLREREVLAWTADGKTAYEIGMIFGIAERTV 258

Query: 206 NAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             +L +A VKLDA+N+  A  KA   G +
Sbjct: 259 KFHLQNAVVKLDAMNKTHAATKAAMLGLL 287


>gi|167615994|ref|ZP_02384629.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia thailandensis Bt4]
          Length = 194

 Score =  138 bits (347), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 39/198 (19%), Positives = 60/198 (30%), Gaps = 9/198 (4%)

Query: 41  ALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIES 100
              FP     I  + NY     +          D  +        P+ W +    +    
Sbjct: 2   RRPFPISNPQILMVSNYPDRWQERYIEARFANVDSAVKAALGSDRPVTWSASTNASKSA- 60

Query: 101 SGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIE----AHGACYQV 156
                           G +   R      G +  +     +            H      
Sbjct: 61  ----FWAEALSFGIAHGWSSASRGADGTIGVLSLSRRQDAIDTAEKFRNESIVHWLANVA 116

Query: 157 ITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKL 216
                           +LT RET  L+   DG T+ EIA  L +S  TVN ++ +   KL
Sbjct: 117 HASMAPFLPAADEFDPDLTRRETDVLKWTADGKTAYEIALILSISESTVNFHVKNIVSKL 176

Query: 217 DAVNRIQAIAKAIRFGYI 234
            + N+IQA+AKA   G +
Sbjct: 177 GSTNKIQAVAKAALMGML 194


>gi|152061176|dbj|BAF73632.1| putative transcription factor PsyR [Pseudomonas syringae pv.
           tabaci]
          Length = 232

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 35/223 (15%), Positives = 63/223 (28%), Gaps = 15/223 (6%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           L++L        + I    +A ++         R      L NY                
Sbjct: 16  LRQLIEDFENDLHHIGDFTYAYFSTPKT-----RNVKPVILSNYPDSWLKSYVASNYHLI 70

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
           D  + H    + P  W+  +       +     R        +G  F +         + 
Sbjct: 71  DPIIKHAWHSITPFFWREARNAVQGVETDDFLKRSAK-YQLSSGATFTLHDASGLFAALS 129

Query: 134 FTSEFLMLANEVIIE---------AHGACYQVITDFLELFKKRSSAARNLTERETSCLQL 184
             +       +  I                ++I                L+ RET  L+ 
Sbjct: 130 LCNARQQNDFDQRIREKAADIQMSLIRFHDRLIKTRAPHELFPQPTQCKLSTRETGVLKW 189

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAK 227
              G +  EIAE   +S  TV  ++ + + KL+     QA+ K
Sbjct: 190 VAMGKSYSEIAEIFSISERTVKFHMSNVSSKLEVRTAKQAVYK 232


>gi|327200684|pdb|3QP5|A Chain A, Crystal Structure Of Cvir Bound To Antagonist
           Chlorolactone (Cl)
 gi|327200685|pdb|3QP5|B Chain B, Crystal Structure Of Cvir Bound To Antagonist
           Chlorolactone (Cl)
 gi|327200686|pdb|3QP5|C Chain C, Crystal Structure Of Cvir Bound To Antagonist
           Chlorolactone (Cl)
 gi|327200687|pdb|3QP5|D Chain D, Crystal Structure Of Cvir Bound To Antagonist
           Chlorolactone (Cl)
 gi|288973234|gb|ADC79709.1| CviR transcriptional regulator [Chromobacterium violaceum]
          Length = 265

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 36/224 (16%), Positives = 70/224 (31%), Gaps = 5/224 (2%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
             +  EL   L  + ++  +    L           ++       +Y  D  D       
Sbjct: 34  IETENELKAFLDQVLSQAPSERLLLALGRLNNQNQIQRLERVLNVSYPSDWLDQYMKENY 93

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
              D  L   + G  P++W+         +  +  +         +GI F      +  G
Sbjct: 94  AQHDPILR-IHLGQGPVMWEERFNRAK-GAEEKRFIAEATQNGMGSGITFSAASERNNIG 151

Query: 131 -YVIFTSEFLMLANEVIIEAHGACYQVITDFLELF--KKRSSAARNLTERETSCLQLAGD 187
             +            ++   +     +    + +      S +   L++RE         
Sbjct: 152 SILSIAGREPGRNAALVAMLNCLTPHLHQAAIRVANLPPASPSNMPLSQREYDIFHWMSR 211

Query: 188 GYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRF 231
           G T+ EIA  L +S  TV  ++ +   KL+A NR  AI   +  
Sbjct: 212 GKTNWEIATILDISERTVKFHVANVIRKLNANNRTHAIVLGMHL 255


>gi|166798333|gb|ABY89695.1| transcriptional regulator [Mesorhizobium loti]
          Length = 241

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 39/230 (16%), Positives = 68/230 (29%), Gaps = 13/230 (5%)

Query: 4   NTLTGKKSSSLQ--ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDS 61
            TL  + S S+   +    L           FA  ++               + NY    
Sbjct: 6   ETLLEQLSLSVDEVDFHNALANAAGAFDIPAFAYLSL-----VSDGVTKPRLISNYHSGW 60

Query: 62  GDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFP 121
                       D  +        P  W        I    Q             G+  P
Sbjct: 61  TSHYLRHQYERIDPVIERARCSECPFQWGRGFGHAGISKREQQLFDEAAEFGICCGLTIP 120

Query: 122 VRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKR------SSAARNLT 175
           +         + F ++ L  +   I E +    +++     +  +R      +    +LT
Sbjct: 121 LVDRRGGVAAMTFAADRLDPSFMRIAEQYEQALEIMATCFHIGVRRKLSGGLAVDGVSLT 180

Query: 176 ERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAI 225
            RE  CL+    G ++ EI   LG+   T   +L +A  KL    + QA+
Sbjct: 181 PREYECLEWTAKGKSAWEIGCILGIKERTAAFHLDNAKKKLGVRTKNQAV 230


>gi|330969598|gb|EGH69664.1| regulatory protein, LuxR [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 254

 Score =  137 bits (346), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 51/248 (20%), Positives = 92/248 (37%), Gaps = 14/248 (5%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARN--FALYTINSALDFPRRQQLICELHNYD 58
           +S+     + +S+L +      L+ + +      +    +  + D       +  L N  
Sbjct: 5   LSDFNSRLQSASTLDQQMDCALLLASDLGFDAVIYDYSPVPVSHDGALITPSLLSLRNTP 64

Query: 59  LDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEE-----TVIESSGQLSVRLEGGLL 113
            D   +         D       + + P +W           T I    +  VR      
Sbjct: 65  ADWHALWCSQGYYQIDPVQHLAVASVSPFVWSYQPRAETVLKTFITDMHKPVVRYLHDSH 124

Query: 114 PFAGIAFPVRLGFHKNGYVI-FTSEFLMLA----NEVIIEAHGACYQVITDFLELFKK-- 166
              G+  P+ +       +    ++   +A     + + E     +        LF +  
Sbjct: 125 MTCGVTVPIHMPKGGFATLTGLCTDGSDVALEDARQSLAEFGLLAHAFQEVAYPLFDQKI 184

Query: 167 RSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIA 226
           RS  A  LT RE  CL  + +G T+ EIA++L  SV TV  +L SA  KL A NR+QA+ 
Sbjct: 185 RSCNAIRLTPRERECLSWSAEGLTAREIADQLNRSVATVTLHLNSAMQKLGAKNRVQAVV 244

Query: 227 KAIRFGYI 234
           +A+ +  +
Sbjct: 245 RAVHYRLL 252


>gi|300702552|ref|YP_003744152.1| transcriptional activator protein solr [Ralstonia solanacearum
           CFBP2957]
 gi|299070213|emb|CBJ41504.1| Transcriptional activator protein solR [Ralstonia solanacearum
           CFBP2957]
          Length = 236

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 41/229 (17%), Positives = 69/229 (30%), Gaps = 11/229 (4%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
            + ++       + +  +   F      + +  P  +  +     Y              
Sbjct: 13  RTAEDEHQLFREVASIARQLGFDYCCYGARMPLPVSKPAVAIFDTYPAGWMQHYQANGFL 72

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  +    S    I+W     +                     G+A          G 
Sbjct: 73  DIDPTVRAGASSSDLIVWPVSIRDDAA-----RLWSDARDAGLNIGVARSSWTAHGAFGL 127

Query: 132 VIFTSEFLMLANEVI----IEAHGACYQVITDFLELFKKRSSAARN--LTERETSCLQLA 185
           +        L    +    I  H       T        +     N  LT RE   L   
Sbjct: 128 LTLARHADPLTAAELGQLSIATHWLANLAHTLMSPFLVPQLVPESNAVLTAREREVLCWT 187

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           G+G T+ EI + L +S  TVN ++ +  +KL A N++QA+ KAI  G I
Sbjct: 188 GEGKTAYEIGQILRISERTVNFHVNNVLLKLAATNKVQAVVKAIATGLI 236


>gi|163758447|ref|ZP_02165535.1| putative LuxR/GerE family transcriptional regulator [Hoeflea
           phototrophica DFL-43]
 gi|162284736|gb|EDQ35019.1| putative LuxR/GerE family transcriptional regulator [Hoeflea
           phototrophica DFL-43]
          Length = 245

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 53/219 (24%), Positives = 72/219 (32%), Gaps = 2/219 (0%)

Query: 18  SPRLHLIQNRIKARNFALYTINSALDFPRRQ-QLICELHNYDLDSGDIPNILIETYGDDF 76
              L L++   +   +  + I S  D   R       + +   D     +          
Sbjct: 26  FDLLRLLREVTQFHQYTYFFIASGCDGATRSLADSIIITSAPSDLVRRYDETGLMERSPL 85

Query: 77  LFHFNSGLLPIIWQ-SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
           +        P+  +                               PV    H    V F 
Sbjct: 86  MRALGGRGTPLQCRLDETITAFTTEQQAALDDFSAEFNIDCCFITPVYHRDHGPAAVCFL 145

Query: 136 SEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIA 195
            +   ++                    +  + S A   LTERE  CL     G TS EIA
Sbjct: 146 GKRNQMSFSEAANLAMISSLAHQKLRRVSAQPSKADSPLTERERECLVWTSSGKTSVEIA 205

Query: 196 EKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L LS HTVN YL +A  KLDAVNR QA+A AIR G+I
Sbjct: 206 RILSLSEHTVNHYLNNAARKLDAVNRTQAVALAIRQGFI 244


>gi|9297032|sp|O30919|SOLR2_RALSO RecName: Full=Transcriptional activator protein solR
 gi|2444467|gb|AAC45947.1| SolR [Ralstonia solanacearum]
          Length = 236

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 43/232 (18%), Positives = 71/232 (30%), Gaps = 14/232 (6%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           + +    +L   +  I  ++    F      + +  P  +  +     Y           
Sbjct: 13  RTAEDEHQLFREIAAIARQL---GFDYCCYGARMPLPVSKPAVAIFDTYPAGWMQHYQAS 69

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +    S    I+W     +                     G+A         
Sbjct: 70  GFLDIDPTVRAGASSSDLIVWPVSIRDDAA-----RLWSDARDAGLNIGVARSSWTAHGA 124

Query: 129 NGYVIFTSEFLMLANEVI----IEAHGACYQVITDFLELFKKRSSAARN--LTERETSCL 182
            G +        L    +    I  H       T        +     N  LT RE   L
Sbjct: 125 FGLLTLARHADPLTAAELGQLSIATHWLANLAHTLMSPFLVPQLVPESNAVLTTREREVL 184

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              G+G T+ EI + L +S  TVN ++ +  +KL A N++QA+ KAI  G I
Sbjct: 185 CWTGEGKTAYEIGQILRISERTVNFHVNNVLLKLAATNKVQAVVKAIATGLI 236


>gi|328542134|ref|YP_004302243.1| LuxR family transcriptional regulator [polymorphum gilvum
           SL003B-26A1]
 gi|326411884|gb|ADZ68947.1| LuxR family transcriptional regulator [Polymorphum gilvum
           SL003B-26A1]
          Length = 217

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 40/218 (18%), Positives = 69/218 (31%), Gaps = 10/218 (4%)

Query: 24  IQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSG 83
           +   +  R +A   +  A   P  +     L  +     D          D  +      
Sbjct: 1   MLAELGFREWAY-QVIRAEALPDEKP--VILTTFSDAWRDHYIDSSYHLIDPVILKGPER 57

Query: 84  LLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLAN 143
           LLP  W S+          +             G+  PV   +     +   +E      
Sbjct: 58  LLPFTWSSMSFGIEPTDEQKSFFAEAEEFGLGEGLGIPVHGAYGSLAMISMVAEEETRRL 117

Query: 144 EVII-----EAHGACYQVITDFLELFK--KRSSAARNLTERETSCLQLAGDGYTSEEIAE 196
             ++     + H           EL    +   +  +L+ RE  CL    +G T  EI+ 
Sbjct: 118 ARMLHHHGEDVHLISLIFHNLARELMALGRCGRSPISLSPRERECLIWLANGKTRWEISL 177

Query: 197 KLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            LG+S  TV  +  +   K    +R + I +A+R G I
Sbjct: 178 ILGISEETVKYHFKNIRAKFGTYSRHEIIIQAVRLGLI 215


>gi|152989200|ref|YP_001349253.1| transcriptional regulator LasR [Pseudomonas aeruginosa PA7]
 gi|150964358|gb|ABR86383.1| transcriptional regulator LasR [Pseudomonas aeruginosa PA7]
          Length = 239

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 44/246 (17%), Positives = 75/246 (30%), Gaps = 23/246 (9%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLD 60
           + +  L  ++SS   E S  L  + + +                 +  +    + NY   
Sbjct: 3   LVDGFLELERSSGKLEWSAILQKMASDLGFSKILF---GLLPKDSQDYENAFIVGNYPAA 59

Query: 61  SGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAF 120
             +  +       D  + H    +LPI W   +                       G+  
Sbjct: 60  WREHYDKAGYARVDPTVSHCTQSVLPIFW---EPSIYQTRKQHEFFEEASAAGLVYGLTM 116

Query: 121 PVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLEL------------FKKRS 168
           P+     + G +  +     +  E   EA+     V+     L            F+   
Sbjct: 117 PLHGARGELGALSLS-----VEAESRAEANRFMESVLPTLWMLKDYALQSGAGLAFEHPV 171

Query: 169 SAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKA 228
           +    LT RE   LQ    G TS EI+     S   VN ++G+   K    +R  A   A
Sbjct: 172 NKPVVLTSREKEVLQWCAIGKTSWEISVICNCSEANVNFHMGNIRRKFGVTSRRVAAIMA 231

Query: 229 IRFGYI 234
           +  G I
Sbjct: 232 VNLGLI 237


>gi|90423713|ref|YP_532083.1| LuxR family transcriptional regulator [Rhodopseudomonas palustris
           BisB18]
 gi|90105727|gb|ABD87764.1| transcriptional regulator, LuxR family [Rhodopseudomonas palustris
           BisB18]
          Length = 240

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 52/234 (22%), Positives = 82/234 (35%), Gaps = 11/234 (4%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
           T  +++S+ +L+  L   +N     +   +  +        Q     L  YD        
Sbjct: 9   TIDRANSVDDLARTLVDWRNESGVAHLVYHATHVPGC---EQPNPVLLLTYDDAWVKRYV 65

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                  D  +      +LPI W S++  T            E   +   G   P+R   
Sbjct: 66  EQDYFGIDPVVVAGRDAVLPIDWMSVEHATPQARQ--FFAEAESYGVGRHGFTLPIRGPA 123

Query: 127 HKNGYVIFTSEFLMLANEV-----IIEAHGACYQVITDFLELFKKRSS-AARNLTERETS 180
            +      T+              + + H   + +    + L   R   A R L+ RE  
Sbjct: 124 AERALFTITTNATDDHWHRWRFSYLKDFHLLAHYLHDRAMRLAGLRLDHAMRPLSRREQQ 183

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           CLQ    G T  +IA  L LS   V+ YL +A  KL+     QAIAKA+R   +
Sbjct: 184 CLQGLVHGRTPGQIAGDLELSASAVHGYLRTARRKLNCATHEQAIAKAVRLELL 237


>gi|144900206|emb|CAM77070.1| transcriptional activator protein [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 237

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 45/238 (18%), Positives = 66/238 (27%), Gaps = 14/238 (5%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLD 60
           M+E  L  +  SS Q+    L  +        FA       L+ P           Y  +
Sbjct: 8   MTEELLWVEDISSAQD---SLRRLAKLANVDFFAYGNSRPGLENPYWDA------TYPTE 58

Query: 61  SGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVI-ESSGQLSVRLEGGLLPFAGIA 119
             +        + D  +       LP  W+ +           +L            G  
Sbjct: 59  WMEHYFANRYQFIDPVVLEAQRSHLPFAWRFLLNRPGAMSPEQKLLFAEAAKYGIRDGFT 118

Query: 120 FPVRLGFHKNGYVIFT---SEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTE 176
            P          + F       +     +            T    L +        L+ 
Sbjct: 119 IPFHSDNGCIAAMSFAFRSRAEMEHFANMQPRLKLLALYYHTAIERLLEVEIP-DDELSA 177

Query: 177 RETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            E  CL    DG +  EI+  L      V + L SA  KL A    QA+ KAI  G I
Sbjct: 178 MERQCLTFLADGRSLWEISGLLHRPESDVTSSLRSARDKLGAATTAQAVHKAIAEGLI 235


>gi|59940055|gb|AAX12566.1| LuxR-type transcriptional regulator [Aeromonas sp. 'CDC 2478-85']
          Length = 260

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 46/230 (20%), Positives = 86/230 (37%), Gaps = 7/230 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S+ +      LI        +  Y     +    +++ +   +                
Sbjct: 14  TSVTDGDRLAELISRFTLGMGYDYYRFAVIILMSMQRRKVVLFNQCPDSWVQAYTANHML 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETV-IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             D  +       LP+ W   +E    ++   +  + L        GI+FP+       G
Sbjct: 74  ACDPIIQLARKQTLPLYWNRREERGRFLQEGSRDVMGLAAEFGLRNGISFPLHRAAGGKG 133

Query: 131 YVIF------TSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQL 184
            + F      + + L+ ++ ++       ++     + +  +       LT RET CL L
Sbjct: 134 IMSFIISERASRDLLLESSPLLSWMSNYIFEAAIRIVRVSLREDDPQEALTARETECLFL 193

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           A +G TS EIA  LG++   VN +L   T K  ++NR QAI K +  G +
Sbjct: 194 ATEGKTSGEIACILGITERPVNYHLNQVTRKTGSMNRCQAIIKGVSSGIL 243


>gi|59714108|ref|YP_206883.1| autoinducer-binding transcriptional activator protein LuxR [Vibrio
           fischeri ES114]
 gi|462557|sp|P35327|LUXS_VIBF1 RecName: Full=Transcriptional activator protein luxR
 gi|295436|gb|AAA27542.1| putative [Vibrio fischeri ES114]
 gi|59482356|gb|AAW87995.1| autoinducer-binding transcriptional activator protein LuxR [Vibrio
           fischeri ES114]
          Length = 250

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 46/225 (20%), Positives = 88/225 (39%), Gaps = 11/225 (4%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           +++  L  I   I   +   Y           +  +  + NY        +       D 
Sbjct: 24  DINQCLSEIAKII---HCEYYLFAIIYPHSIIKPDVSIIDNYPEKWRKYYDDAGLLEYDP 80

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
            + +  S   PI W  + E+  I+      ++         G +FP+    +  G + F 
Sbjct: 81  VVDYSKSHHSPINWN-VFEKKTIKKESPNVIKEAQESGLITGFSFPIHTASNGFGMLSFA 139

Query: 136 SEFLMLANEVIIEAH------GACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGY 189
                +  + +   H           ++ ++ ++   R  +   LT+RE  CL  A +G 
Sbjct: 140 HSDKDIYTDSLF-LHASTNVPLMLPSLVDNYQKINTTRKKSDSILTKREKECLAWASEGK 198

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           ++ +I++ LG S  TV  +L +  +KL+  NR Q+I+KAI  G I
Sbjct: 199 STWDISKILGCSERTVTFHLTNTQMKLNTTNRCQSISKAILTGAI 243


>gi|260461687|ref|ZP_05809933.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
 gi|319785241|ref|YP_004144717.1| Autoinducer-binding domain protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|259032328|gb|EEW33593.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
 gi|317171129|gb|ADV14667.1| Autoinducer-binding domain protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 241

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/226 (16%), Positives = 72/226 (31%), Gaps = 10/226 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++ S   +       + +   A +F L+   S        +    + NY          L
Sbjct: 10  EQLSESVDAVDLCETMASAAAALDFPLFAYFSCPS--ASGRKPRLISNYPPSWTSRYMQL 67

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +     G     W        + ++ Q  +          G+   +     +
Sbjct: 68  RYHRHDPVILRGLQGWDTFDWGVDLARQHLPAAQQRILEEAARFGIRCGLTMSMHDHRGR 127

Query: 129 NGYVIFTSEFLMLAN-------EVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSC 181
              +   S+             E  ++     + +      L +        LT RE  C
Sbjct: 128 FAALTLASDQSRPPLLRSLSRYEQALQLVAISFHIFAR-RRLAEDCVVDGVILTPREFEC 186

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAK 227
           L+ A DG ++ +I++ L +S  TV  +L +A  KL      QA+A+
Sbjct: 187 LKWAADGKSAWDISQILSVSKRTVTFHLENAKAKLGVRTINQAVAR 232


>gi|49082134|gb|AAT50467.1| PA1430 [synthetic construct]
          Length = 240

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 45/246 (18%), Positives = 75/246 (30%), Gaps = 23/246 (9%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLD 60
           + +  L  ++SS   E S  L  + + +                 +  +    + NY   
Sbjct: 3   LVDGFLELERSSGKLEWSAILQKMASDLGFSKILF---GLLPKDSQDYENAFIVGNYPAA 59

Query: 61  SGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAF 120
             +  +       D  + H    +LPI W   +                       G+  
Sbjct: 60  WREHYDRAGYARVDPTVSHCTQSVLPIFW---EPSIYQTRKQHEFFEEASAAGLVYGLTM 116

Query: 121 PVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLEL------------FKKRS 168
           P+     + G +  +     +  E   EA+     V+     L            F+   
Sbjct: 117 PLHGARGELGALSLS-----VEAENRAEANRFMESVLPTLWMLKDYALQSGAGLAFEHPV 171

Query: 169 SAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKA 228
           S    LT RE   LQ    G TS EI+     S   VN ++G+   K    +R  A   A
Sbjct: 172 SKPVVLTSREKEVLQWCAIGKTSWEISVICNCSEANVNFHMGNIRRKFGVTSRRVAAIMA 231

Query: 229 IRFGYI 234
           +  G I
Sbjct: 232 VNLGLI 237


>gi|330992245|ref|ZP_08316193.1| Putative HTH-type transcriptional regulator y4qH [Gluconacetobacter
           sp. SXCC-1]
 gi|329760444|gb|EGG76940.1| Putative HTH-type transcriptional regulator y4qH [Gluconacetobacter
           sp. SXCC-1]
          Length = 244

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 46/225 (20%), Positives = 72/225 (32%), Gaps = 5/225 (2%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
                +           +       Y++ +       Q+       Y             
Sbjct: 22  IRGAPDHQALAEAFGALVSRLGPHAYSMGTIHKTDPLQRH-LIATTYPDHWMAHYVARNY 80

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
            + D  +     GL P  W+ I  E          +R  G +   +G A P+ L      
Sbjct: 81  HHIDPVIDPLRHGLHPYDWKDIHIEN---RRQDTMLREFGEMGFRSGHAVPLALAPGTLL 137

Query: 131 YVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSS-AARNLTERETSCLQLAGDGY 189
            V   S    +     +    A  Q    + +L +K +      LT RE  CL     G 
Sbjct: 138 LVSIASYDPHIDTRQQMAIQLAASQFHYRYHQLGRKHAGITGTGLTRRERECLTWVAQGK 197

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            + +I   L LS +T+  +L +A  KL   NR+QA  KA   G I
Sbjct: 198 DTADIGHILALSDNTIKFHLKNALRKLGCHNRVQAAVKATCLGLI 242


>gi|15596627|ref|NP_250121.1| transcriptional regulator LasR [Pseudomonas aeruginosa PAO1]
 gi|116049375|ref|YP_791822.1| transcriptional regulator LasR [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218892698|ref|YP_002441567.1| transcriptional regulator LasR [Pseudomonas aeruginosa LESB58]
 gi|254234529|ref|ZP_04927852.1| transcriptional regulator LasR [Pseudomonas aeruginosa C3719]
 gi|254239780|ref|ZP_04933102.1| transcriptional regulator LasR [Pseudomonas aeruginosa 2192]
 gi|313106426|ref|ZP_07792658.1| transcriptional regulator LasR [Pseudomonas aeruginosa 39016]
 gi|125980|sp|P25084|LASR_PSEAE RecName: Full=Transcriptional activator protein lasR
 gi|9947379|gb|AAG04819.1|AE004572_7 transcriptional regulator LasR [Pseudomonas aeruginosa PAO1]
 gi|151326|gb|AAA25874.1| transcriptional activator LasR [Pseudomonas aeruginosa PAO1]
 gi|115584596|gb|ABJ10611.1| transcriptional regulator LasR [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126166460|gb|EAZ51971.1| transcriptional regulator LasR [Pseudomonas aeruginosa C3719]
 gi|126193158|gb|EAZ57221.1| transcriptional regulator LasR [Pseudomonas aeruginosa 2192]
 gi|156106986|gb|ABU49653.1| LasR [Pseudomonas sp. M18]
 gi|218772926|emb|CAW28738.1| transcriptional regulator LasR [Pseudomonas aeruginosa LESB58]
 gi|310879160|gb|EFQ37754.1| transcriptional regulator LasR [Pseudomonas aeruginosa 39016]
          Length = 239

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 45/246 (18%), Positives = 75/246 (30%), Gaps = 23/246 (9%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLD 60
           + +  L  ++SS   E S  L  + + +                 +  +    + NY   
Sbjct: 3   LVDGFLELERSSGKLEWSAILQKMASDLGFSKILF---GLLPKDSQDYENAFIVGNYPAA 59

Query: 61  SGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAF 120
             +  +       D  + H    +LPI W   +                       G+  
Sbjct: 60  WREHYDRAGYARVDPTVSHCTQSVLPIFW---EPSIYQTRKQHEFFEEASAAGLVYGLTM 116

Query: 121 PVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLEL------------FKKRS 168
           P+     + G +  +     +  E   EA+     V+     L            F+   
Sbjct: 117 PLHGARGELGALSLS-----VEAENRAEANRFMESVLPTLWMLKDYALQSGAGLAFEHPV 171

Query: 169 SAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKA 228
           S    LT RE   LQ    G TS EI+     S   VN ++G+   K    +R  A   A
Sbjct: 172 SKPVVLTSREKEVLQWCAIGKTSWEISVICNCSEANVNFHMGNIRRKFGVTSRRVAAIMA 231

Query: 229 IRFGYI 234
           +  G I
Sbjct: 232 VNLGLI 237


>gi|308186328|ref|YP_003930459.1| Transcriptional activator protein phzR [Pantoea vagans C9-1]
 gi|308056838|gb|ADO09010.1| Transcriptional activator protein phzR [Pantoea vagans C9-1]
          Length = 240

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 32/216 (14%), Positives = 61/216 (28%), Gaps = 10/216 (4%)

Query: 24  IQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSG 83
           +Q   ++  F  +        P  +  I     Y                D  L      
Sbjct: 30  LQQFTESLGFDYFAFLIQHPVPFTRPRIHLHSTYPKLWVKRYEKQNYYAVDPVLTLCQRP 89

Query: 84  LLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLM--- 140
              + W   Q                      +G +          G +  +S+  +   
Sbjct: 90  GRGMAWSEEQFTDAGN-----LWHEAREYGLQSGFSCSAMAPNRVIGILSISSQQPISVQ 144

Query: 141 -LANEVIIEAHGACYQVITDFLELFKKRSSAAR-NLTERETSCLQLAGDGYTSEEIAEKL 198
               E+ ++ H      +              +   ++RE   L+   +G T+ EI+  L
Sbjct: 145 LRHAELEVKLHLLAELSLDTLERFSDDAMMVLKKAFSQRELEILKWTAEGKTAVEISLIL 204

Query: 199 GLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +S HTVN +  +   + +  N+ Q    A   G I
Sbjct: 205 SISEHTVNFHQKNMQKRFNVSNKTQIACYAAAIGLI 240


>gi|89053644|ref|YP_509095.1| LuxR family transcriptional regulator [Jannaschia sp. CCS1]
 gi|88863193|gb|ABD54070.1| transcriptional regulator, LuxR family [Jannaschia sp. CCS1]
          Length = 243

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/236 (16%), Positives = 73/236 (30%), Gaps = 5/236 (2%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLD 60
           M+      ++  +         ++ + +      + + +         +       +  +
Sbjct: 1   MTSVDAIMEQIRTAPSRRALWQIMLDFMHDEGVVMGSYHFVDADAASVR--VAADGFPEE 58

Query: 61  SGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAF 120
                        D           P  W  IQ+     +     +          G+AF
Sbjct: 59  WICEYLNRKLALIDPIPALAARMSRPFYWHEIQDLIPPSAQTDAYLDRLRASGLGDGLAF 118

Query: 121 PVRLGFHKNGYVI--FTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERE 178
            V     +N YV   F    + L  E I               EL   ++     L+ RE
Sbjct: 119 YVFGPGLRNAYVGLGFGRPVVDLPPEQIFRLQCVAQAGHLRVCELS-DQAPKEAALSPRE 177

Query: 179 TSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              L     G ++  IAE L +S HTV+A++ S   KLD  +R  A  + +  G +
Sbjct: 178 KQVLDWIAKGKSNSVIAEILAMSPHTVDAHVRSIYRKLDVTDRTSAALRGVGSGVL 233


>gi|209809708|ref|YP_002265247.1| transcriptional activator protein LuxR [Aliivibrio salmonicida
           LFI1238]
 gi|208011271|emb|CAQ81712.1| transcriptional activator protein LuxR [Aliivibrio salmonicida
           LFI1238]
          Length = 247

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 45/211 (21%), Positives = 83/211 (39%), Gaps = 6/211 (2%)

Query: 24  IQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSG 83
           +Q   K  +   Y +         +  I  L NY L   +  +       D  + +  S 
Sbjct: 29  LQELTKILHCEYYLLAIISQKTMIKSDIKILDNYPLYWRNYYDEANLIKDDPIVDYSFSH 88

Query: 84  LLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLAN 143
             PI W   +++  + +     +        ++G +FP+       G + F S       
Sbjct: 89  HSPINWSIFEKQKKMSNQIN-VIEEAKISGLYSGFSFPIHTKDGGFGMISFASSQKEKYI 147

Query: 144 EVIIEAH-----GACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKL 198
           + +             +++     + K+       LT+RE  CL  + +G +  EI++ L
Sbjct: 148 DNLFLNACMSVPLILPELLDSNQRITKEDQQVHTKLTKREKECLIWSCEGKSRWEISKIL 207

Query: 199 GLSVHTVNAYLGSATVKLDAVNRIQAIAKAI 229
           G S  TV  +L ++ +KL A NR Q+I+KAI
Sbjct: 208 GCSERTVTFHLANSQLKLGANNRCQSISKAI 238


>gi|119116629|dbj|BAF40892.1| LuxR [Shewanella hanedai]
          Length = 243

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 43/217 (19%), Positives = 77/217 (35%), Gaps = 12/217 (5%)

Query: 24  IQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSG 83
           +       +   Y           +  +  L NY        N       D  + +  S 
Sbjct: 24  LTKLALLLDCEYYLFAILNPVSIFKSDLYILDNYPSCWKKYYNDEKLIDYDPIIDYSASN 83

Query: 84  LLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLAN 143
             PIIW  +++    ++     +         +G +FPV    +  G + F +       
Sbjct: 84  YAPIIWSMLEQSKWDKNKTN-VIEEAKNSNLKSGFSFPVHTKNNSFGVISFANSNNEKT- 141

Query: 144 EVIIEAH--------GACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIA 195
             +I  H            +++     + K   +    LT RE  CL    +G T+ EI+
Sbjct: 142 --LISLHSNSYSYVLLVLPELLDSHQRINKNIGNTCTQLTPREKECLAWISEGKTTWEIS 199

Query: 196 EKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFG 232
           + L  S  TV+ ++ +   KL   NR Q+I+K+I  G
Sbjct: 200 KILDCSERTVSFHITNLQTKLGTNNRSQSISKSILTG 236


>gi|21311443|gb|AAM46724.1|AF452135_9 LuxR2 [Aliivibrio salmonicida]
          Length = 223

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 45/211 (21%), Positives = 83/211 (39%), Gaps = 6/211 (2%)

Query: 24  IQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSG 83
           +Q   K  +   Y +         +  I  L NY L   +  +       D  + +  S 
Sbjct: 5   LQELTKILHCEYYLLAIISQKTMIKSDIKILDNYPLYWRNYYDEANLIKDDPIVDYSFSH 64

Query: 84  LLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLAN 143
             PI W   +++  + +     +        ++G +FP+       G + F S       
Sbjct: 65  HSPINWSIFEKQKKMSNQIN-VIEEAKISGLYSGFSFPIHTKDGGFGMISFASSQKEKYI 123

Query: 144 EVIIEAH-----GACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKL 198
           + +             +++     + K+       LT+RE  CL  + +G +  EI++ L
Sbjct: 124 DNLFLNACMSVPLILPELLDSNQRITKEDQQVHTKLTKREKECLIWSCEGKSRWEISKIL 183

Query: 199 GLSVHTVNAYLGSATVKLDAVNRIQAIAKAI 229
           G S  TV  +L ++ +KL A NR Q+I+KAI
Sbjct: 184 GCSERTVTFHLANSQLKLGANNRCQSISKAI 214


>gi|541657|dbj|BAA06489.1| LasR [Pseudomonas aeruginosa]
          Length = 239

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 45/246 (18%), Positives = 75/246 (30%), Gaps = 23/246 (9%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLD 60
           + +  L  ++SS   E S  L  + + +                 +  +    + NY   
Sbjct: 3   LVDGFLELERSSGKLEWSAILQKMASDLGFSKILF---GLLPKDSQDYENAFIVGNYPAA 59

Query: 61  SGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAF 120
             +  +       D  + H    +LPI W   +                       G+  
Sbjct: 60  WREHYDRAGYARVDPTVSHCTQSVLPIFW---EPSIYQTRKQHEFFEEASAAGLVYGLTM 116

Query: 121 PVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLEL------------FKKRS 168
           P+     + G +  +     +  E   EA+     V+     L            F+   
Sbjct: 117 PLHGARGELGALSLS-----VEAENRAEANRFIESVLPTLWMLKDYALQSGAGLAFEHPV 171

Query: 169 SAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKA 228
           S    LT RE   LQ    G TS EI+     S   VN ++G+   K    +R  A   A
Sbjct: 172 SKPVVLTSREKEVLQWCAIGKTSWEISVICNCSEANVNFHMGNIRRKFGVTSRRVAAIMA 231

Query: 229 IRFGYI 234
           +  G I
Sbjct: 232 VNLGLI 237


>gi|148560233|ref|YP_001258220.1| LuxR family transcriptional regulator [Brucella ovis ATCC 25840]
 gi|148371490|gb|ABQ61469.1| transcriptional regulator, LuxR autoinducer regulated family
           [Brucella ovis ATCC 25840]
          Length = 235

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 45/234 (19%), Positives = 80/234 (34%), Gaps = 17/234 (7%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           + + S  +L   +    + +    F   +   ++              +           
Sbjct: 11  QSADSADQLFEIVKNYAHDL---GFEYVSYVMSIPSLNGSLKWVRFGAFPDGWEQRYLAQ 67

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  L    + + P+IW      +  +                 GI+ P       
Sbjct: 68  NYAEIDPLLRRGVNSIDPLIWSQNFFASAPQ-----IWADAVKYGLKVGISQPCWAAQGV 122

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELF--KKRSSAA------RNLTERETS 180
            G + F      L    I        Q++T+ L L   ++    A       +LT RE  
Sbjct: 123 FGLLSFVRSGPALTPGEISML-RRQLQMVTNLLHLSMYERVDVPAISCIGDVSLTLRERE 181

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            L+   +G T+E I   L +S  TVN ++ +   KL AVN+++A+AKA  FG +
Sbjct: 182 ILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNKVKAVAKARTFGLL 235


>gi|330952863|gb|EGH53123.1| regulatory protein, LuxR [Pseudomonas syringae Cit 7]
          Length = 254

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 51/248 (20%), Positives = 90/248 (36%), Gaps = 14/248 (5%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARN--FALYTINSALDFPRRQQLICELHNYD 58
           +S+     + +S+L +      L+ + +      +    +  + D       +  L N  
Sbjct: 5   LSDFNSRLQSASTLDQQMDCALLLASDLGFDAVIYDYSPVPVSHDGALITPSLLSLRNTP 64

Query: 59  LDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEE-----TVIESSGQLSVRLEGGLL 113
            D   +         D       + + P +W           T I    +  VR      
Sbjct: 65  ADWYALWCSQGYYQIDPVQHLAVASVSPFVWSYQPRAETVLKTFITDMHKPVVRYLHDSH 124

Query: 114 PFAGIAFPVRLGFHKNG---YVIFTSEFLMLA--NEVIIEAHGACYQVITDFLELFKK-- 166
              G+  P+ +          +      + L    + + E     +        LF +  
Sbjct: 125 MTCGVTVPIHMPKGGFATLTGLCADGSDVALEDARQSLAEFGLLAHAFQEVAYPLFDQKI 184

Query: 167 RSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIA 226
           RS  A  LT RE  CL  + +G T+ EIA++L  SV TV  +L SA  KL A NR+QA+ 
Sbjct: 185 RSCNAIRLTPRERECLSWSAEGLTAREIADQLNRSVATVTLHLNSAMQKLGAKNRVQAVV 244

Query: 227 KAIRFGYI 234
           +A+ +  +
Sbjct: 245 RAVHYRLL 252


>gi|197344641|gb|ACH69671.1| LuxR family transcriptional regulator [uncultured proteobacterium]
          Length = 277

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 45/227 (19%), Positives = 84/227 (37%), Gaps = 11/227 (4%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
           ++ +  ++  R    Q   +A  F  +   S +D  +  +    LH+Y  +   + + L 
Sbjct: 15  RAGAPVDVLAR--DFQRCTEALGFRHFACCSHVDPLKPPRRAVMLHSYPKEWAQLFSELE 72

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
               D    H +  L+P  W +      +    Q      G      G   P+       
Sbjct: 73  LFDIDPVFLHASRSLVPFFWDTEAFNDELSPPQQELFNEAGRYGLTRGYTVPIH--SVDA 130

Query: 130 GYVIFTSEFLMLANEVIIEAHGACYQVITDFL-------ELFKKRSSAARNLTERETSCL 182
                 S  ++  +E +  A     Q++  +L          K      + L+ RE  CL
Sbjct: 131 PRDFRASCSVVPDSESLEPAAYQAVQLMAFYLYDTASKDAQQKDPPPVQQPLSRRERQCL 190

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAI 229
           +LA  G +    +  LGLS  TV+ ++ +A  +L    R+QA+  A+
Sbjct: 191 ELAAQGKSDWVSSRILGLSERTVHNHVENAKRRLQVATRMQAVMHAL 237


>gi|260433332|ref|ZP_05787303.1| autoinducer-binding domain protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417160|gb|EEX10419.1| autoinducer-binding domain protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 230

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/217 (18%), Positives = 74/217 (34%), Gaps = 14/217 (6%)

Query: 24  IQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSG 83
           I +      F   +  +       +  +    NY  +           + D  L+     
Sbjct: 15  INSVCNELGFDYASYATTHPV---KGDVQGYANYPDEWKLHYGSQGYHHLDPTLYQAALS 71

Query: 84  LLPIIWQSIQEETVIESSGQLSVRLEGGLLPFA-GIAFPVRLGFHKNGYVIFTSEFLMLA 142
           + P+ W     +    +      R          G+  PVR  + + G +  T +     
Sbjct: 72  IAPVDWSRFNHDEKFNA----VFRDAHDFGITDRGLTVPVRGPYGECGMLSVTKDCSDTE 127

Query: 143 N-----EVIIEAHGACYQVITDFLELF-KKRSSAARNLTERETSCLQLAGDGYTSEEIAE 196
                  V+ +   A  Q     ++     ++    +L+ RE   LQ   +G + ++I +
Sbjct: 128 WKKLKRHVMGDLQMAAVQAHDTVMQSGVLAKALYLPSLSRREREILQWVAEGKSQQDIGD 187

Query: 197 KLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGY 233
            L +S  TV  +L S   KL A+   QAI +AI  G 
Sbjct: 188 ILSISHRTVEVHLRSGREKLGALTTAQAIGRAIGLGL 224


>gi|254511024|ref|ZP_05123091.1| autoinducer-binding transcriptional regulator LuxR
           [Rhodobacteraceae bacterium KLH11]
 gi|221534735|gb|EEE37723.1| autoinducer-binding transcriptional regulator LuxR
           [Rhodobacteraceae bacterium KLH11]
          Length = 233

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 43/222 (19%), Positives = 79/222 (35%), Gaps = 15/222 (6%)

Query: 19  PRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLF 78
             L  + ++ +  + A   +N A         I     Y  D  +          D  L 
Sbjct: 18  EFLRQVCDKYEMDHAAYAGMNPAAG------TIHGHVTYGDDWKNHYQEQGLHLIDPTLH 71

Query: 79  HFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEF 138
                + P+ W  ++     +   ++        +P  GI  PVR  +   G +  T   
Sbjct: 72  MSQRSIAPVDWSRLE---RGKDFQRVFRDAHDFGIPDQGITIPVRGPYGDIGLLSATRGC 128

Query: 139 LMLANEVII-----EAHGACYQVITDFLELFK-KRSSAARNLTERETSCLQLAGDGYTSE 192
                + ++     +       +  + +      R      L+ RE   LQ A  G + +
Sbjct: 129 SRDEWKKLVPNVIKDLQSLAVHIHDNVMTSDTISRMLYHPTLSSRELEILQWAAAGKSQQ 188

Query: 193 EIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +I + L +S  TV  +L S+  KL+A+   QA+ +AI  G I
Sbjct: 189 DIGDILSISHRTVEVHLRSSREKLNALTTPQAVGRAIGIGLI 230


>gi|320325287|gb|EFW81354.1| autoinducer transcriptional regulator AhlR [Pseudomonas syringae
           pv. glycinea str. B076]
          Length = 189

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 33/190 (17%), Positives = 57/190 (30%), Gaps = 10/190 (5%)

Query: 54  LHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLL 113
           + NY                D  + H    + P  W+  +       +     R      
Sbjct: 1   MSNYPDSWLKSYVASNYHLIDPIIKHAWHSITPFFWREARNAVQGVETDDFLKRSAK-YQ 59

Query: 114 PFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIE---------AHGACYQVITDFLELF 164
             +G  F +         +   +       +  I                ++I       
Sbjct: 60  LSSGATFTLHDASGLFAALSLCNARQQNDFDQRIREKAADIQMSLIRFHDRLIKTRAPHE 119

Query: 165 KKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQA 224
                A   L+ RET  L+    G +  EIAE   +S  TV  ++ + + KL+     QA
Sbjct: 120 LFPQPAQCKLSTRETGVLKWVAMGKSYSEIAEIFSISERTVKFHMSNVSSKLEVRTAKQA 179

Query: 225 IAKAIRFGYI 234
           + KAI  G +
Sbjct: 180 VYKAINIGMV 189


>gi|255608035|ref|XP_002538833.1| Transcriptional activator protein ahyR/asaR, putative [Ricinus
           communis]
 gi|223510221|gb|EEF23550.1| Transcriptional activator protein ahyR/asaR, putative [Ricinus
           communis]
          Length = 234

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/227 (16%), Positives = 73/227 (32%), Gaps = 5/227 (2%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           +  +++  +         RI A  +      + L   +  +      ++  D  ++    
Sbjct: 10  EACATIDAVKALFK---RRIAAHGYTASACGAFLPADKGPEPHFFFQDWPPDWLELYVNR 66

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +      + P  W+  + E  +  + Q             G++ P+      
Sbjct: 67  NFVAADYGVAEARRRIAPFTWREAKAERTLSRAEQDIWDTVVEWGWTDGLSVPIHGPGGY 126

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELF--KKRSSAARNLTERETSCLQLAG 186
              V    +   +   +  +     +        L      +     LT RE  CL+   
Sbjct: 127 FAIVTMAGKEQPMPPALRGKLQQLAFLTHERCRALTGLAPVTDPQATLTHRELECLRWVA 186

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGY 233
            G T  +IA  LG+S  T   ++  A  KL A  R QA+A+ +  G 
Sbjct: 187 AGKTDLQIARLLGVSQTTARTHIDQARRKLGARTRSQAVARLVLSGL 233


>gi|26991331|ref|NP_746756.1| LuxR family transcriptional regulator [Pseudomonas putida KT2440]
 gi|24986392|gb|AAN70220.1|AE016661_6 transcriptional regulator, LuxR family [Pseudomonas putida KT2440]
          Length = 279

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 35/223 (15%), Positives = 69/223 (30%), Gaps = 13/223 (5%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDF 76
           L      +   +         +N  +    +   +    NY  +  +          D  
Sbjct: 65  LFDIAVHLAQDLD---MDYLGLNIRIQIATQTPRLYLYSNYPSEWIERYQRDDFYKQDPA 121

Query: 77  LFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTS 136
               +S  +P++W     +   +        +        G    +    H    +    
Sbjct: 122 ANLSHSSTMPVLWTDELYKEAPQ-----FREMACLYGLRHGWTQSLHDQQHNESQISVAR 176

Query: 137 EFLMLANEVIIE----AHGACYQVITDFLELFKKRS-SAARNLTERETSCLQLAGDGYTS 191
               +    + +        C+ +     E            ++ERE   L+ +  G T+
Sbjct: 177 PNGPIDEVELYDKAGSVQWLCHTLHAVLGEHHLNALCPPQPKMSERELEVLKWSAAGKTA 236

Query: 192 EEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            ++A  L LS  TVN ++ S   K +A N+  AIA A   G+I
Sbjct: 237 ADVASILSLSQSTVNFHIRSVITKTNAANKAGAIAIAALRGWI 279


>gi|327190710|gb|EGE57792.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli CNPAF512]
          Length = 240

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 41/223 (18%), Positives = 68/223 (30%), Gaps = 4/223 (1%)

Query: 13  SLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETY 72
           +  E+   +  +   +    F + T+ +          I  + N+  +  D  +      
Sbjct: 19  THYEVFKFMKGLTQDLGMTAFLIMTLPTVDFVEIGATKI--ITNWPAEMVDYYDAHNLMV 76

Query: 73  GDDFLFHFNSGLLPIIWQ-SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
               +        P  +          E      + L        G  FPV       G 
Sbjct: 77  DSPVIRRMLRSTSPFNYDVEAINTDRGEGKKSTVIDLFRRYGMEKGAYFPVHDAAGGRGA 136

Query: 132 VIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTS 191
           +  +        E+          +     +L           T  E  CL+L   G  S
Sbjct: 137 MSISGSRNFTMLEMAKIL-FIATLIYDRLSQLTLNEKHKPIAFTSSELDCLRLTAGGRKS 195

Query: 192 EEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            EIA+ L LS + VN ++GS   KL    R QA+  A+R   I
Sbjct: 196 SEIAKLLDLSENAVNNHIGSVIKKLGCTTRTQAVVSALRLNII 238


>gi|56697147|ref|YP_167510.1| autoinducer-binding transcriptional regulator LuxR [Ruegeria
           pomeroyi DSS-3]
 gi|56678884|gb|AAV95550.1| autoinducer-binding transcriptional regulator LuxR [Ruegeria
           pomeroyi DSS-3]
          Length = 233

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 39/222 (17%), Positives = 76/222 (34%), Gaps = 15/222 (6%)

Query: 19  PRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLF 78
             L  ++ +++  + A   +N A         I     Y  +             D  L 
Sbjct: 18  DFLLQVREKLEMDHAAYAGLNPAAGA------IHGYVTYSDEWKLHYQEQGFHMIDPTLH 71

Query: 79  HFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEF 138
                + P+ W  ++         ++        +   G+  PVR  +   G +  T E 
Sbjct: 72  MSQRSIAPVDWSRLE---RSNDFRRVFRDAHDFGIGDQGLTIPVRGPYGDVGLLSVTREC 128

Query: 139 LMLANEVII-----EAHGACYQVITDFLELF-KKRSSAARNLTERETSCLQLAGDGYTSE 192
                + ++     +       +    +      R     +L+ RE   LQ    G + +
Sbjct: 129 STEEWQKLVRHVIGDLQSLAVHIHDTVMSSDMLGRILYHPSLSTREVEILQWVAAGKSQQ 188

Query: 193 EIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +I + L +S  TV  +L S+  KL A+   QA+ +A+  G I
Sbjct: 189 DIGDILSISHRTVEVHLRSSREKLCALTTAQAVGRAVGLGLI 230


>gi|28558836|ref|NP_788096.1| putative transcriptional regulator [Ruegeria sp. PR1b]
 gi|22726387|gb|AAN05182.1| RC109 [Ruegeria sp. PR1b]
          Length = 258

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 50/249 (20%), Positives = 80/249 (32%), Gaps = 18/249 (7%)

Query: 1   MSENTLTGKKSS-SLQELSPRLHLIQNRIK--ARNF-ALYTINSALDFPRRQQLIC---- 52
           M  N ++  + S ++ E   R   ++      A         +     P+ +        
Sbjct: 8   MKCNNVSASRISCAISEKFSRFSSLKEVSDFLASGLGDYGISDVTYYTPKSKVKGGGAGR 67

Query: 53  ELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGL 112
            +  Y  D  D    +     D  +        PI W  +++                  
Sbjct: 68  LITTYSQDWQDHYFEMSYQDKDPVIEMGQQSFCPIDWSILKDRCGDTKK---MFGEAREF 124

Query: 113 LPFA-GIAFPVRLGFHKNGYVIFTSEFLMLANEVIIEAH-----GACYQVITDFLELFKK 166
                G+  P+R    +   +  TS+         + AH        + +    L L   
Sbjct: 125 GVSDRGVVIPMRGHLGEITLISMTSDLGGSEWVKYLSAHKSEFVNFAFCLHGSILSLSAN 184

Query: 167 RSSAARN-LTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAI 225
                   LT RE   LQ A  G TS E A  L LS  T+  Y+G A  KL+A  +  A+
Sbjct: 185 TGGKEEPRLTVREKQVLQWAAFGKTSWETAMILELSERTIETYIGKAVAKLEASTKAHAV 244

Query: 226 AKAIRFGYI 234
            KA+  G I
Sbjct: 245 CKALSLGLI 253


>gi|146277748|ref|YP_001167907.1| autoinducer-binding domain-containing protein [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145555989|gb|ABP70602.1| Autoinducer-binding domain protein [Rhodobacter sphaeroides ATCC
           17025]
          Length = 233

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 40/227 (17%), Positives = 72/227 (31%), Gaps = 12/227 (5%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
             + +  L  +        F   +  +          +    NY                
Sbjct: 10  ASDDANFLEYLDQLCARLGFDFASYATTSPMTGA---VQGYANYPDSWKMHYMRRNLHRV 66

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
           D  +      + P+ W   +     E    +    E   +   G+  PVR  +   G + 
Sbjct: 67  DPTIHKSALSIAPVDWARFE---RDERFRAVFFAAEDFGITPQGLTVPVRGPYGDRGLLS 123

Query: 134 FTSEFLMLANE-----VIIEAHGACYQVITDFLELFK-KRSSAARNLTERETSCLQLAGD 187
            T        +      I +   A   +    +      R+     L+ RE   LQ    
Sbjct: 124 VTRRCPRSDWDKLKRAAIGDLQVAAVHLHDAVMRSDVISRALRQPRLSTREIEVLQWVAA 183

Query: 188 GYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           G +  +I + LG+S  TV  +L SA  KL  ++ +QA+ +AI  G +
Sbjct: 184 GKSQMDIGDILGISHRTVEVHLRSAREKLGTLSTVQAVGRAIGLGLV 230


>gi|71736210|ref|YP_276356.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257482085|ref|ZP_05636126.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|71556763|gb|AAZ35974.1| transcriptional regulator, LuxR family, autoinducer-regulated
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|320322567|gb|EFW78660.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320330180|gb|EFW86166.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330875327|gb|EGH09476.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330987492|gb|EGH85595.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011444|gb|EGH91500.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 254

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 51/248 (20%), Positives = 92/248 (37%), Gaps = 14/248 (5%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARN--FALYTINSALDFPRRQQLICELHNYD 58
           +S+     + +S++ +      L+ + +      +    +  + D       +  L N  
Sbjct: 5   LSDFNSRLQSASTVDQQMDCALLLASELGFDAVIYDYSPVPVSHDGALITPSLLSLRNTP 64

Query: 59  LDSGDIPNILIETYGDDFLFHFNSGLLPIIWQ-----SIQEETVIESSGQLSVRLEGGLL 113
            D   +         D       + + P +W          +T I    +  VR      
Sbjct: 65  ADWHALWCSQGYYQIDPVQHLAVASVSPFVWSYQPKAETVLQTFITDMHKPVVRYLHDSH 124

Query: 114 PFAGIAFPVRLGFHKNGYVI-FTSEFLMLA----NEVIIEAHGACYQVITDFLELFKK-- 166
              G+  P+ +       +    S+    A     + + E     +        LF +  
Sbjct: 125 MTCGVTVPIHMPKGGFATLTGLCSDSSDAALEDARQSLAEFGLLAHAFQEVAYPLFDQKM 184

Query: 167 RSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIA 226
           RS  A  LT RE  CL  + +G T+ EIA++L  SV TV  +L SA  KL A NR+QA+ 
Sbjct: 185 RSCNAIKLTRRERECLSWSAEGLTAREIADQLNRSVATVTLHLNSAMQKLGAKNRVQAVV 244

Query: 227 KAIRFGYI 234
           +A+ +  +
Sbjct: 245 RAVHYRLL 252


>gi|300689864|ref|YP_003750859.1| transcriptional activator protein solR [Ralstonia solanacearum
           PSI07]
 gi|299076924|emb|CBJ49537.1| Transcriptional activator protein solR [Ralstonia solanacearum
           PSI07]
          Length = 236

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 44/229 (19%), Positives = 68/229 (29%), Gaps = 11/229 (4%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
            + Q+       I +  +   F        +  P  +  +     Y              
Sbjct: 13  RTAQDERQLFREITSIARQLGFDYCCYGVRMPLPVSKPAVAIFDTYPAGWMQHYQASGFL 72

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  +    S    IIW        I                  G+A          G 
Sbjct: 73  EIDPTVRAGASSSDLIIWP-----VSIRDEAMRLWSDARDFGLNIGVARSSWTARGAFGL 127

Query: 132 VIFTSEFLMLANEVIIEA----HGACYQVITDFLE-LFKKRSSAARN-LTERETSCLQLA 185
           +        L    +       +       T     L  K    +   LT RE   L   
Sbjct: 128 LTLARHADPLTAAELDRLSATTNWLANLAHTLMSPFLMPKLVPESNAVLTAREREVLCWT 187

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           G+G T+ EI + L +S  TVN ++ +  +KL A N++QA+ KAI  G I
Sbjct: 188 GEGKTAYEIGQILRISERTVNFHVNNVLLKLAATNKVQAVVKAIVIGLI 236


>gi|83952460|ref|ZP_00961191.1| autoinducer-binding transcriptional regulator LuxR [Roseovarius
           nubinhibens ISM]
 gi|83836133|gb|EAP75431.1| autoinducer-binding transcriptional regulator LuxR [Roseovarius
           nubinhibens ISM]
          Length = 251

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 41/238 (17%), Positives = 76/238 (31%), Gaps = 24/238 (10%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           + L  L   +  ++  +K     L+  ++  D  +        H                
Sbjct: 20  AGLSSLPATVEALRRALKVDQI-LFCSSTGPDRSQN------WHTLPPGWTARYAQQGYH 72

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D         + P  W+ +  +     + +         +   G   P      +   
Sbjct: 73  RIDPVRAEAQRRVTPFDWRPLDWQRPAARALR--ADAVAHGIGPQGFTIPAHGPNGQLAL 130

Query: 132 VIFTSEFLMLANEVIIEAHGACYQVITDFLEL---------------FKKRSSAARNLTE 176
           +  T++        +  A+     +    L                     +  A  L+ 
Sbjct: 131 LSITADRDDATWTDLTRANRFALILAAHALHHKIMSQPDAGLGEDPDSAAATPPAPRLSP 190

Query: 177 RETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           RET  + L   G +  +IA KL +S HT+ +Y+ +A  KL AVN   A+A+AI  G I
Sbjct: 191 RETDVITLLARGDSRGQIATKLAISEHTLRSYIETARHKLGAVNTPHAVARAIAMGMI 248


>gi|222150233|ref|YP_002551190.1| transcriptional regulator LuxR family [Agrobacterium vitis S4]
 gi|221737215|gb|ACM38178.1| transcriptional regulator LuxR family [Agrobacterium vitis S4]
          Length = 246

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 38/211 (18%), Positives = 64/211 (30%), Gaps = 9/211 (4%)

Query: 33  FALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQS- 91
           F  Y +  +    +    +     +      +         D  + +      P  W   
Sbjct: 35  FDYYGLVRSPKPDQNPMSLVLAGRWPEKWPQVYITKKFVLIDPAIRYLAQAQRPFRWSET 94

Query: 92  --IQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIEA 149
                +       Q  +          G  FP+         +      + L    I+  
Sbjct: 95  LTAFSQDPHFKRMQRMMMDAQRFGLEEGYIFPIHGRGGLLANMTIGGRPVELTPIEIMLF 154

Query: 150 HGACYQVITDFLELFKKRSSAAR------NLTERETSCLQLAGDGYTSEEIAEKLGLSVH 203
                       E+  +    +        LT RE   L   G+G TS E+++ L +S H
Sbjct: 155 DTVAKCAFWRLAEINGEDELLSMVQKVDVRLTRRELEILNYLGEGMTSNEMSKLLEISNH 214

Query: 204 TVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           TV+ Y+     KL+A NR   +A A R G I
Sbjct: 215 TVDWYVNELQDKLNAKNRQHMVAIAYRLGLI 245


>gi|104783716|ref|YP_610214.1| LuxR family transcriptional regulator [Pseudomonas entomophila L48]
 gi|95112703|emb|CAK17431.1| putative transcriptional regulator, LuxR family [Pseudomonas
           entomophila L48]
          Length = 234

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 41/233 (17%), Positives = 73/233 (31%), Gaps = 18/233 (7%)

Query: 15  QELSPRLHL---------IQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIP 65
           +++   L                +A       ++  L    +   +   +NY  +  +  
Sbjct: 7   EDIQQLLEERNPQRMFEIAVTMSQALGMEYLGLSLHLHIAAQNPQVILYNNYPREWNEHY 66

Query: 66  NILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLG 125
                   D  +   +  L P IW       V                   G    V   
Sbjct: 67  RQGNFLTIDPIVSMCHKTLKPQIWSDELYCEVP-----HFRESAMRFGITHGWTQSVFDQ 121

Query: 126 FHKNGYVIFTSEFLMLANEVIIE----AHGACYQVITDFLELFKKRSSAARNLTERETSC 181
            H    +        +  + + +        C  +     E   ++ S   NL+ERE   
Sbjct: 122 RHNESQLSVCRGKRPIKVKEVYDKASQVMWLCNTLHAALSEHHLEKLSPTPNLSERELEV 181

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           L+ +  G T+ ++A  L LS  TVN ++ S   K +A N+  AIA A   G +
Sbjct: 182 LKWSAGGKTAADVATILSLSTSTVNFHIRSVINKTNAANKAGAIAVAFLRGLL 234


>gi|237807075|ref|YP_002891515.1| transcriptional regulator, LuxR family [Tolumonas auensis DSM 9187]
 gi|237499336|gb|ACQ91929.1| transcriptional regulator, LuxR family [Tolumonas auensis DSM 9187]
          Length = 254

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 49/202 (24%), Positives = 73/202 (36%), Gaps = 7/202 (3%)

Query: 27  RIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLP 86
              A NF  Y +   L    +Q  +  L     +  +          D       +   P
Sbjct: 31  LCAANNFEYYQLCLTLRRGLQQTDLTLLTQTPDNWAEHYAKNNTIQNDSLYQRAQTQSRP 90

Query: 87  IIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEF-LMLANEV 145
           + WQS   E   E    L +          GIA P+       GY   +      +  + 
Sbjct: 91  LFWQS---EAKPEHENFLPMDCWRQFGMEEGIAVPLHGPAGFCGYFALSRHKKEPIRLQD 147

Query: 146 IIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTV 205
                   + +    ++LF   S    NL+ RE  CL    +G TS EIA+ LG++  TV
Sbjct: 148 FFHLSYLGHILQEQAIQLF---SPEQSNLSGREKECLFWVSEGKTSWEIAQILGITERTV 204

Query: 206 NAYLGSATVKLDAVNRIQAIAK 227
           N +L +A  K    NR Q +AK
Sbjct: 205 NFHLNNAIRKSGCKNRYQTVAK 226


>gi|289625636|ref|ZP_06458590.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289646651|ref|ZP_06477994.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|298488410|ref|ZP_07006441.1| Transcriptional regulator ahyR/asaR family [Pseudomonas savastanoi
           pv. savastanoi NCPPB 3335]
 gi|298157035|gb|EFH98124.1| Transcriptional regulator ahyR/asaR family [Pseudomonas savastanoi
           pv. savastanoi NCPPB 3335]
 gi|330868197|gb|EGH02906.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 254

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 51/248 (20%), Positives = 91/248 (36%), Gaps = 14/248 (5%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARN--FALYTINSALDFPRRQQLICELHNYD 58
           +S+     + +S++ +      L+ + +      +    +  + D       +  L N  
Sbjct: 5   LSDFNSRLQSASTVDQQMDCALLLASDLGFDAVIYDYSPVPVSHDGALITPSLLSLRNTP 64

Query: 59  LDSGDIPNILIETYGDDFLFHFNSGLLPIIWQ-----SIQEETVIESSGQLSVRLEGGLL 113
            D   +         D       + + P +W          +T I    +  VR      
Sbjct: 65  ADWHALWCSQGYYQIDPVQHLAVASVSPFVWSYQPKAETVLQTFITDMHKPVVRYLHDSH 124

Query: 114 PFAGIAFPVRLGFHKNGYVI-FTSEFLMLA----NEVIIEAHGACYQVITDFLELFKK-- 166
              G+  P+ +       +    S+    A     + + E              LF +  
Sbjct: 125 MTCGVTVPIHMPKGGFATLTGLCSDSSDAALEDARQSLAEFGLLAQAFQEVAYPLFDQKM 184

Query: 167 RSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIA 226
           RS  A  LT RE  CL  + +G T+ EIA++L  SV TV  +L SA  KL A NR+QA+ 
Sbjct: 185 RSCNAIKLTRRERECLSWSAEGLTAREIADQLNRSVATVTLHLNSAMQKLGAKNRVQAVV 244

Query: 227 KAIRFGYI 234
           +A+ +  +
Sbjct: 245 RAVHYRLL 252


>gi|33326387|gb|AAQ08608.1| putative transcription regulator [Agrobacterium vitis]
          Length = 248

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 38/211 (18%), Positives = 64/211 (30%), Gaps = 9/211 (4%)

Query: 33  FALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQS- 91
           F  Y +  +    +    +     +      +         D  + +      P  W   
Sbjct: 37  FDYYGLVRSPKPDQNPMSLVLAGRWPEKWPQVYITKKFVLIDPAIRYLAQAQRPFRWSET 96

Query: 92  --IQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIEA 149
                +       Q  +          G  FP+         +      + L    I+  
Sbjct: 97  LTAFSQDPHFKRMQRMMMDAQRFGLEEGYIFPIHGRGGLLANMTIGGRSVELTPIEIMLF 156

Query: 150 HGACYQVITDFLELFKKRSSAAR------NLTERETSCLQLAGDGYTSEEIAEKLGLSVH 203
                       E+  +    +        LT RE   L   G+G TS E+++ L +S H
Sbjct: 157 DTVAKCAFWRLAEINGEDELLSMVQKVDVRLTRRELEILNYLGEGMTSNEMSKLLEISNH 216

Query: 204 TVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           TV+ Y+     KL+A NR   +A A R G I
Sbjct: 217 TVDWYVNELQDKLNAKNRQHMVAIAYRLGLI 247


>gi|197337087|ref|YP_002158591.1| transcriptional activator protein LuxR [Vibrio fischeri MJ11]
 gi|197314339|gb|ACH63788.1| transcriptional activator protein LuxR [Vibrio fischeri MJ11]
          Length = 252

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 49/229 (21%), Positives = 90/229 (39%), Gaps = 11/229 (4%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
            S  +++  L  +   +   +   Y +         +  I  L NY        +     
Sbjct: 22  RSNNDINQCLSDMTKMV---HCEYYLLAIIYPHSMVKSDISILDNYPKKWRQYYDDANLI 78

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  + + NS   PI W  I E   +       ++         G +FP+    +  G 
Sbjct: 79  KYDPIVDYSNSNHSPINWN-IFENNAVNKKSPNVIKEAKTSGLITGFSFPIHTANNGFGM 137

Query: 132 VIFTSEFLMLANEVIIEAH------GACYQVITDFLELFKKRSSAARNLTERETSCLQLA 185
           + F         + +   H           ++ ++ ++    + +  +LT+RE  CL  A
Sbjct: 138 LSFAHSEKDNYIDSLF-LHACMNIPLIVPSLVDNYRKINIANNKSNNDLTKREKECLAWA 196

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +G +S +I++ LG S  TV  +L +A +KL+  NR Q+I+KAI  G I
Sbjct: 197 CEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKAILTGAI 245


>gi|462556|sp|P12746|LUXR_VIBFI RecName: Full=Transcriptional activator protein luxR
 gi|5726578|gb|AAD48473.1|AF170104_1 regulatory protein LuxR [Aliivibrio fischeri]
 gi|155231|gb|AAA27540.1| luxR protein [Aliivibrio fischeri]
 gi|59800242|gb|AAX07424.1| LuxR [Expression vector pLuxR-wt]
 gi|59800247|gb|AAX07428.1| LuxR-mut [Expression vector pHTSUB-105]
 gi|60594754|gb|AAX29978.1| LuxR [Cloning vector pHTSUB-106]
          Length = 250

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 49/229 (21%), Positives = 90/229 (39%), Gaps = 11/229 (4%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
            S  +++  L  +   +   +   Y +         +  I  L NY        +     
Sbjct: 20  RSNNDINQCLSDMTKMV---HCEYYLLAIIYPHSMVKSDISILDNYPKKWRQYYDDANLI 76

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  + + NS   PI W  I E   +       ++         G +FP+    +  G 
Sbjct: 77  KYDPIVDYSNSNHSPINWN-IFENNAVNKKSPNVIKEAKTSGLITGFSFPIHTANNGFGM 135

Query: 132 VIFTSEFLMLANEVIIEAH------GACYQVITDFLELFKKRSSAARNLTERETSCLQLA 185
           + F         + +   H           ++ ++ ++    + +  +LT+RE  CL  A
Sbjct: 136 LSFAHSEKDNYIDSLF-LHACMNIPLIVPSLVDNYRKINIANNKSNNDLTKREKECLAWA 194

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +G +S +I++ LG S  TV  +L +A +KL+  NR Q+I+KAI  G I
Sbjct: 195 CEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKAILTGAI 243


>gi|330888704|gb|EGH21365.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           mori str. 301020]
          Length = 254

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 51/248 (20%), Positives = 91/248 (36%), Gaps = 14/248 (5%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARN--FALYTINSALDFPRRQQLICELHNYD 58
           +S+     + +S++ +      L+ + +      +    +  + D       +  L N  
Sbjct: 5   LSDFNSRLQSASTVDQQMDCALLLASELGFDAVIYDYSPVPVSHDGALITPSLLSLRNTP 64

Query: 59  LDSGDIPNILIETYGDDFLFHFNSGLLPIIWQ-----SIQEETVIESSGQLSVRLEGGLL 113
            D   +         D       + + P +W          +T I    +  VR      
Sbjct: 65  ADWHALWCSQGYYQIDPVQHLAVASVSPFVWSYQPKAETVLQTFITDMHKPVVRYLHDSH 124

Query: 114 PFAGIAFPVRLGFHKNGYVI-FTSEFLMLA----NEVIIEAHGACYQVITDFLELFKK-- 166
              G+  P+ +       +    S+    A     + + E     +        LF +  
Sbjct: 125 MTCGVTVPIHMPKGGFATLTGLCSDSSDAALEDARQSLAEFGLLAHAFQEVAYPLFDQKM 184

Query: 167 RSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIA 226
           RS  A  LT RE  CL  + +G T+ EIA+ L  SV TV  +L SA  KL A NR+QA+ 
Sbjct: 185 RSCNAIKLTRRERECLSWSAEGLTAREIADHLNRSVATVTLHLNSAMQKLGAKNRVQAVV 244

Query: 227 KAIRFGYI 234
           +A+ +  +
Sbjct: 245 RAVHYRLL 252


>gi|254471852|ref|ZP_05085253.1| transcriptional regulator, LuxR family protein [Pseudovibrio sp.
           JE062]
 gi|211959054|gb|EEA94253.1| transcriptional regulator, LuxR family protein [Pseudovibrio sp.
           JE062]
          Length = 254

 Score =  135 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 48/230 (20%), Positives = 75/230 (32%), Gaps = 17/230 (7%)

Query: 17  LSPRLHLIQNRIKARNF---ALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           L  R   +    +   F   A   +         +Q IC L N+  D  +  N     + 
Sbjct: 28  LQARWEELTRFAEKLGFEKGAYIIVPKIEGRVEDRQPIC-LSNHSQDWVEHYNSHHYYFK 86

Query: 74  DDFLFHFNSGLLPII--WQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
           D  + H  SG   +   W         +        +        G+  P+         
Sbjct: 87  DPGMDHLLSGRK-VDQLWTDYTVRPTSKVDSDFFNDVRSA-GLKFGVTIPL--ECSNKHL 142

Query: 132 VIFTSEFLMLANEVIIEAHGACYQ-VITDFLELFKKRSSAARNL------TERETSCLQL 184
           V   S       ++  +A       V+   + LF   +     L      T RE  CL  
Sbjct: 143 VGGASFASCERTQLGFDAQMTSNYPVLKGAVHLFHTYAQEPETLSEFFGFTPREHECLLW 202

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              G  ++EIA  L LS  TV  ++  A  KL   NR  A+A+A+ F  +
Sbjct: 203 LTAGRANKEIAHILNLSEKTVEHHIKRACKKLRVTNRTHAVARAMTFQLL 252


>gi|218663535|ref|ZP_03519465.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli IE4771]
          Length = 240

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 39/223 (17%), Positives = 67/223 (30%), Gaps = 4/223 (1%)

Query: 13  SLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETY 72
           +  E+   +  +   +    F + T+ +          I  + N+  +  D  +      
Sbjct: 19  THYEVFKYMKGLTQDLGMTAFLIMTLPTVEFVEIGATKI--ITNWPAEMVDYYDAHNLMV 76

Query: 73  GDDFLFHFNSGLLPIIWQ-SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
               +        P  +                 + L        G  FP+       G 
Sbjct: 77  DSPVIRRMLRSTSPFNYDVEAINTDRGGGKKSTVIDLFRRYGMEKGAYFPLHDAAGGRGA 136

Query: 132 VIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTS 191
           +  +        E+          +     +L           T  E  CL+L   G  S
Sbjct: 137 MSISGSRNFSMIEMAKIL-FIATLIYDRLSQLTLNEKHKPIAFTSSELDCLRLTAGGRKS 195

Query: 192 EEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            EIA+ L LS + VN ++GS   KL    R QA+  A+R   I
Sbjct: 196 SEIAKLLHLSENAVNNHIGSVIKKLGCTTRTQAVVSALRLNII 238


>gi|313500551|gb|ADR61917.1| LuxR family transcriptional regulator [Pseudomonas putida BIRD-1]
          Length = 235

 Score =  135 bits (339), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 34/222 (15%), Positives = 70/222 (31%), Gaps = 10/222 (4%)

Query: 18  SPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFL 77
                +  +  +  +     +N  +    +   +    NY  +  +          D   
Sbjct: 19  QKLFDIAVHLAQDLDMDYLGLNIRIQIATQTPRLYLYSNYPSEWIERYQRDDFYKQDPAA 78

Query: 78  FHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSE 137
              +S  +P++W     +   +        +        G    +    H    +     
Sbjct: 79  NLSHSSTMPVLWTDELYKEAPQ-----FREMACLHGLRHGWTQSLHDQQHNESQISVARP 133

Query: 138 FLMLANEVIIE----AHGACYQVITDFLELFKKRS-SAARNLTERETSCLQLAGDGYTSE 192
              +    + +        C+ +     E            ++ERE   L+ +  G T+ 
Sbjct: 134 NGPIDEVELYDKAGSVQWLCHALHAVLGEHHLNALCPPQPKMSERELEVLKWSAAGKTAA 193

Query: 193 EIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           ++A  L LS  TVN ++ S   K +A N+  AIA A   G+I
Sbjct: 194 DVASILSLSQSTVNFHIRSVITKTNAANKAGAIAIAALRGWI 235


>gi|330958109|gb|EGH58369.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 254

 Score =  135 bits (339), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 51/248 (20%), Positives = 90/248 (36%), Gaps = 14/248 (5%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARN--FALYTINSALDFPRRQQLICELHNYD 58
           +S+     + +++L +      L+ + +      +    +  + D       +  L N  
Sbjct: 5   LSDFNSRLQSAATLDQQMDCALLLASHMGFDAVIYDYSPVPVSHDGALITPSLLSLRNTP 64

Query: 59  LDSGDIPNILIETYGDDFLFHFNSGLLPIIWQ-----SIQEETVIESSGQLSVRLEGGLL 113
            D   +         D       + + P +W          +T I    +  VR      
Sbjct: 65  ADWHSLWCSQGYYQIDPVQHLAVASVSPFVWSYQPKAETVLQTFITDLHKPVVRYLHDSH 124

Query: 114 PFAGIAFPVRLGFHKNGYVIFTSEF-----LMLANEVIIEAHGACYQVITDFLEL--FKK 166
              G+  P+ +       +           L  A + + E     +        L   K 
Sbjct: 125 MTCGVTAPIHMPKGGFATLTGLRSDNSDIALEDARQSLAEFGLLAHAFQEVAYPLFDEKM 184

Query: 167 RSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIA 226
           RS  A  LT RE  CL  + +G T+ EIA++L  SV TV  +L SA  KL A NR+QA+ 
Sbjct: 185 RSCTAIKLTRRERECLSWSAEGLTAREIADQLNRSVATVTLHLNSAMQKLGAKNRVQAVV 244

Query: 227 KAIRFGYI 234
           +A+ +  +
Sbjct: 245 RAVHYRLL 252


>gi|213966697|ref|ZP_03394848.1| transcriptional regulator, LuxR family, autoinducer-regulated
           [Pseudomonas syringae pv. tomato T1]
 gi|301383210|ref|ZP_07231628.1| transcriptional regulator, LuxR family, autoinducer-regulated
           [Pseudomonas syringae pv. tomato Max13]
 gi|302059053|ref|ZP_07250594.1| transcriptional regulator, LuxR family, autoinducer-regulated
           [Pseudomonas syringae pv. tomato K40]
 gi|302133729|ref|ZP_07259719.1| transcriptional regulator, LuxR family, autoinducer-regulated
           [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|213928547|gb|EEB62091.1| transcriptional regulator, LuxR family, autoinducer-regulated
           [Pseudomonas syringae pv. tomato T1]
 gi|331018431|gb|EGH98487.1| transcriptional regulator, LuxR family, autoinducer-regulated
           [Pseudomonas syringae pv. lachrymans str. M302278PT]
          Length = 254

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 51/248 (20%), Positives = 91/248 (36%), Gaps = 14/248 (5%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARN--FALYTINSALDFPRRQQLICELHNYD 58
           +S+     + +S+L +      L+ + +      +    +  + D       +  L N  
Sbjct: 5   LSDFNSRLQSASTLDQQMDCALLLASDLGFDAVIYDYSPVPVSHDGALITPSLLSLRNTP 64

Query: 59  LDSGDIPNILIETYGDDFLFHFNSGLLPIIWQ-----SIQEETVIESSGQLSVRLEGGLL 113
            D   +         D       + + P +W          +T +    +  VR      
Sbjct: 65  ADWHALWCSQGYYQIDPVQHLAVASVSPFVWSYQPRAETVLQTFLTDMHKPVVRYLHDSH 124

Query: 114 PFAGIAFPVRLGFHKNGYVIFTSEF-----LMLANEVIIEAHGACYQVITDFLELFKK-- 166
              G+  P+ +       +           L  A + + E     +        LF +  
Sbjct: 125 MTCGLTVPIHMPKGGFATLTGLCSDSSDVALEDARQSLAEFGLLAHAFQEVAYPLFDQKM 184

Query: 167 RSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIA 226
           RS  A  LT RE  CL  + +G T+ EIA++L  SV TV  +L SA  KL A NR+QA+ 
Sbjct: 185 RSCNAIKLTRRERECLSWSAEGLTAREIADQLNRSVATVTLHLNSAMQKLGAKNRVQAVV 244

Query: 227 KAIRFGYI 234
           +A+ +  +
Sbjct: 245 RAVHYRLL 252


>gi|294851589|ref|ZP_06792262.1| LuxR family transcriptional regulator [Brucella sp. NVSL 07-0026]
 gi|294820178|gb|EFG37177.1| LuxR family transcriptional regulator [Brucella sp. NVSL 07-0026]
          Length = 238

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 45/234 (19%), Positives = 79/234 (33%), Gaps = 17/234 (7%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           + + S  +L   +    + +    F   +   ++              +           
Sbjct: 14  QSADSADQLFEIVKNYAHDL---GFEYVSYVMSIPSLNGSLKWVRFGAFPDGWEQRYLAQ 70

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  L    + +  +IW      +  +                 GI+ P       
Sbjct: 71  NYAEIDPLLRRGVNSIDLLIWSQNFFASAPQ-----IWADAVKYGLKVGISQPCWAAQGV 125

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELF--KKRSSAA------RNLTERETS 180
            G + F      L    I        Q++T+ L L   ++    A       +LT RE  
Sbjct: 126 FGLLSFVRSGPALTPGEISML-RRQLQMLTNLLHLSMYERVDVPAISCIGDVSLTLRERE 184

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            L+   +G T+E I   L +S  TVN ++ +   KL AVN++QA+AKA  FG +
Sbjct: 185 ILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNKVQAVAKARTFGLL 238


>gi|148258315|ref|YP_001242900.1| LuxR family transcriptional regulator [Bradyrhizobium sp. BTAi1]
 gi|146410488|gb|ABQ38994.1| transcriptional regulator, LuxR family [Bradyrhizobium sp. BTAi1]
          Length = 242

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 45/218 (20%), Positives = 68/218 (31%), Gaps = 2/218 (0%)

Query: 18  SPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFL 77
           +  L   +  I    F  Y +       +  Q     + +  +  D+         D   
Sbjct: 24  ASVLSQFEKMIGDLGFHAYIMAGVPAPGQSLQHTILANGWPSEWFDLYAREQFHRYDPIP 83

Query: 78  FHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSE 137
            H  S L P  W     +   E      +          G   P+       G V    E
Sbjct: 84  RHCLSTLNPFAWSEAPYDRNDEPGAHEVMTRARDFRLNEGFCVPIHYDD-AVGAVSLAGE 142

Query: 138 FLMLANEVIIEAHGACYQVITDFLELFKKRS-SAARNLTERETSCLQLAGDGYTSEEIAE 196
              LA +     H       +    L +  S   +R L+  E   L  A  G T+ E A 
Sbjct: 143 RPNLAPDARGALHLISIFTHSRLRALARATSGGQSRRLSRIEAEVLSWAARGKTAWETAR 202

Query: 197 KLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            LG+S   V  +L  A  KL+  N+   +A A+  G I
Sbjct: 203 ILGVSERNVRWHLEEAQRKLETKNKTATVATALVNGEI 240


>gi|299132715|ref|ZP_07025910.1| transcriptional regulator, LuxR family [Afipia sp. 1NLS2]
 gi|298592852|gb|EFI53052.1| transcriptional regulator, LuxR family [Afipia sp. 1NLS2]
          Length = 241

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 39/217 (17%), Positives = 71/217 (32%), Gaps = 11/217 (5%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDF 76
           L   L      +    FA  +++          +   + NY ++  D          D  
Sbjct: 21  LRTVLADAGAALDLSCFAYLSMSPRRGG-----VPELISNYPVEWTDHYLREHYERVDPV 75

Query: 77  LFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTS 136
           +    +G  P  W        +  S    +          G   P+         V F +
Sbjct: 76  IAVALAGTEPFEWGQEFAAKRLSKSQCALLDEAAQFGIRCGFTVPIHDSRGPVAAVTFAA 135

Query: 137 EFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARN------LTERETSCLQLAGDGYT 190
           +      +  IE + +  Q++  +     +R  +         L+ RE  CL+ A  G +
Sbjct: 136 DERRPTFQRCIEQNRSVLQLMAMYFHAHARRRLSINRVIDGVALSPREFECLEWAAQGKS 195

Query: 191 SEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAK 227
           + EI   L +S  T   +L +A +K       QA+AK
Sbjct: 196 AWEIGRLLNISRRTAAFHLDNAKMKFGVRTICQAVAK 232


>gi|170727337|ref|YP_001761363.1| LuxR family transcriptional regulator [Shewanella woodyi ATCC
           51908]
 gi|169812684|gb|ACA87268.1| transcriptional regulator, LuxR family [Shewanella woodyi ATCC
           51908]
          Length = 250

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 42/221 (19%), Positives = 71/221 (32%), Gaps = 13/221 (5%)

Query: 21  LHLIQNRIKARNFALYTINSALDFPRRQQLI----CELHNYDLDSGDIPNILIETYGDDF 76
           +  +QN ++    AL  +    D     + +        +  ++  +I       Y D  
Sbjct: 36  VKALQNLLEVDGVALINLILRPDHTITIERVVSSGFGFESKSVEWDNIYQKKKFQYIDPV 95

Query: 77  LFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIA---FPVRLGFHKNGYVI 133
           +    S      W S+     +       +     +    G +   F  R  + +     
Sbjct: 96  VSCSASFRRSFNWASVPSMITLSEVQFNFLERAQEMGLKEGASIGSFSTRQIYKELTITS 155

Query: 134 FTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEE 193
                  L  E +                L       A  LT RE+  L  + +G +S E
Sbjct: 156 VCG--CSLNPEQLASLELINAVSAQAMKRL----ILPAEKLTGRESEILAWSSEGKSSWE 209

Query: 194 IAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           I     ++  TV  +L +   KL+  NR QAI  AIR G I
Sbjct: 210 IGMICSITERTVKFHLKNIYKKLNVQNRAQAIVCAIRLGLI 250


>gi|28871673|ref|NP_794292.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|28854925|gb|AAO57987.1| transcriptional regulator, LuxR family, autoinducer-regulated
           [Pseudomonas syringae pv. tomato str. DC3000]
          Length = 254

 Score =  134 bits (338), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 51/248 (20%), Positives = 91/248 (36%), Gaps = 14/248 (5%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARN--FALYTINSALDFPRRQQLICELHNYD 58
           +S+     + +S+L +      L+ + +      +    +  + D       +  L N  
Sbjct: 5   LSDFNSRLQSASTLDQQMDCALLLASDMGFDAVIYDYSPVPVSHDGALITPSLLSLRNTP 64

Query: 59  LDSGDIPNILIETYGDDFLFHFNSGLLPIIWQ-----SIQEETVIESSGQLSVRLEGGLL 113
            D   +         D       + + P +W          +T +    +  VR      
Sbjct: 65  ADWHALWCSQGYYQIDPVQHLAVASVSPFVWSYQPRAETVLQTFLTDMHKPVVRYLHDSH 124

Query: 114 PFAGIAFPVRLGFHKNGYVIFTSEF-----LMLANEVIIEAHGACYQVITDFLELFKK-- 166
              G+  P+ +       +           L  A + + E     +        LF +  
Sbjct: 125 MTCGLTVPIHMPKGGFATLTGLCSDSSDVALEDARQSLAEFGLLAHAFQEVAYPLFDQKM 184

Query: 167 RSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIA 226
           RS  A  LT RE  CL  + +G T+ EIA++L  SV TV  +L SA  KL A NR+QA+ 
Sbjct: 185 RSCNAIKLTRRERECLSWSAEGLTAREIADQLNRSVATVTLHLNSAMQKLGAKNRVQAVV 244

Query: 227 KAIRFGYI 234
           +A+ +  +
Sbjct: 245 RAVHYRLL 252


>gi|288960338|ref|YP_003450678.1| transcriptional regulator [Azospirillum sp. B510]
 gi|288912646|dbj|BAI74134.1| transcriptional regulator [Azospirillum sp. B510]
          Length = 287

 Score =  134 bits (338), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 45/225 (20%), Positives = 71/225 (31%), Gaps = 11/225 (4%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           + S  L  I + +   N   +            + +  L  Y                D 
Sbjct: 68  DKSHFLSRIIDSVGPFNVTYF---GTQCTSSPDRHVNLLTTYSEKWRMRYFDRRYENIDP 124

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
            L       +P+ W  +                    +   G+ F +R    +   V   
Sbjct: 125 VLSAARRATMPVDWDQLP--KTDSGVEDFIADALCYGIRLQGVTFSLRDMHQRLAIVSLQ 182

Query: 136 SEFLMLANEV-----IIEAHGACYQVITDFLELFKKRSSAAR-NLTERETSCLQLAGDGY 189
           S        V     I +       + +  +      +      L+ RE   L  A  G 
Sbjct: 183 SNDDPAVWRVRRPRIIPDFIHFSLALHSAMVSSEPDDAEEVPCKLSPREREVLDWASRGK 242

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           TS E    LGLS  TVN YL +A  K++A  ++QA A+A+R G I
Sbjct: 243 TSWETGMVLGLSEKTVNFYLRNACQKMNAATKVQAAAQAVREGLI 287


>gi|190890862|ref|YP_001977404.1| transcriptional regulator protein, LuxR family [Rhizobium etli CIAT
           652]
 gi|190696141|gb|ACE90226.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli CIAT 652]
          Length = 240

 Score =  134 bits (338), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 41/224 (18%), Positives = 69/224 (30%), Gaps = 4/224 (1%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           ++  E+   +  +   +    F + T+ +          I  + N+  +  D  +     
Sbjct: 18  NTHYEVFKYMKGLTQGLGMTAFLIMTLPTVDFVEIGATKI--ITNWPAEMVDYYDSHNLM 75

Query: 72  YGDDFLFHFNSGLLPIIWQ-SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
                +        P  +          E      + L        G  FPV       G
Sbjct: 76  VDSPVIRRMLRSTSPFNYDVEAINTDRGEGKKSTVIDLFRRYGMEKGAYFPVHDAAGGRG 135

Query: 131 YVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYT 190
            +  +        E+          +     +L           T  E  CL+L   G  
Sbjct: 136 AMSISGSRNFTMLEMAKIL-FIATLIYDRLSQLTLNEKHKPIAFTSSELDCLRLTAGGRK 194

Query: 191 SEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           S EIA+ L LS + VN ++GS   KL    R QA+  A+R   I
Sbjct: 195 SSEIAKLLDLSENAVNNHIGSVIKKLGCTTRTQAVVSALRLNII 238


>gi|283478850|emb|CAY74766.1| DNA-binding transcriptional activator SdiA [Erwinia pyrifoliae DSM
           12163]
          Length = 242

 Score =  134 bits (338), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 39/216 (18%), Positives = 75/216 (34%), Gaps = 10/216 (4%)

Query: 24  IQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSG 83
           I+ +++      Y++      P  +       NY  D  +          D  L    S 
Sbjct: 32  IEQQLRELELDFYSLFIRHPVPFTRPKTFLYSNYPEDWLEHYFREDFYQLDPVLKMCGSP 91

Query: 84  LLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEF----L 139
               IW     +    SSG            F G++  V       G    ++      +
Sbjct: 92  GK--IW---LWDDEAISSGVRVFENARNYGIFHGLSCSVMASNRSVGIFSMSTANSLKTI 146

Query: 140 MLANEVIIEAHGACYQVITDFLELFKKRSSAAR-NLTERETSCLQLAGDGYTSEEIAEKL 198
            L   + ++        +   +++     +  + +L++RE   L+   +G TS EI+  L
Sbjct: 147 ELTPVMELKIQYISELSMASLIKINDISMATTKLDLSQRELEILKWTAEGKTSAEISLIL 206

Query: 199 GLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +S +TVN +      + +A N+ Q  + A   G I
Sbjct: 207 SISENTVNFHQKKMQKRFNAPNKTQIASYAAAIGLI 242


>gi|259908860|ref|YP_002649216.1| Regulatory protein [Erwinia pyrifoliae Ep1/96]
 gi|224964482|emb|CAX55992.1| Regulatory protein [Erwinia pyrifoliae Ep1/96]
          Length = 240

 Score =  134 bits (338), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 39/216 (18%), Positives = 75/216 (34%), Gaps = 10/216 (4%)

Query: 24  IQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSG 83
           I+ +++      Y++      P  +       NY  D  +          D  L    S 
Sbjct: 30  IEQQLRELELDFYSLFIRHPVPFTRPKTFLYSNYPEDWLEHYFREDFYQLDPVLKMCGSP 89

Query: 84  LLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEF----L 139
               IW     +    SSG            F G++  V       G    ++      +
Sbjct: 90  GK--IW---LWDDEAISSGVRVFENARNYGIFHGLSCSVMASNRSVGIFSMSTANSLKTI 144

Query: 140 MLANEVIIEAHGACYQVITDFLELFKKRSSAAR-NLTERETSCLQLAGDGYTSEEIAEKL 198
            L   + ++        +   +++     +  + +L++RE   L+   +G TS EI+  L
Sbjct: 145 ELTPVMELKIQYISELSMASLIKINDISMATTKLDLSQRELEILKWTAEGKTSAEISLIL 204

Query: 199 GLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +S +TVN +      + +A N+ Q  + A   G I
Sbjct: 205 SISENTVNFHQKKMQKRFNAPNKTQIASYAAAIGLI 240


>gi|301305257|ref|ZP_07211354.1| autoinducer binding domain protein [Escherichia coli MS 124-1]
 gi|300839463|gb|EFK67223.1| autoinducer binding domain protein [Escherichia coli MS 124-1]
          Length = 226

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 34/216 (15%), Positives = 73/216 (33%), Gaps = 13/216 (6%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  ++  + +E+   +     +++   +  Y++      P  +  +    NY       
Sbjct: 14  LLRFQRMEAAEEVYHEIEFQAQQLE---YDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSY 70

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D  L   N     ++W             Q             G+   + L
Sbjct: 71  YQAKNFLAIDPVLNPENFSQGHLMWNDDLFS-----EAQPLWEAARAHGLRRGVTQYLML 125

Query: 125 GFHKNGYVIFTSEFLM----LANEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERET 179
                G++ F+         L++E+ ++      + +   + L  +   +   N ++RE 
Sbjct: 126 PNRALGFLSFSRSSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREK 185

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVK 215
             L+   +G TS EIA  L +S +TVN +  +   K
Sbjct: 186 EILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKK 221


>gi|289624509|ref|ZP_06457463.1| LuxR transcriptional regulator [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|330869296|gb|EGH04005.1| LuxR transcriptional regulator [Pseudomonas syringae pv. aesculi
           str. 0893_23]
          Length = 261

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 35/220 (15%), Positives = 62/220 (28%), Gaps = 15/220 (6%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           L++L        + I    +A ++         R      L NY                
Sbjct: 24  LRQLIEDFENDLHHIGDFTYAYFSTPKT-----RNVKPVILSNYPDSWLKSYVASNYHLI 78

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
           D  + H    + P  W+  +       +     R        +G  F +         + 
Sbjct: 79  DPIIKHAWHSITPFFWREARNAAQGVETDDFLKRSAK-YQLSSGATFTLHDASGLFAALS 137

Query: 134 FTSEFLMLANEVIIE---------AHGACYQVITDFLELFKKRSSAARNLTERETSCLQL 184
             +       +  I                ++I            A   L+ RET  L+ 
Sbjct: 138 LCNARQQKDFDQRIREKAADIQMSLIRFHDRLIKTRAPHELFPQPAQCKLSTRETGVLKW 197

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQA 224
              G +  EIAE   +S  TV  ++ + + KL+     QA
Sbjct: 198 VAMGKSYSEIAEIFSISERTVKFHMSNVSSKLEVRTAKQA 237


>gi|157370075|ref|YP_001478064.1| LuxR family transcriptional regulator [Serratia proteamaculans 568]
 gi|157321839|gb|ABV40936.1| transcriptional regulator, LuxR family [Serratia proteamaculans
           568]
          Length = 238

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 39/214 (18%), Positives = 73/214 (34%), Gaps = 12/214 (5%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +S  +    L  +    +A  F  ++      +P  +  +    N+     +    L   
Sbjct: 14  TSQPDRKVFLSQLAPCAQALGFEYFSYTVFSCYPASRPKMLIEGNFPECYLEDYRKLRVY 73

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  +   +   L   W         +   +L  R+        G +  V+  + + G 
Sbjct: 74  LQDPVIEQAHHSTLQFYWDE----HFYQDKPELWWRMAQ-FGIREGWSQSVKDCYGRLGI 128

Query: 132 VIFTSEFLMLANEVIIEAH-----GACYQVITDFLELFKKRSSAA--RNLTERETSCLQL 184
           + F  + + + +      +          V     E     +  A    LT RE   L+ 
Sbjct: 129 LTFAGKSIPVQSPQASARNETFFLWLAQMVHKTLREALISVNDEAIKDVLTLREKDILRW 188

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDA 218
             +G TSEE A  +GLS  TVN ++G++  KL  
Sbjct: 189 CSEGKTSEETALLMGLSERTVNFHIGNSIKKLSV 222


>gi|27802474|gb|AAO21112.1| TraR [Rhizobium leguminosarum bv. viciae]
          Length = 234

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 43/222 (19%), Positives = 68/222 (30%), Gaps = 12/222 (5%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDF 76
           +   L    N      FA                +   ++Y  +  DI      +  D  
Sbjct: 21  IKSALKSFANTYGFERFAY--------LQTEGAEVRAFNSYPEEWQDIYLGNQYSRIDPV 72

Query: 77  LFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTS 136
           +      +    W +        S  +            +G+  PV   F     + F S
Sbjct: 73  VTEAKRRMEMFSWTANDWPARGTSELRRFRDQAIEHGIRSGLTIPVEGSFGSTMMLTFAS 132

Query: 137 EFLMLANEVIIEAHGACYQVITDFLEL----FKKRSSAARNLTERETSCLQLAGDGYTSE 192
                    + +A  A   V+     L         +  R L+ RE  CL  A  G ++ 
Sbjct: 133 SRQTADGSKLRDAQKAIQAVLAIHYRLKIIAATTIVAPKRLLSPREAMCLMWAARGKSAP 192

Query: 193 EIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           E A   G++  TV  YL  A  KL+A    Q +A A   G +
Sbjct: 193 ETAMLTGINPRTVQHYLDKAREKLEAATVPQLVAIAKDHGLV 234


>gi|170700574|ref|ZP_02891575.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           IOP40-10]
 gi|170134522|gb|EDT02849.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           IOP40-10]
          Length = 240

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 43/225 (19%), Positives = 69/225 (30%), Gaps = 10/225 (4%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHN----YDLDSGDIPNILIETY 72
           L    +L+ N   +  F  Y ++    F  R             Y  +  +         
Sbjct: 17  LRSLTNLLANAAHSLGFPCYAVSRVSRFRSRSSPRIFAETIHVHYPDNWVNHYLAHDYGL 76

Query: 73  GDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYV 132
            D           P  W  I     +    +  +          GI+ P+          
Sbjct: 77  VDPVHRAAFIYNSPYRWSDIP---GLSEPERRVLGEAHDAGLTHGISIPIYEPDGSVLLF 133

Query: 133 IFTSE-FLMLANEVIIEAHGACYQVITDFLELFK--KRSSAARNLTERETSCLQLAGDGY 189
            F+     +     +  A  A      +F  L            L+ R+  CL   G G 
Sbjct: 134 SFSGPPHRVNTALNVRRAQLASLLFHAEFQRLAPIPHVEPPTLRLSPRQQECLYWVGQGK 193

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           TS EI   +G+S HTV+ +L  A   L+  +R +A   A  +G I
Sbjct: 194 TSPEIGMIMGISHHTVDYHLSEAMKILNVNSRTKAAVFASTYGLI 238


>gi|115523303|ref|YP_780214.1| LuxR family transcriptional regulator [Rhodopseudomonas palustris
           BisA53]
 gi|115517250|gb|ABJ05234.1| transcriptional regulator, LuxR family [Rhodopseudomonas palustris
           BisA53]
          Length = 237

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 49/233 (21%), Positives = 81/233 (34%), Gaps = 11/233 (4%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNI 67
            ++++S+ +L   L   +N     +   +  +        Q     L  YD         
Sbjct: 10  IERANSVADLGRILVDWRNESGVAHLVYHATHVPAC---EQPNPVLLLTYDDAWVKRYVE 66

Query: 68  LIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
                 D  +      +LPI W ++  E     +       E   +   G+  P+R    
Sbjct: 67  RNYFSIDPVVVAGRDAVLPIDWMAV--EHDTPEARHFFAEAESFGVGRHGLTLPIRGPAA 124

Query: 128 KNGYVIFTSEFLMLANEV-----IIEAHGACYQVITDFLELFKKRSS-AARNLTERETSC 181
           +      T+              + + H   + +    + L   R     R L+ RE  C
Sbjct: 125 ERALFTVTTNATDDHWHRWRFSYMKDFHLLAHYLHDRAMRLAGLRLDHVMRPLSSRERQC 184

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           L     G T  +IA +L LS   V+ YL +A  KLD     QAIAKA+R   +
Sbjct: 185 LNGLVRGRTPGQIAGELDLSGSAVHGYLRTARRKLDCATVEQAIAKAVRLDLL 237


>gi|170719977|ref|YP_001747665.1| LuxR family transcriptional regulator [Pseudomonas putida W619]
 gi|169757980|gb|ACA71296.1| transcriptional regulator, LuxR family [Pseudomonas putida W619]
          Length = 236

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 35/221 (15%), Positives = 69/221 (31%), Gaps = 9/221 (4%)

Query: 18  SPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFL 77
                L  +  +        +   +    +   +    NY L   +          D   
Sbjct: 19  QKVFDLAVHLAQDLGMEFMGLKLRIQLAAQAPKLYLYSNYPLAWIERYQRDEFYKQDPAA 78

Query: 78  FHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSE 137
              ++   P++W         +                 G    +    H    V     
Sbjct: 79  ALSHTSTEPVLWTDELYSEAPD-----FREQACKHGLRHGWTQSLHDLRHNETQVSVARP 133

Query: 138 FLMLANEVIIE----AHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEE 193
           F  +    + +        C+ +     E    + S+   +++RE   L+ +  G T+ +
Sbjct: 134 FGKIDIHELYDKAGQVQWLCHTLHDTICEHHLAKLSSPLKMSDRELEVLKWSAAGKTAAD 193

Query: 194 IAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +A  L LS  TVN ++ S   K +A N+  A+A A+  G I
Sbjct: 194 VACILSLSQSTVNFHIRSVITKTNASNKAGAVAIAMMRGLI 234


>gi|541659|dbj|BAA06490.1| LasR [Pseudomonas aeruginosa]
          Length = 239

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 44/246 (17%), Positives = 74/246 (30%), Gaps = 23/246 (9%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLD 60
           + +  L  ++SS   E S  L  + + +                 +  +    + NY   
Sbjct: 3   LVDGFLELERSSGKLEWSAILQKMASDLGFSKILF---GLLPKDSQDYENAFIVGNYPAA 59

Query: 61  SGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAF 120
             +  +       D  + H    +LPI W   +                       G+  
Sbjct: 60  WREHYDRAGYARVDPTVSHCTQSVLPIFW---EPSIYQTRKQHEFFEEASAAGLVYGLTM 116

Query: 121 PVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLEL------------FKKRS 168
           P+     + G +  +     +  E   EA+     V+     L            F+   
Sbjct: 117 PLHGARGELGALSLS-----VEAENRAEANRFIESVLPTLWMLKDYALQSGAGLAFEHPV 171

Query: 169 SAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKA 228
           S    LT  E   LQ    G TS EI+     S   VN ++G+   K    +R  A   A
Sbjct: 172 SKPVVLTSWEKEVLQWCAIGKTSWEISVICNCSEANVNFHMGNIRRKFGVTSRRVAAIMA 231

Query: 229 IRFGYI 234
           +  G I
Sbjct: 232 VNLGLI 237


>gi|310767240|gb|ADP12190.1| DNA-binding transcriptional activator SdiA [Erwinia sp. Ejp617]
          Length = 240

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 39/216 (18%), Positives = 76/216 (35%), Gaps = 10/216 (4%)

Query: 24  IQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSG 83
           I+ +++      Y++      P  +       NY  D  +          D  L   +S 
Sbjct: 30  IEQQLRELELDFYSLFIRHPVPFTRPKTFLYSNYPEDWLEHYFREDFYQLDPVLKMCSSP 89

Query: 84  LLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEF----L 139
               IW     +    SSG            F G++  V       G    ++      +
Sbjct: 90  GK--IW---LWDDEAMSSGVRVFENARNYGIFHGLSCSVMASNRSVGIFSVSTAKSLKTI 144

Query: 140 MLANEVIIEAHGACYQVITDFLELFKKRSSAAR-NLTERETSCLQLAGDGYTSEEIAEKL 198
            L   + ++        +   +++     +  + +L++RE   L+   +G TS EI+  L
Sbjct: 145 ELTPVMELKIQYISELSMASLIKINDISMATTKLDLSQRELEILKWTAEGKTSAEISLIL 204

Query: 199 GLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +S +TVN +      + +A N+ Q  + A   G I
Sbjct: 205 SISENTVNFHQKKMQKRFNAPNKTQIASYAAAIGLI 240


>gi|77458474|ref|YP_347979.1| LuxR family transcriptional regulator [Pseudomonas fluorescens
           Pf0-1]
 gi|77382477|gb|ABA73990.1| putative transcriptional regulator, LuxR family [Pseudomonas
           fluorescens Pf0-1]
          Length = 239

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 45/231 (19%), Positives = 74/231 (32%), Gaps = 9/231 (3%)

Query: 6   LTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIP 65
           L  + + +L  +   +           F L++  ++      +++     ++  D   + 
Sbjct: 14  LDIEAAPTLVAIQKAVRGFAGAYGYDRFVLFS-ATSASEDVVERIYWVEGDWFGDGIAVD 72

Query: 66  NILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLP-FAGIAFPVRL 124
                        H         W  +QE++     G+L   +     P   G+  PV  
Sbjct: 73  -AQTYVQRCPVTRHLLDARESFFWSKVQEQS-----GELYRLVRVPSGPGVHGLQIPVFG 126

Query: 125 GFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSS-AARNLTERETSCLQ 183
                G +    E +  +  V +               L +      A  L+ RE   L 
Sbjct: 127 PQGLEGAMSLGGEQIDASARVRLALGMLASVAFFSARRLLEAPLDETAGKLSTREREVLA 186

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G    +IA  LGLS  TV  +L SA   L      QAI  AIR G I
Sbjct: 187 WVAAGRRQADIAATLGLSGRTVENHLRSARRHLGVATTAQAIKIAIRKGEI 237


>gi|310686584|gb|ADP02958.1| LuxR [Cloning vector pLR3]
 gi|310686589|gb|ADP02962.1| LuxR [Cloning vector pLR4]
          Length = 269

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 49/229 (21%), Positives = 90/229 (39%), Gaps = 11/229 (4%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
            S  +++  L  +   +   +   Y +         +  I  L NY        +     
Sbjct: 39  RSNNDINQCLSDMTKMV---HCEYYLLAIIYPHSMVKSDISILDNYPKKWRQYYDDANLI 95

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  + + NS   PI W  I E   +       ++         G +FP+    +  G 
Sbjct: 96  KYDPIVDYSNSNHSPINWN-IFENNAVNKKSPNVIKEAKSSGLITGFSFPIHTANNGFGM 154

Query: 132 VIFTSEFLMLANEVIIEAH------GACYQVITDFLELFKKRSSAARNLTERETSCLQLA 185
           + F         + +   H           ++ ++ ++    + +  +LT+RE  CL  A
Sbjct: 155 LSFAHSEKDNYIDSLF-LHACMNIPLIVPSLVDNYRKINIANNKSNNDLTKREKECLAWA 213

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +G +S +I++ LG S  TV  +L +A +KL+  NR Q+I+KAI  G I
Sbjct: 214 CEGKSSWDISKILGCSKRTVTFHLTNAQMKLNTTNRCQSISKAILTGAI 262


>gi|47177072|ref|YP_015683.1| hypothetical protein pHCG3_p118 [Oligotropha carboxidovorans OM5]
 gi|47115463|emb|CAG28516.1| probable TraR [Oligotropha carboxidovorans OM5]
          Length = 239

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 44/217 (20%), Positives = 71/217 (32%), Gaps = 10/217 (4%)

Query: 22  HLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFN 81
             +++  ++  F  +          R    C L  Y  +   +         D  +    
Sbjct: 29  QALRHFCESNGFDRFA-----HLNVRSTETCVLTTYPAEWQRLYFDKKYALIDPVVISAK 83

Query: 82  SGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLML 141
             +    W         +   +   R        +G++ P+R  F     +   SE   +
Sbjct: 84  RNMEIFSWSQDDASKYSKDVKRFF-READDFGIRSGLSIPIRTPFGGTAILTLASEQRRV 142

Query: 142 ANEVIIEAHGACYQVITDFLELFKKRSSAARN----LTERETSCLQLAGDGYTSEEIAEK 197
               I +   A   V      L +  ++  R     LT RE +CL  A  G T  EIA+ 
Sbjct: 143 DFAGIQDTVRAMNAVAFAHAHLNRVAAAPCRRTKYELTPREVTCLTWASLGKTMSEIADL 202

Query: 198 LGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           L + V TV  YL  A  KL   N   A+  A+    I
Sbjct: 203 LQIDVRTVRNYLDLAREKLGGSNIAHAVRLAVMQHLI 239


>gi|155233|gb|AAA27541.1| luxR protein [Aliivibrio fischeri]
 gi|455385|gb|AAA27551.1| regulatory protein [Aliivibrio fischeri]
 gi|225902|prf||1403259A luxR gene
          Length = 250

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 49/229 (21%), Positives = 90/229 (39%), Gaps = 11/229 (4%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
            S  +++  L  +   +   +   Y +         +  I  L NY        +     
Sbjct: 20  RSNNDINQCLSDMTKMV---HCEYYLLAIIYPHSMVKSDISILDNYPKKWRQYYDDANLI 76

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  + + NS   PI W  I E   +       ++         G +FP+    +  G 
Sbjct: 77  KYDPIVDYSNSNHSPINWN-IFENNAVNKKSPNVIKEAKSSGLITGFSFPIHTANNGFGM 135

Query: 132 VIFTSEFLMLANEVIIEAH------GACYQVITDFLELFKKRSSAARNLTERETSCLQLA 185
           + F         + +   H           ++ ++ ++    + +  +LT+RE  CL  A
Sbjct: 136 LSFAHSEKDNYIDSLF-LHACMNIPLIVPSLVDNYRKINIANNKSNNDLTKREKECLAWA 194

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +G +S +I++ LG S  TV  +L +A +KL+  NR Q+I+KAI  G I
Sbjct: 195 CEGKSSWDISKILGCSKRTVTFHLTNAQMKLNTTNRCQSISKAILTGAI 243


>gi|330942061|gb|EGH44732.1| transcriptional regulator LasR [Pseudomonas syringae pv. pisi str.
           1704B]
          Length = 239

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/224 (16%), Positives = 71/224 (31%), Gaps = 10/224 (4%)

Query: 18  SPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFL 77
                 ++    A            D          L +Y      I +    +  D  +
Sbjct: 17  RSWFEALKANTCALGCDGLLFALKSDGNADNSQAALLSDYSQAWRAIYDANDYSRIDPVV 76

Query: 78  FHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSE 137
            H  S   PI+W     +T +            G     G++ P+     + G +    +
Sbjct: 77  SHCMSSTSPIVWNDSIFKTPL---QLEFREESKGHGVVQGVSLPLHGMAGQVGVLSVRLD 133

Query: 138 FLMLA------NEVIIEAHGACYQVITDFLEL-FKKRSSAARNLTERETSCLQLAGDGYT 190
            +           ++          +  FL L  ++  +    L+ RE   L+ +  G T
Sbjct: 134 SIPQHQLKYHIARILPGLALIRDYAVDTFLSLADEREPNNIVQLSHRELEVLKWSAFGKT 193

Query: 191 SEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           + EIA  L  S   +N +      K +  +R  AI KA++ G +
Sbjct: 194 TWEIARILSCSEANINYHFAKVRKKFNVGSRRMAIVKALQTGLL 237


>gi|159044364|ref|YP_001533158.1| putative transcriptional regulator [Dinoroseobacter shibae DFL 12]
 gi|157912124|gb|ABV93557.1| putative transcriptional regulator [Dinoroseobacter shibae DFL 12]
          Length = 265

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 41/193 (21%), Positives = 66/193 (34%), Gaps = 2/193 (1%)

Query: 44  FPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQ 103
                +     H +  +  DI         D          +P +W  + E T +     
Sbjct: 65  VSATPRFHIIAHGFPREWVDIYVDDHLYEIDPIPALAQRRAVPFLWSEVAELTRLAEEQA 124

Query: 104 LSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLA--NEVIIEAHGACYQVITDFL 161
             +          G+A  V     ++GYV               + E       +     
Sbjct: 125 AFLERSMPARVGDGVAIQVFGPNMRHGYVGMGFGDRPRDVTAPQLAEYQLVSQLMHLRAC 184

Query: 162 ELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNR 221
            L ++R+ +   L+ RET  L     G +   IA+ LGLS HTV+  +     KL+  +R
Sbjct: 185 RLIEERNRSEIALSARETEVLGWMARGKSKTVIADILGLSPHTVDTLVRRIFRKLEVFDR 244

Query: 222 IQAIAKAIRFGYI 234
             AI KAI  G +
Sbjct: 245 TAAILKAINLGLV 257


>gi|330879513|gb|EGH13662.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 254

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 51/248 (20%), Positives = 91/248 (36%), Gaps = 14/248 (5%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARN--FALYTINSALDFPRRQQLICELHNYD 58
           +S+     + +S+L +      L+ + +      +    +  + D       +  L N  
Sbjct: 5   LSDFNSRLQSASTLDQQMDCALLLASDLGFDAVIYDYSPVPVSHDGALITPSLLSLRNTP 64

Query: 59  LDSGDIPNILIETYGDDFLFHFNSGLLPIIWQ-----SIQEETVIESSGQLSVRLEGGLL 113
            D   +         D       + + P +W          +T I    +  VR      
Sbjct: 65  ADWHALWCSQGYYQIDPVQHLAVASVSPFVWSYQPRAETVLQTFITDMHKPVVRYLHDSH 124

Query: 114 PFAGIAFPVRLGFHKNGYVIFTSEF-----LMLANEVIIEAHGACYQVITDFLELFKK-- 166
              G+  P+ +       +           L  A + + E     +        LF +  
Sbjct: 125 MTCGVTVPIHMPKGGFATLTGLCSDSSDVALEDARQSLAEFGLLAHAFQEVAYPLFDQKM 184

Query: 167 RSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIA 226
           RS  A  LT RE  CL  + +G T+ EIA++L  SV T+  +L SA  KL A NR+QA+ 
Sbjct: 185 RSCNAIKLTRRERECLSWSAEGLTAREIADQLNRSVATITLHLNSAMQKLGAKNRVQAVV 244

Query: 227 KAIRFGYI 234
           +A+ +  +
Sbjct: 245 RAVHYRLL 252


>gi|209886745|ref|YP_002290602.1| transcriptional regulator, LuxR family [Oligotropha carboxidovorans
           OM5]
 gi|209874941|gb|ACI94737.1| transcriptional regulator, LuxR family [Oligotropha carboxidovorans
           OM5]
          Length = 195

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/178 (21%), Positives = 62/178 (34%)

Query: 57  YDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFA 116
           +                D  +           W    +      + +             
Sbjct: 17  FPDGWAARYLDQNYLPRDPIVGRLQKDRNAFSWSESYKSCPEPDNVRAVGGEAADFGLVE 76

Query: 117 GIAFPVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTE 176
           G   P+     +   + F      L+N             I  +L L + R +  + L+ 
Sbjct: 77  GFVIPITTLDQRIAALSFGGARDDLSNRDRSALIFLANFAIGHWLYLRRPRPTCNKTLSP 136

Query: 177 RETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           RE  CL  AG+G T  EI+  LG+S  TV  ++ SA  KL+AVN+  AIA A+R   +
Sbjct: 137 RELDCLLWAGEGKTDWEISVILGISRSTVTKHITSAREKLNAVNKPHAIAIAMRLKIL 194


>gi|331092883|ref|ZP_04586362.2| putative LuxR family regulatory protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331125377|ref|ZP_04592751.2| putative LuxR family regulatory protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331020753|gb|EGI00810.1| putative LuxR family regulatory protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331027159|gb|EGI07214.1| putative LuxR family regulatory protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 235

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 42/216 (19%), Positives = 77/216 (35%), Gaps = 8/216 (3%)

Query: 24  IQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSG 83
           ++  +    +  Y ++    F   +     +  Y LD             D  + H    
Sbjct: 21  LRKVLCRLGYKTYLLSI-GGFTTNEPSNRIITTYPLDWLKCYEDENFILIDPIVKHCRRH 79

Query: 84  LLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLAN 143
            +P+ W   +      S      R         G++ P+R       + +          
Sbjct: 80  FMPLFWGGARRRARGRSKE--FWRARERHGLSQGVSIPLRCREMLGSFNVAHPVDSNEEF 137

Query: 144 EVII-----EAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKL 198
           +  +             ++       K     + +LT RET  L+ +G G T+ EI+  L
Sbjct: 138 DDEVNVTFGVLFMLVPFLLEGSQRHLKAPGEQSCSLTMRETEVLKWSGAGKTTWEISRIL 197

Query: 199 GLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           G S  TVN ++ +A+ KL A NR+QA+  A+   +I
Sbjct: 198 GCSERTVNFHIANASRKLGASNRLQAVGMALAQEFI 233


>gi|182679457|ref|YP_001833603.1| LuxR family transcriptional regulator [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182635340|gb|ACB96114.1| transcriptional regulator, LuxR family [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 239

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 44/222 (19%), Positives = 73/222 (32%), Gaps = 7/222 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
            SL  +  R+      +    F L+T ++A +    +++     ++      +   L   
Sbjct: 20  DSLSVIQDRIRAFAGPLGYDRFVLFTASAARE-DVVERIYWVEGDWFGTGEAVD-ALTYI 77

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
                  H      P  W   + E+        + R  G      G+  P+       G 
Sbjct: 78  RRCPVNRHILEVSEPFFWTKTRSESGELYQVVRTPRGRG----VHGLQIPIFGPSGLEGA 133

Query: 132 VIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKR-SSAARNLTERETSCLQLAGDGYT 190
           +    E +  + +  +               L +   SSA   L+ RE   L     G  
Sbjct: 134 MSLGGERIDASPQARLALSLVGTAAFLSARRLLEAPNSSATAKLSHREREILAWTAAGRR 193

Query: 191 SEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFG 232
             +IA  LGLS  TV  +L     +L  +   QAI  AIR G
Sbjct: 194 QADIAATLGLSERTVENHLRRIRRRLAVMTTAQAIRVAIRNG 235


>gi|302878668|ref|YP_003847232.1| transcriptional regulator, LuxR family [Gallionella
           capsiferriformans ES-2]
 gi|302581457|gb|ADL55468.1| transcriptional regulator, LuxR family [Gallionella
           capsiferriformans ES-2]
          Length = 243

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 44/207 (21%), Positives = 69/207 (33%), Gaps = 11/207 (5%)

Query: 36  YTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEE 95
             I      P   +   +  NY  D  +        + D    H  S   P+IW     +
Sbjct: 37  LAILPDPRAPIEAEHAFQQSNYSADWLNKYTAEKLHHVDPTFSHCISKSTPLIWS---PK 93

Query: 96  TVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSE---FLMLANEV---IIEA 149
                  +       G    +G+  P+     + G V F S+         +    + E 
Sbjct: 94  IFSAQKQKEMYEEACGYGVKSGVTLPIHGAKGELGIVCFVSDTKPDKRFHRDANHHLPEL 153

Query: 150 HGACYQVITDFLELFKKRSSAARNL--TERETSCLQLAGDGYTSEEIAEKLGLSVHTVNA 207
                 ++   L+  K        +  T RE  CL+ +  G +S EI   L  +  TVN 
Sbjct: 154 ACFRDFILESSLQFMKPSRQVENPISVTHRELECLKWSASGKSSWEIGHILNCTEATVNF 213

Query: 208 YLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +  +   K    +R QAI KAI  G I
Sbjct: 214 HFSNIRRKFSTTSRQQAIVKAISLGLI 240


>gi|218677689|ref|ZP_03525586.1| transcriptional regulator, LuxR family protein [Rhizobium etli CIAT
           894]
          Length = 240

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 70/224 (31%), Gaps = 4/224 (1%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           ++  E+   +  +   +    F   T+ +  +       I  + N+  +  D  +     
Sbjct: 18  NTHYEVFKYMKGLTQDLGMNAFLFMTLPTVDNVEIGATKI--ITNWPAEMVDYYDAHSLL 75

Query: 72  YGDDFLFHFNSGLLPIIWQ-SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
                +        P  +          E      + L        G  FPV       G
Sbjct: 76  IDSPVIRRMLRSTSPFNYDVEAINTNRGEGKKSTVIELFFRYGMEKGAYFPVHDAAGGRG 135

Query: 131 YVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYT 190
            +  +        E + +       +     +L           T  E  CL+L   G  
Sbjct: 136 AMSISGPRNFSMIE-MAKLLFIATLIYDRLSQLTLNEKHKPIEFTPGELDCLRLTAGGRK 194

Query: 191 SEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             EIA+ L L+ + VN ++GSA  KL    R QA+  A+R   I
Sbjct: 195 GSEIAKLLDLTENVVNNHIGSAIKKLGCTTRTQAVVSALRLNII 238


>gi|20804002|emb|CAD31579.1| PROBABLE TRANSCRIPTIONAL REGULATOR PROTEIN [Mesorhizobium loti R7A]
          Length = 241

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/230 (16%), Positives = 69/230 (30%), Gaps = 13/230 (5%)

Query: 4   NTLTGKKSSSLQ--ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDS 61
            TL  + S S+   +    L           FA  ++        R      + NY    
Sbjct: 6   ETLLEQLSLSVDEVDFHNALASAAGAFDIPAFAYLSL-----VSDRVTKPRLISNYHSGW 60

Query: 62  GDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFP 121
                       D  +        P  W        I +  Q             G+  P
Sbjct: 61  TSHYLRHQYERIDPVIEWARCSEYPFQWGPDFGHAGISTRQQQLFDEAAEFGICCGLTIP 120

Query: 122 VRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKR------SSAARNLT 175
           +         + F ++ L      + E +    +++     +  +R      +    +LT
Sbjct: 121 LVDRRGGVAAMTFAADRLDPTFLRVAEKYEQALEIMAMCFHIGVRRKLSCGLAVDGVSLT 180

Query: 176 ERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAI 225
            RE  CL+    G ++ EI   LG+   T   +L +A  KL    + QA+
Sbjct: 181 PREYECLEWTAKGKSAWEIGCILGIKERTAAFHLDNAKKKLGVRTKNQAV 230


>gi|307141914|gb|ADN34749.1| transcriptional activator CmrR [Pseudomonas sp. CMR12a]
          Length = 235

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 37/226 (16%), Positives = 74/226 (32%), Gaps = 16/226 (7%)

Query: 13  SLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETY 72
           S  ++  R+      ++   F        + FP  ++ +   +NY        +      
Sbjct: 17  SESQIVKRIQEAATMLE---FEYCAYGLQVIFP--EEKVVMFNNYPRQWQRRYDTENYLA 71

Query: 73  GDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYV 132
            D  +        PIIW        +     +            G +            +
Sbjct: 72  IDPIVAQGRQSQTPIIWAD-----SVSREAPIFWEEARAAGLKVGWSQSSINAAGAASML 126

Query: 133 IFTSEFLMLANEVI----IEAHGACYQVITDFL-ELFKKRSSAAR-NLTERETSCLQLAG 186
             +     +  + +    I+               +  + ++     LT RE   L+  G
Sbjct: 127 SLSRSSQPITRQELDANEIKMRWLVNVAHLALSNRISTRLANPYEVKLTSREKEVLKWTG 186

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFG 232
            G TS EI+  L +S +TVN ++ ++ +KL A N+  A+ +A   G
Sbjct: 187 SGKTSFEISCLLAISENTVNFHIKNSILKLSAANKTAAVIQAFLTG 232


>gi|304394107|ref|ZP_07376030.1| transcriptional activator protein ahyr/asar [Ahrensia sp. R2A130]
 gi|303293547|gb|EFL87924.1| transcriptional activator protein ahyr/asar [Ahrensia sp. R2A130]
          Length = 240

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 54/230 (23%), Positives = 95/230 (41%), Gaps = 6/230 (2%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNI 67
             +  +  ++      + N   A  F++ T++           +  ++N+D +   + + 
Sbjct: 13  ISRLETAYDVFRYARRLGNDFGASRFSILTLDKQTSAI---SDLGVVNNWDPELIAVYDE 69

Query: 68  LIETYGDDFLFHFNSGLLPIIWQ-SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
              +     L HF +G   + +      +     S  L+  L        G   PV  G 
Sbjct: 70  NGLSKASPVLGHFETGNRVMTYDMDTMLQERAPESAALARELFNDFDMKYGACCPVNDGK 129

Query: 127 HKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAAR--NLTERETSCLQL 184
              G ++F+   L+L  +     H     +    +++     + +   +L+ RE  CL  
Sbjct: 130 GNRGGLVFSGNELVLNPDDGAMLHLLSNYLYDHLVQISATSVTRSEMPSLSGREMDCLSH 189

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           A  G TS+E A  L LS HTV  YL  A  KL+AVNR+ A+AKA+R G +
Sbjct: 190 AALGKTSKETARDLELSDHTVTHYLALACKKLEAVNRVHAVAKALRLGLL 239


>gi|188534209|ref|YP_001908006.1| Regulatory protein [Erwinia tasmaniensis Et1/99]
 gi|188029251|emb|CAO97128.1| Regulatory protein [Erwinia tasmaniensis Et1/99]
          Length = 240

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 42/243 (17%), Positives = 87/243 (35%), Gaps = 15/243 (6%)

Query: 2   SEN-TLTGKKSSSLQE----LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHN 56
           SEN  +      S  +    ++    +I+ ++K      Y++      P  +       N
Sbjct: 3   SENYFIWRADLKSAYDNGSGIAHITRVIEQQLKELELDFYSLFIRHPVPFTRPKTFLYSN 62

Query: 57  YDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFA 116
           Y  +  +          D  L   +      +W      +     GQ           + 
Sbjct: 63  YPQNWLEHYWREDFYQLDPVLKICSVPGKVWLWDDEDLSS-----GQRVFDDARIHGIYH 117

Query: 117 GIAFPVRLGFHKNGYVIFTS----EFLMLANEVIIEAHGACYQVITDFLELFKKRSSAAR 172
           GI+  V       G +  ++    + ++L  E+ ++        +   +++     +  +
Sbjct: 118 GISCSVMASNRSVGILSMSTANALKNIVLTPEIELKIQYISELTMAALIDINDISMATTK 177

Query: 173 -NLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRF 231
            +L+ERE   L+   +G TS EI+  L +S +TVN +      + +A N+ Q  + A   
Sbjct: 178 LDLSERELEVLKWTAEGKTSAEISLILSISQNTVNFHQKKMQKRFNAPNKTQIASYAAAI 237

Query: 232 GYI 234
           G I
Sbjct: 238 GLI 240


>gi|323139012|ref|ZP_08074072.1| Autoinducer-binding domain protein [Methylocystis sp. ATCC 49242]
 gi|322395766|gb|EFX98307.1| Autoinducer-binding domain protein [Methylocystis sp. ATCC 49242]
          Length = 267

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 79/231 (34%), Gaps = 11/231 (4%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
           ++  ++  S  +    N     N A   +N       R         Y ++         
Sbjct: 27  RADRVEAASDIITGFTNAWGLHNVAYAALNMPSPGAARP---LLSMTYSVEWQKHYAQSG 83

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
               D  +     G+LPI W  I     I          +   +   G++ P+R    + 
Sbjct: 84  YVDIDPIVRSGLGGILPIDWSEIDRGDPIIRK--FFGEAQELDVGANGMSIPIRGRHGEF 141

Query: 130 GYVIFTSEFLMLAN-----EVIIEAHGACYQVITDFLELFKKRSSAAR-NLTERETSCLQ 183
                TS    L       ++I +     +      L    + +     +L  RE SCL+
Sbjct: 142 ALFTVTSNENALEWRAIRRDLIRDLMVVAWNFHAAALRSCGELAEPGDVHLPLREASCLR 201

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G T EEI   L +S HTV  +L SA  +L+  N    +AKA+  G I
Sbjct: 202 WKALGKTDEEIGRILVISPHTVRFHLESARARLNTANTTHTVAKALALGLI 252


>gi|161724877|emb|CAO85750.1| LasR protein [Pseudomonas aeruginosa]
          Length = 239

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 44/246 (17%), Positives = 74/246 (30%), Gaps = 23/246 (9%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLD 60
           + +  L  ++SS   E S  L  + + +                 +  +    + NY   
Sbjct: 3   LVDGFLELERSSGKLEWSAILQKMASDLGFSKILF---GLLHKDSQDYENAFIVGNYPAA 59

Query: 61  SGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAF 120
             +  +       D  +      +LPI W   +                       G+  
Sbjct: 60  WHEHYDRTGYARVDPTVSQCTQNVLPIFW---EASIYQTRKQHEFFEEASAAGLVYGLTM 116

Query: 121 PVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLEL------------FKKRS 168
           P+     + G +  +     +  E   EA+     V+     L            F+   
Sbjct: 117 PLHGARGELGALSLS-----VEAENRAEANRFMESVLPTLWMLKDYALQSGAGLAFEHPV 171

Query: 169 SAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKA 228
           S    LT RE   LQ    G TS EI+     S   VN ++G+   K    +R  A   A
Sbjct: 172 SKPVVLTSREKEVLQWCAIGKTSWEISVICNCSEANVNFHMGNIRRKFGVTSRRVAAIMA 231

Query: 229 IRFGYI 234
           +  G I
Sbjct: 232 VNLGLI 237


>gi|86356800|ref|YP_468692.1| transcriptional regulator protein [Rhizobium etli CFN 42]
 gi|86280902|gb|ABC89965.1| probable transcriptional regulator protein [Rhizobium etli CFN 42]
          Length = 240

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 43/226 (19%), Positives = 72/226 (31%), Gaps = 8/226 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           ++  E+   +  +   +    F + T+ +          I  + N+  +  D  +     
Sbjct: 18  NTHYEVFKYMKGLTQGLGMTAFLIMTLPTVDFVEIGATKI--ITNWPAEMVDYYDAHNLM 75

Query: 72  YGDDFLFHFNSGLLPIIWQ-SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
                +        P  +          E      + L        G  FPV       G
Sbjct: 76  VDSPVIRRMLRSTSPFNYDVEAINTDRGEGKKSTVIDLFRRYGMEKGAYFPVHDAAGGRG 135

Query: 131 YVIFTSEFLMLANEVIIEAHGACYQVITDF--LELFKKRSSAARNLTERETSCLQLAGDG 188
            +  +      +   + +       +      L L +K    A   T+ E  CL+L   G
Sbjct: 136 AMSISGSR-NFSMVEMAKLLFIATLIYDRLSQLTLNEKHKPVA--FTQSELDCLRLTAGG 192

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             S EIA+ L LS   VN  +GS   KL    R QA+  A+R   I
Sbjct: 193 RKSSEIAKLLDLSESAVNNQIGSVIRKLGCTTRTQAVVSALRLNII 238


>gi|13475096|ref|NP_106660.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
 gi|14025847|dbj|BAB52446.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
          Length = 241

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 39/230 (16%), Positives = 69/230 (30%), Gaps = 13/230 (5%)

Query: 4   NTLTGKKSSSLQ--ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDS 61
            TL  + S S+   +    L           FA  ++        R      + NY    
Sbjct: 6   ETLLEQLSLSVDEVDFHNALASAAGAFDIPAFAYLSL-----VSDRVTKPRLISNYHSGW 60

Query: 62  GDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFP 121
                       D  +        P  W        I +  Q             G+  P
Sbjct: 61  TSHYLRHQYERIDPVIEWARCSECPFQWGPGLGHAGISTRQQQLFDEAAEFGICCGLTIP 120

Query: 122 VRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITD------FLELFKKRSSAARNLT 175
           +         + F ++ L      + E +    +++          +L +  +    +LT
Sbjct: 121 LVDRRGGVAAMTFAADRLDPTFLRVAEQYEQALEIMAMCFHIGVRRKLARGLAVDGVSLT 180

Query: 176 ERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAI 225
            RE  CL+    G ++ EI   LG+   T   +L +A  KL    + QA+
Sbjct: 181 PREYECLEWTAKGKSAWEIGCILGIKERTAAFHLDNAKKKLGVRTKNQAV 230


>gi|218463347|ref|ZP_03503438.1| transcriptional regulator, LuxR family protein [Rhizobium etli Kim
           5]
          Length = 240

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 38/223 (17%), Positives = 66/223 (29%), Gaps = 4/223 (1%)

Query: 13  SLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETY 72
           +  E+   +  +   +    F   T+ +          I  + N+  +  D  +      
Sbjct: 19  THYEVFKYMKGLTQDLGMNAFLFMTLPTVDIVEIGATKI--ITNWPAEMVDYYDAHNLMI 76

Query: 73  GDDFLFHFNSGLLPIIWQ-SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
               +        P  +                 + L        G  FPV       G 
Sbjct: 77  DSPVIRRMMRSTSPFNYDVEAINTNRGGGKKSTVIELFNRYGMEKGAYFPVHDAAGGRGS 136

Query: 132 VIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTS 191
           +  +        E + +       +     +L           T  E  CL+L   G   
Sbjct: 137 MSISGSRNFSMIE-MAKLLFIATLIYDRLSQLTLNEKHKPIEFTRSELDCLRLTAGGRKG 195

Query: 192 EEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            EIA+ L L+ + VN ++GS   KL    R QA+  A+R   I
Sbjct: 196 NEIAKLLDLTENAVNNHIGSVIKKLGCTTRTQAVVSALRLNII 238


>gi|330809090|ref|YP_004353552.1| response regulator, NarL family [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327377198|gb|AEA68548.1| putative response regulator, NarL family [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 272

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/226 (17%), Positives = 83/226 (36%), Gaps = 13/226 (5%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFP-RRQQLICELHNYDLDSGDIPNILIETYGD 74
           +    L+ +  ++    F  Y I+     P     L   +  +     +          D
Sbjct: 34  DWERLLNKVLRQL---GFGSYLISLGPVAPRDTDPLAGLITTFPKRWLEHYRCDGLIEID 90

Query: 75  DFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
             L H    L+P+ W    E        +            +G++ P+R      G +  
Sbjct: 91  PILRHCRRELVPLFWD--SERRRARGRSRHFWEQREQHGLRSGVSIPLRY-EMLRGTLSV 147

Query: 135 TSEFLMLANE------VIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDG 188
             +   +  +       + +       ++       ++ +   ++LT +E  CL  A +G
Sbjct: 148 AFDDTQITEQKGFSNPAVYQLFMLIPYLLAGIRHQLQRPAQPRQDLTPKEMDCLYWASEG 207

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            T+ EI+  L  S  T++ +L +A  KL +V+R QA++ A+  G +
Sbjct: 208 KTTWEISHILTCSERTIDFHLLNARRKLGSVSRQQAVSAAVACGLV 253


>gi|110634656|ref|YP_674864.1| LuxR family transcriptional regulator [Mesorhizobium sp. BNC1]
 gi|110285640|gb|ABG63699.1| transcriptional regulator, LuxR family [Chelativorans sp. BNC1]
          Length = 265

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 47/224 (20%), Positives = 85/224 (37%), Gaps = 1/224 (0%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
            + +E++  L +   R    +     I  +    R Q     L  +  +       L   
Sbjct: 41  RTTEEVNHSLMIFLQRYGVTSLIAGMIPPSNSSRREQLSYVLLDGWPEEWKRRYFSLGYL 100

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
           + D  +     G     W  I+E   +   G+  +         AG+ F       K   
Sbjct: 101 HRDPAIHLVRRGCPHFHWSEIREHCSVCPIGRRIMNEAREFQLRAGVTFSFPTLESKTFG 160

Query: 132 VIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAAR-NLTERETSCLQLAGDGYT 190
            +  +E L LA   +          +   L L       +  +L+ R+   +  A +G T
Sbjct: 161 FLVAAEELDLAETDLFTLQFVAAFGLGCALTLAGGVVGRSNVHLSRRQREVVAWASEGLT 220

Query: 191 SEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           ++EIAE+L +SVHT + +L +   +L   N + A+A+A+R G I
Sbjct: 221 ADEIAERLNVSVHTADMHLRAVRTRLGVANTVHAVAEALRLGLI 264


>gi|107100865|ref|ZP_01364783.1| hypothetical protein PaerPA_01001895 [Pseudomonas aeruginosa PACS2]
 gi|296390203|ref|ZP_06879678.1| transcriptional regulator LasR [Pseudomonas aeruginosa PAb1]
          Length = 223

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 42/231 (18%), Positives = 68/231 (29%), Gaps = 23/231 (9%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           E S  L  + + +                 +  +    + NY     +  +       D 
Sbjct: 2   EWSAILQKMASDLGFSKILF---GLLPKDSQDYENAFIVGNYPAAWREHYDRAGYARVDP 58

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
            + H    +LPI W   +                       G+  P+     + G +  +
Sbjct: 59  TVSHCTQSVLPIFW---EPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGELGALSLS 115

Query: 136 SEFLMLANEVIIEAHGACYQVITDFLEL------------FKKRSSAARNLTERETSCLQ 183
                +  E   EA+     V+     L            F+   S    LT RE   LQ
Sbjct: 116 -----VEAENRAEANRFMESVLPTLWMLKDYALQSGAGLAFEHPVSKPVVLTSREKEVLQ 170

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G TS EI+     S   VN ++G+   K    +R  A   A+  G I
Sbjct: 171 WCAIGKTSWEISVICNCSEANVNFHMGNIRRKFGVTSRRVAAIMAVNLGLI 221


>gi|330941017|gb|EGH43939.1| putative LuxR family regulatory protein [Pseudomonas syringae pv.
           pisi str. 1704B]
          Length = 262

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 47/225 (20%), Positives = 78/225 (34%), Gaps = 11/225 (4%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRR-QQLICELHNYDLDSGDIPNILIETYGD 74
           +    L  +  ++    FA Y I+ +   P     L   +  +     D          D
Sbjct: 16  DWERHLRKVMRQL---GFAHYLISLSPMRPWTGNPLAGVITTFPRTWLDCYCCDGLLDID 72

Query: 75  DFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL-GFHKNGYVI 133
             L H    L+P+ W             +   +         G++ P+R         V 
Sbjct: 73  PILKHCRQELVPMFWAQQGRRARG--RTRHFWQRREEHGLCHGLSIPLRYERLRGTLSVA 130

Query: 134 FTS----EFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGY 189
           F      E    A+            +++     ++  +    +LT RE  CL  A  G 
Sbjct: 131 FDGTGVHEDDGFAHPAAALLFMLVPYLVSGLGRRWQTDNPCNDDLTPRELECLYWASAGK 190

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           TS EI+  L  S  TV+ +L +A  KL +V+R QA+  A   G +
Sbjct: 191 TSWEISHILTRSERTVDFHLLNARRKLGSVSRQQAVGSAAARGLL 235


>gi|150377494|ref|YP_001314089.1| autoinducer-binding domain-containing protein [Sinorhizobium
           medicae WSM419]
 gi|150032041|gb|ABR64156.1| Autoinducer-binding domain protein [Sinorhizobium medicae WSM419]
          Length = 320

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 41/222 (18%), Positives = 65/222 (29%), Gaps = 12/222 (5%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDF 76
           +   +    N      FA            +   +   ++Y  +  DI      +  D  
Sbjct: 107 IKSAVLSFANAHGFERFAY--------LQTQGDDVQTFNSYPEEWQDIYLGSRYSIIDPV 158

Query: 77  LFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTS 136
           +      +    W          S  +            +G+  PV   F     + F S
Sbjct: 159 ITEAKRRMNVFSWTVDDWPARGRSELRRFKDQAVAHGIRSGVTVPVEGSFGSKMMLTFAS 218

Query: 137 EFLMLANEVIIEAHGACYQVITDFLEL----FKKRSSAARNLTERETSCLQLAGDGYTSE 192
                    + +A  A   V+     L         S    L+ RE  CL  A  G    
Sbjct: 219 SERKADVSKLQDAQDAIQAVLVIHYRLKILAAVTIVSPKTMLSPREAMCLMWAMKGKNGP 278

Query: 193 EIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           E A+  G+   TV  YL +A  KL A +    +A A   G +
Sbjct: 279 ETAKITGIKPRTVQHYLDNARRKLGAQSVPHLVAIARDHGLV 320


>gi|146338047|ref|YP_001203095.1| putative N-acyl homoserine lactone transcriptional regulator,
           LuxR-like [Bradyrhizobium sp. ORS278]
 gi|146190853|emb|CAL74858.1| putative N-acyl homoserine lactone transcriptional regulator,
           LuxR-like [Bradyrhizobium sp. ORS278]
          Length = 242

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 41/218 (18%), Positives = 67/218 (30%), Gaps = 2/218 (0%)

Query: 18  SPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFL 77
           +  +   +  I    F  Y +       +  Q     + +  +  ++         D   
Sbjct: 24  ASVITQFEKMICDLGFHAYIMAGVPAPGQSLQQTILANGWPREWFEMYAREQFHRCDPIP 83

Query: 78  FHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSE 137
            H  S L P  W  +  +   +      +          G   P+       G V    E
Sbjct: 84  RHCVSTLNPFAWSEVPYDREDDPGAHEVMMRARDFRLNEGFCVPIHYDD-AVGAVSIAGE 142

Query: 138 FLMLANEVIIEAHGACYQVITDFLELFKKRSS-AARNLTERETSCLQLAGDGYTSEEIAE 196
              LA +     H       +    L +  +    R L+  E   L  A  G T+ E A 
Sbjct: 143 HPNLAPDARGALHLISIFTHSRLRALARATAGNPGRRLSRIEAEVLSWAARGKTAWETAR 202

Query: 197 KLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            LG+S   V  +L  A  KL   N+   +A A+  G I
Sbjct: 203 ILGVSERNVRWHLEEAQRKLATKNKTATVATALVNGEI 240


>gi|148256507|ref|YP_001241092.1| LuxR family transcriptional regulator [Bradyrhizobium sp. BTAi1]
 gi|146408680|gb|ABQ37186.1| transcriptional regulator, LuxR family [Bradyrhizobium sp. BTAi1]
          Length = 242

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 51/232 (21%), Positives = 83/232 (35%), Gaps = 12/232 (5%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
           +++SL ELS  L   ++  +  +      N+       +     L  YD +         
Sbjct: 14  RTTSLSELSNVLSETRHEYELAHLVY---NARHLPRTEEPNPLLLLTYDAEWVQRYKTQD 70

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
               D  + H  + LLP+ W ++  E+                +   G+  P+R    + 
Sbjct: 71  YFQIDPVIKHGLASLLPLDWSNL--ESGEADVRAFFREARSFGVGRNGMTIPIRGPHGER 128

Query: 130 GYVIFTSEFLMLANE-----VIIEAHGACYQVITDFLELFKKRSSAA--RNLTERETSCL 182
                TS       +     ++ +     Y      + L   R      R L+ RE   L
Sbjct: 129 ALFSLTSNLSAGQWQTTRLAMMRDFMIIAYFFHDQAVRLSGMRDLPGMGRPLSRRERETL 188

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           QLA  G+  ++IA  L +S   V  YL +A  KL+     Q IAKAI    I
Sbjct: 189 QLAARGFAPKQIAADLRVSTTAVRLYLQTARTKLECTTLTQGIAKAISLDLI 240


>gi|297489|emb|CAA68561.1| luxR [Aliivibrio fischeri]
          Length = 250

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 90/231 (38%), Gaps = 10/231 (4%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
           K+    +++  L  +   +        T+         +  I  L NY        +   
Sbjct: 17  KACRAYDINQCLSDMTKMVHCEY--YLTLAIIYPHSMVKSDISILDNYPKKWRQYYDDAN 74

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
               D  + + NS   PI W  I E   +       ++         G +FP+    +  
Sbjct: 75  LIKYDPIVDYSNSNHSPINWN-IFENNAVNKKSPNVIKEAKTSGLITGFSFPIHTANNGF 133

Query: 130 GYVIFTSEFLMLANEVIIEAH------GACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
           G + F         + +   H           ++ ++ ++    + +  +LT+RE  CL 
Sbjct: 134 GMLSFAHSEKDNYIDSLF-LHACMNIPLIVPSLVDNYRKINIANNKSNNDLTKREKECLA 192

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A +G +S +I++ LG S  TV  +L +A +KL+  NR Q+I+KAI  G I
Sbjct: 193 WACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKAILTGAI 243


>gi|289628275|ref|ZP_06461229.1| putative LuxR-family regulatory protein [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
          Length = 262

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 47/225 (20%), Positives = 78/225 (34%), Gaps = 11/225 (4%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRR-QQLICELHNYDLDSGDIPNILIETYGD 74
           +    L  +  ++    FA Y I+ +   P     L   +  +     D          D
Sbjct: 16  DWERHLRKVMRQL---GFAHYLISLSPMRPWTGNPLAGVITTFPRTWLDCYCCDGLLDID 72

Query: 75  DFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL-GFHKNGYVI 133
             L H    L+P+ W             +   +         G++ P+R         V 
Sbjct: 73  PILKHCRQELVPMFWAQQGRRARG--RTRHFWQRREEHGLCHGLSIPLRYERLRGTLSVA 130

Query: 134 FTS----EFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGY 189
           F      E    A+            +++     ++  +    +LT RE  CL  A  G 
Sbjct: 131 FDGTGVHEDDGFAHPAAALLFMLVPYLVSGLGRRWQTDNPCNDDLTPRELECLYWASAGK 190

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           TS EI+  L  S  TV+ +L +A  KL +V+R QA+  A   G +
Sbjct: 191 TSWEISHILTRSERTVDFHLLNARRKLGSVSRQQAVGSAAARGLL 235


>gi|192360157|ref|YP_001981723.1| putative two-component transcriptional regulator, LuxR family
           [Cellvibrio japonicus Ueda107]
 gi|190686322|gb|ACE84000.1| putative two-component transcriptional regulator, LuxR family
           [Cellvibrio japonicus Ueda107]
          Length = 238

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 43/226 (19%), Positives = 84/226 (37%), Gaps = 4/226 (1%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           S ++Q L        + I      +  + +     +++     L NY  D  +       
Sbjct: 13  SKNIQSLFNLFEKYMSDIGFDR-VILGLMTDHPRLKKEAEHGFLKNYPADWVERYFDQKY 71

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
            + D         +    W  ++    + +              F G+   +R       
Sbjct: 72  VHIDPVRHKAYDAIGAYTWDELKASMQLSNKQIQMFNEAEDARLFNGVGVSMRGPGGAIA 131

Query: 131 YVI--FTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDG 188
            V    + +   L  +++  A+    Q  T +  L +K+     +LT +E   L  +  G
Sbjct: 132 AVGAACSVKNGNLNKDILDAANLMSVQFYTCYWRLMEKKV-TLVHLTAKEQEILTWSAAG 190

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           YT  +IA KL +SVHTV+ ++ +   KL+A N   A+++A+    I
Sbjct: 191 YTKSQIAHKLCISVHTVDFHVRNCLAKLEAQNITHAVSRALNLSLI 236


>gi|182677912|ref|YP_001832058.1| LuxR family transcriptional regulator [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182633795|gb|ACB94569.1| transcriptional regulator, LuxR family [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 268

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 53/239 (22%), Positives = 87/239 (36%), Gaps = 12/239 (5%)

Query: 3   ENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSG 62
              L  + + S + L      IQ   + +N       S          I  L  Y  +  
Sbjct: 34  TQLLDLEANLSERTLEEFAVFIQKYYELKNIFYIC-PSLPGRTITDPYI--LGTYSQEWI 90

Query: 63  DIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPV 122
           +          D  +      LLPI W  +   +      +         +   G+  PV
Sbjct: 91  EHYRERNYVNLDPVINVGARSLLPIDWAKLPRSSP--KIQKFFGEATDFGVGRQGLTIPV 148

Query: 123 RLGFHKNGYV-IFTSEFLMLAN-----EVIIEAHGACYQVITDFLELFKKRSS-AARNLT 175
           R   +    +   T++           E+I +     + +     E+  +        +T
Sbjct: 149 RGPTNGLWALFCMTTDDTQAEWQARHYELIRDMVHVAHFIQQRAFEMHHQDEGIDINTIT 208

Query: 176 ERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +RE   L  + +G T E+I+  + +S  TV A+L SA  KL A+NRI A+AKAIR G I
Sbjct: 209 KREIEALSWSAEGKTLEDISVLMRISQETVKAHLDSARYKLGALNRIHAVAKAIRAGLI 267


>gi|330870194|gb|EGH04903.1| putative LuxR family regulatory protein [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 280

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 47/225 (20%), Positives = 78/225 (34%), Gaps = 11/225 (4%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRR-QQLICELHNYDLDSGDIPNILIETYGD 74
           +    L  +  ++    FA Y I+ +   P     L   +  +     D          D
Sbjct: 34  DWERHLRKVMRQL---GFAHYLISLSPMRPWTGNPLAGVITTFPRTWLDCYCCDGLLDID 90

Query: 75  DFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL-GFHKNGYVI 133
             L H    L+P+ W             +   +         G++ P+R         V 
Sbjct: 91  PILKHCRQELVPMFWAQQGRRARG--RTRHFWQRREEHGLCHGLSIPLRYERLRGTLSVA 148

Query: 134 FTS----EFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGY 189
           F      E    A+            +++     ++  +    +LT RE  CL  A  G 
Sbjct: 149 FDGTGVHEDDGFAHPAAALLFMLVPYLVSGLGRRWQTDNPCNDDLTPRELECLYWASAGK 208

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           TS EI+  L  S  TV+ +L +A  KL +V+R QA+  A   G +
Sbjct: 209 TSWEISHILTRSERTVDFHLLNARRKLGSVSRQQAVGSAAARGLL 253


>gi|294142230|ref|YP_003558208.1| LuxR family transcriptional regulator [Shewanella violacea DSS12]
 gi|293328699|dbj|BAJ03430.1| transcriptional regulator, LuxR family [Shewanella violacea DSS12]
          Length = 250

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 43/217 (19%), Positives = 70/217 (32%), Gaps = 11/217 (5%)

Query: 24  IQNRIKARNFALYTINSALDFPRRQQLICELHNY-----DLDSGDIPNILIETYGDDFLF 78
           +QN ++    AL T+    D             +       + G+I       Y D  + 
Sbjct: 39  LQNLLEVDGVALITLMIRPDHSI-NIERVVSSGFGFEAKSAEWGNIYQKNKFQYIDPIVS 97

Query: 79  HFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAF-PVRLGFHKNGYVIFTSE 137
              S      W S+     +  S    +     +    G +              I +  
Sbjct: 98  CSKSIRSSFNWTSVPSMMSLSESQLNFLEQAEEMGLKEGASIGSFSSRHIYKELNITSVS 157

Query: 138 FLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEK 197
              L +E +                L    ++    LT+RE   L  + +G +S EI   
Sbjct: 158 GRSLNSEQLATLELINTVSAQAMTRL----TNPVEELTKREREILAWSSEGKSSWEIGMI 213

Query: 198 LGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             ++  TV  +L +   KL+  NR QAI  AIR G I
Sbjct: 214 CSITERTVKFHLKNIYKKLNVQNRAQAIVCAIRQGLI 250


>gi|115265509|dbj|BAF32771.1| transcriptional regulator of LuxR family [Pseudomonas syringae pv.
           actinidiae]
 gi|330965240|gb|EGH65500.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 254

 Score =  131 bits (331), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 51/248 (20%), Positives = 91/248 (36%), Gaps = 14/248 (5%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARN--FALYTINSALDFPRRQQLICELHNYD 58
           +S+     + +S+L +      L+ + +      +    +  + D       +  L N  
Sbjct: 5   LSDFNSRLQSASTLDQQMDCALLLASDLGFDAVIYDYSPVPVSHDGALITPSLLSLRNTP 64

Query: 59  LDSGDIPNILIETYGDDFLFHFNSGLLPIIWQ-----SIQEETVIESSGQLSVRLEGGLL 113
            D   +         D       + + P +W          +T I    +  VR      
Sbjct: 65  ADWHALWCSQGYYQIDPVQHLAVARVSPFVWSYQPRAETVLQTFITDMHKPVVRYLHDSH 124

Query: 114 PFAGIAFPVRLGFHKNGYVIFTSEF-----LMLANEVIIEAHGACYQVITDFLELFKK-- 166
              G+  P+ +       +           L  A + + E     +        LF +  
Sbjct: 125 MTCGVTVPIHMPKGGFATLTGLCSDSSDVALEDARQSLAEFGLLAHAFQEVAYPLFDQKM 184

Query: 167 RSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIA 226
           RS  A  LT RE  CL  + +G T+ EIA++L  SV T+  +L SA  KL A NR+QA+ 
Sbjct: 185 RSCNAIKLTRRERECLSWSAEGLTAREIADQLNRSVATITLHLNSAMQKLGAKNRVQAVV 244

Query: 227 KAIRFGYI 234
           +A+ +  +
Sbjct: 245 RAVHYRLL 252


>gi|159184428|ref|NP_353732.2| LuxR family transcriptional regulator [Agrobacterium tumefaciens
           str. C58]
 gi|159139741|gb|AAK86517.2| transcriptional regulator, LuxR family [Agrobacterium tumefaciens
           str. C58]
          Length = 201

 Score =  131 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 48/198 (24%), Positives = 73/198 (36%), Gaps = 1/198 (0%)

Query: 38  INSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETV 97
           ++ + +          + ++  +     +          +       +P           
Sbjct: 3   LDLSSELASELSQYTVITSWPAELLQRYDEEGMLQNSRVMAQLKKSTIPFSVSMDFLVNG 62

Query: 98  IESSGQL-SVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQV 156
            E       + L         + FPV     + G + F+    +L    + E       V
Sbjct: 63  EEHIANKTVIGLFERFEMVNSVWFPVHDVTMRRGAISFSGNKAVLPTTRLAELLYISCHV 122

Query: 157 ITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKL 216
                E+ +        L+ERE  CL     G TS EIAE + LS HT+N YL  AT KL
Sbjct: 123 FARLSEIRRLDLRVPETLSEREIDCLNWTAAGKTSAEIAEIMMLSEHTINHYLNRATKKL 182

Query: 217 DAVNRIQAIAKAIRFGYI 234
           D VNR QA+AKA+R G I
Sbjct: 183 DTVNRTQAVAKALRVGLI 200


>gi|167035632|ref|YP_001670863.1| LuxR family transcriptional regulator [Pseudomonas putida GB-1]
 gi|166862120|gb|ABZ00528.1| transcriptional regulator, LuxR family [Pseudomonas putida GB-1]
          Length = 235

 Score =  131 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 34/222 (15%), Positives = 66/222 (29%), Gaps = 10/222 (4%)

Query: 18  SPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFL 77
                +  +  +        +N  +    +   +    NY  +  +          D   
Sbjct: 19  QKLFDIAVHLAQELGMDYLGLNIRIQIATQTPRLYLYSNYPSEWIERYQRDDFYKQDPAA 78

Query: 78  FHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSE 137
              +S   P++W         +                 G    +    H    +     
Sbjct: 79  HMSHSSTTPVLWTDDLYRDAPQ-----FREAACQHGLRHGWTQSLHDLQHNESQISVARP 133

Query: 138 FLMLANEVIIE----AHGACYQVITDFLELFKKRS-SAARNLTERETSCLQLAGDGYTSE 192
              +    + +        C+ +     E            ++ERE   L+ +  G T+ 
Sbjct: 134 AEKIDIVELYDKAGSVQWLCHTLHAVLGEHHLNALCPPQPRMSERELEVLKWSAAGKTAA 193

Query: 193 EIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           ++A  L LS  TVN ++ S   K +A N+  AIA A   G+I
Sbjct: 194 DVACILSLSQSTVNFHIRSVITKTNAANKAGAIAIAALRGWI 235


>gi|148241069|ref|YP_001220570.1| LuxR family transcriptional regulator [Bradyrhizobium sp. BTAi1]
 gi|146411445|gb|ABQ39898.1| transcriptional regulator, LuxR family [Bradyrhizobium sp. BTAi1]
          Length = 243

 Score =  131 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 37/233 (15%), Positives = 73/233 (31%), Gaps = 17/233 (7%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           + + ++         + +  R FA +   +             + +Y             
Sbjct: 18  AHTEEDFRRVAERTAHALGFRWFAYFGHRANGPK--------LISSYPKSWTSHYFREGY 69

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
              D  L    +     +W   +  +      +             G+   +    ++  
Sbjct: 70  DNIDPVLQEPRNTSRMFLWDGREARSAKSPKERRLFDDALSFKIRTGLTVRIPSSQNQFA 129

Query: 131 YVIFTSEFLML-------ANEVIIEAHGACYQVITDFLELFKKRSS--AARNLTERETSC 181
                ++   L        ++ ++E  G  Y        + +          LT+RE  C
Sbjct: 130 AFTLAADDRSLGLDRFIETSQDMLEMVGLTYHAHVSAARIGRTPPDGQQGSPLTQRERQC 189

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           L    DG T ++IAE LG+S   V  +L +A   L A+    A+A A R G +
Sbjct: 190 LAWISDGKTMQDIAELLGVSPRGVKFHLDNARRNLAALTLPHAVALAFRQGLL 242


>gi|159185350|ref|NP_355660.2| LuxR family transcriptional regulator [Agrobacterium tumefaciens
           str. C58]
 gi|159140603|gb|AAK88445.2| transcriptional regulator, LuxR family [Agrobacterium tumefaciens
           str. C58]
          Length = 245

 Score =  131 bits (330), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 45/236 (19%), Positives = 71/236 (30%), Gaps = 13/236 (5%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
            ++ S   +      +        F  + ++  +             +      ++    
Sbjct: 12  SQAGSADRVRSEFAKLIREY---GFEYFLVSRRMTGELASAGQILAEHLPDGWLEVYRAK 68

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQE---ETVIESSGQLSVRLEGGLLPFAGIAFPVRLG 125
                D           P  W+   E     +      +     G      G AFPV   
Sbjct: 69  KYNLVDPVRKVIGMVHKPFQWKEALEGLPRAMHRKRASVFFHDAGRYGLQGGYAFPVHGR 128

Query: 126 FHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSS-------AARNLTERE 178
               G V        L +  +     A   V    L+L  +          +A  LT RE
Sbjct: 129 AGFIGAVFIGGPDRQLPSLHVELLDAATRAVFWRLLDLSGQAHGFSNAPDVSALELTRRE 188

Query: 179 TSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              L L  DG TS EI  +L +S HTV+ Y+     +  A NR   +A A R G +
Sbjct: 189 MEVLALMADGMTSTEIGRQLSISNHTVDWYINGIQRRFSAKNRQHTVALAFRHGLL 244


>gi|94496793|ref|ZP_01303368.1| hypothetical protein SKA58_16678 [Sphingomonas sp. SKA58]
 gi|94423806|gb|EAT08832.1| hypothetical protein SKA58_16678 [Sphingomonas sp. SKA58]
          Length = 256

 Score =  131 bits (330), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 51/238 (21%), Positives = 89/238 (37%), Gaps = 7/238 (2%)

Query: 1   MSENTLTG-KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDL 59
           ++++ L   +K +S +EL+  +  + + I  R+FAL   +        +    ++ +Y  
Sbjct: 11  LADDLLRALRKVASREELAALMTCLASEIGFRHFALIHHD---PLAGERPDRVDIRDYPA 67

Query: 60  DSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIA 119
              D      +   D  +          +W  + +        + S+    G     GI 
Sbjct: 68  AIVDRLFDQGQLRRDPVIRGCLFSDGAFLWSDLDKIITFTRQDRHSLEFGAGHGLNEGIT 127

Query: 120 FPVRLGFHKNGYVIFTS-EFLMLANEVIIEAHGACYQVITDFLE--LFKKRSSAARNLTE 176
            P  L     G   F       LA+  +  A               L       A  L  
Sbjct: 128 VPHVLLGECIGSCTFAGATDPQLASRYLGFAQITGIFAFQAARRMLLASPLIGPAPRLHP 187

Query: 177 RETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           R   C+ LAG G++++EIA +LGL+  TV+ YL  A    DA +R + +  A+  G I
Sbjct: 188 RPRDCVVLAGRGFSNKEIARELGLTPRTVDGYLTEARRLFDAHDRAELVVSAVLAGEI 245


>gi|197344631|gb|ACH69663.1| LuxR family transcriptional regulator [uncultured bacterium]
          Length = 238

 Score =  131 bits (330), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 40/187 (21%), Positives = 63/187 (33%), Gaps = 9/187 (4%)

Query: 53  ELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGL 112
               Y      + N     Y D  + H  +   PI W     +    +S    +      
Sbjct: 55  ITSGYPEQYRHLYNDKGFIYRDPSVVHCQTRTDPIFWNESMYD----ASSYEIMEESQRF 110

Query: 113 LPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVI-----IEAHGACYQVITDFLELFKKR 167
               G + PVR        +    +      E+       +       V+   + +    
Sbjct: 111 GLGHGFSVPVRESDKVVSMISLARDQPFTKQELEYIVPTAKVLATVMHVVAQKIIVPSMI 170

Query: 168 SSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAK 227
            S    L+ RE  CL+    G ++  IA+ L +S  TV  YL  A  KL    R+QA+A 
Sbjct: 171 ESRQPRLSPRELECLRWVAQGKSNTVIADILKISDDTVAFYLRGALRKLGVSTRMQAVAL 230

Query: 228 AIRFGYI 234
            + FG I
Sbjct: 231 CVTFGLI 237


>gi|209548400|ref|YP_002280317.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534156|gb|ACI54091.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 240

 Score =  131 bits (330), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 39/224 (17%), Positives = 70/224 (31%), Gaps = 4/224 (1%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           ++  E+   +  +   +    F + T+ +          I  + N+  +  D  +     
Sbjct: 18  NTHYEVFKYMKGLTQDLGMTAFLIMTLPTVDFAEIGATKI--ITNWPAEMVDYYDAHNLM 75

Query: 72  YGDDFLFHFNSGLLPIIWQ-SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
                +        P  +          E      + L        G  FPV       G
Sbjct: 76  VDSPVIRRMLRSTSPFNYDVEAINTDRGEGKKSTVIELFNRYGMEKGAYFPVHDAAGGRG 135

Query: 131 YVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYT 190
            +  +        E + +       +     +L           T  E  CL+L   G  
Sbjct: 136 AMSISGSRNFSMIE-MAKLLFIATLIYDRLSQLTLNEKHKPIEFTRNELDCLRLTAGGRK 194

Query: 191 SEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             EIA+ L L+ + VN ++GSA  KL    R QA+  A+R   +
Sbjct: 195 GAEIAKLLDLTENAVNNHIGSAIKKLGCTTRTQAVVSALRLNIL 238


>gi|319781695|ref|YP_004141171.1| LuxR family transcription regulator [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167583|gb|ADV11121.1| regulatory protein LuxR [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 256

 Score =  131 bits (330), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 64/226 (28%), Positives = 102/226 (45%), Gaps = 5/226 (2%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           + ++ +   R   I   + A  F L+ ++ + +    + + C   +Y   +      +  
Sbjct: 33  AVTIPDAVRRCRWIAVDMNASAFGLFFVSPSPERA--RLVPCFDSDYPGIAVAT-KFISG 89

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLP--FAGIAFPVRLGFHK 128
             G++ + H      P  W         E  G  +       L    +GIAFPV     +
Sbjct: 90  ANGEEIVRHTRISTEPRWWTDDGVPATAELFGDFAWTERMAALVPGTSGIAFPVHADRGQ 149

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDG 188
            G V+F    + L  + + E H  C+ +      +    +   R +++RE  CL+L  +G
Sbjct: 150 CGLVVFLGSEMTLQQDALYEVHARCFSLFAAVARIRPGDAGRMRAISKRELECLKLTANG 209

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            TSEEIA  L LSVHT N YL  +T KL+AVNR QA+AKA+R G I
Sbjct: 210 NTSEEIARLLKLSVHTANQYLTQSTQKLNAVNRNQAVAKALRLGLI 255


>gi|194365353|ref|YP_002027963.1| LuxR family transcriptional regulator [Stenotrophomonas maltophilia
           R551-3]
 gi|194348157|gb|ACF51280.1| transcriptional regulator, LuxR family [Stenotrophomonas
           maltophilia R551-3]
          Length = 234

 Score =  131 bits (330), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 43/235 (18%), Positives = 75/235 (31%), Gaps = 7/235 (2%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLD 60
           + +  L  +++ SL E+   L  +   +      ++   + L+   ++       ++  D
Sbjct: 4   LVQALLGLERADSLTEVGAILRSVAAPLGYDRVLVFATGTGLERDAQRVY-WIEGDWLGD 62

Query: 61  SGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAF 120
             D        +      H      P  W     +       Q+  +  G  L   G+  
Sbjct: 63  GSDTDLA-RYLHACPVNRHVLDSDAPFFWSKR--QGARGERYQVVKQPRGDGL--HGLQV 117

Query: 121 PVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSS-AARNLTERET 179
           PV       G + F    +  +    +               L +  +      L+ RE 
Sbjct: 118 PVFGTTGLEGAISFAGAAVDASARARLLLEAVATAAFRTARRLAEAPAELPVGALSARER 177

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+    G    EIA  LGLS  TV  +L  A  +L      QA+  A R G I
Sbjct: 178 EVLRWVAAGRRQAEIAATLGLSARTVENHLRRARQRLGVATTAQAVRAASRRGEI 232


>gi|307300496|ref|ZP_07580276.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
 gi|307318361|ref|ZP_07597796.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|306896043|gb|EFN26794.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|306904662|gb|EFN35246.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
          Length = 321

 Score =  131 bits (330), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 54/231 (23%), Positives = 92/231 (39%), Gaps = 4/231 (1%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            +      +  EL   +  + +R    +F +  +  A +    ++L   L N+  +    
Sbjct: 94  EIDPASVRTEYELLHLMRRLISRYGFAHFMIARLPLADEQRFSERL--VLSNWPAELVQQ 151

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQ-SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVR 123
            +        + +       LP+     + E     +     +RL          A  + 
Sbjct: 152 YDAGETFQTSELVERLRQTKLPVTGGPELMEPAGKGAGKAAFIRLPPHAGMGH-FAVLLH 210

Query: 124 LGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
             + +    + +      A       + A  Q+       F   S A   L+ RE  CL+
Sbjct: 211 TTYGEPFVAVLSGTRDEPAGAERATLYLALLQLFECLERTFDAGSGAREKLSSREVECLR 270

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A  G +S+EIA  LG+S +TV++Y  SAT KLDAVNR+QAIA+A+R   I
Sbjct: 271 WAAAGKSSDEIAIILGISAYTVSSYFKSATRKLDAVNRMQAIARAMRMKLI 321


>gi|148549711|ref|YP_001269813.1| autoinducer-binding domain-containing protein [Pseudomonas putida
           F1]
 gi|148513769|gb|ABQ80629.1| transcriptional regulator, LuxR family [Pseudomonas putida F1]
          Length = 235

 Score =  131 bits (329), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 34/222 (15%), Positives = 69/222 (31%), Gaps = 10/222 (4%)

Query: 18  SPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFL 77
                +  +  +  +     +N  +    +   +    NY  +  +          D   
Sbjct: 19  QKLFDIAVHLAQDLDMDYLGLNIRIQIATQTPRLYLYSNYPSEWIERYQRDDFYKQDPAA 78

Query: 78  FHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSE 137
              +S  +P++W     +   +                 G    +    H    +     
Sbjct: 79  NLSHSSTMPVLWTDDLYKEAPQ-----FRETACQHGLRHGWTQSLHDQQHNESQISVARP 133

Query: 138 FLMLANEVIIE----AHGACYQVITDFLELFKKRS-SAARNLTERETSCLQLAGDGYTSE 192
              +    + +        C+ +     E            ++ERE   L+ +  G T+ 
Sbjct: 134 NGHIDMLELYDKAGSVQWLCHTLHAVLGEHHLNALCPPQPKMSERELEVLKWSAAGKTAA 193

Query: 193 EIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           ++A  L LS  TVN ++ S   K +A N+  AIA A   G+I
Sbjct: 194 DVASILSLSQSTVNFHIRSVITKTNAANKAGAIAIAALRGWI 235


>gi|124268980|ref|YP_001022984.1| LuxR family transcriptional regulator [Methylibium petroleiphilum
           PM1]
 gi|124261755|gb|ABM96749.1| putative LuxR-family transcriptional regulator [Methylibium
           petroleiphilum PM1]
          Length = 237

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 38/232 (16%), Positives = 78/232 (33%), Gaps = 13/232 (5%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
           ++ +  E    +     R+    F   +  + +D P        + N      D      
Sbjct: 11  EARNRDEFRGEVVRFAKRL---GFETVSAITVVDHPVGDTEFVAIDNAPDAYKDAIEDPK 67

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
               D  + H     +PIIW    + T + +        +       GI   + +   ++
Sbjct: 68  AGQLDPVMQHCKRQSVPIIW---DQSTYVSAGQGSMWEAQARFGFRTGICLALHMPEGRH 124

Query: 130 GYVIFTSE-----FLMLANEVIIEAHGACYQVITDFLEL--FKKRSSAARNLTERETSCL 182
             +    +            ++ +            + +   ++       LT RE   L
Sbjct: 125 FVIGVDRDQALPKDRGEVTRLVADLQLFAVHAQDTAMRVLVPERLQLERPKLTPRELDSL 184

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +   DG T+ E+   +G+S  T   ++ +A  KL   N+ QA+ KA+R G +
Sbjct: 185 RWTMDGKTAWEVGSIMGISERTAVLHINNAMHKLACTNKHQAVLKALRLGLL 236


>gi|148255499|ref|YP_001240084.1| putative transcriptional activator [Bradyrhizobium sp. BTAi1]
 gi|146407672|gb|ABQ36178.1| putative transcriptional activator [Bradyrhizobium sp. BTAi1]
          Length = 213

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 40/215 (18%), Positives = 72/215 (33%), Gaps = 11/215 (5%)

Query: 26  NRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLL 85
            +     FA  +     D    +     +  Y     +          D  +    +  L
Sbjct: 2   EQYGFPCFAYLSFAPRGD----EDDALAITTYPSAWVEQYRANRYDRIDPVIARSVATTL 57

Query: 86  PIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEV 145
           P  W + Q +  + +  +  +          G+  P+     K   +   +     A E 
Sbjct: 58  PFAWSTDQFDA-LNNRQKWFLEEASEFEIRHGVTIPIHDRQGKVATLTLAACEARSAFEA 116

Query: 146 -----IIEAHGACYQVITDFLELFKKRSSAARN-LTERETSCLQLAGDGYTSEEIAEKLG 199
                  E H     +     ++    +S  R  LT+RE  CLQ A  G ++ + AE + 
Sbjct: 117 QISKYRHELHLIAIYLYARLRDVTPTPASPLRPCLTQRERICLQWAARGKSALDTAEIIN 176

Query: 200 LSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +S  TV  +  +A  KL      QA+AK + +  I
Sbjct: 177 VSRRTVVFHTQNAKRKLGVATVQQAVAKGLAYDII 211


>gi|325277395|ref|ZP_08143015.1| LuxR family transcriptional regulator [Pseudomonas sp. TJI-51]
 gi|324097468|gb|EGB95694.1| LuxR family transcriptional regulator [Pseudomonas sp. TJI-51]
          Length = 242

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 42/229 (18%), Positives = 74/229 (32%), Gaps = 9/229 (3%)

Query: 6   LTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIP 65
           L  +++++L  +   L     R+    F L+++ +  D     ++     ++  D   I 
Sbjct: 14  LAVERATTLAGVQDALRPFAMRLGYDRFVLFSVRAVAD-ALIDRVYWVEGDWWGDGQAID 72

Query: 66  NILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLL-PFAGIAFPVRL 124
                        H      P  W         +  G+    +         G+  PV  
Sbjct: 73  -ARTYLTRCPVTRHVLEARAPFFWT-----KTCDEKGERYRVVRRPAGAGVHGLQLPVFG 126

Query: 125 GFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSA-ARNLTERETSCLQ 183
                G +      +  + E  +               L +   +A A  L+ RE   L+
Sbjct: 127 PQGLEGAMSLGGARIDSSPEARLMLAMVATAAFHTARRLLQPPLAASATQLSAREREVLR 186

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFG 232
               G    +IA  LGLS  TV  +L +A  +L      QAI  A+  G
Sbjct: 187 WTAAGSRQADIAATLGLSERTVENHLRAARRRLGVATTAQAIKIALHNG 235


>gi|149184297|ref|ZP_01862615.1| transcriptional regulator, LuxR family protein [Erythrobacter sp.
           SD-21]
 gi|148831617|gb|EDL50050.1| transcriptional regulator, LuxR family protein [Erythrobacter sp.
           SD-21]
          Length = 211

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 35/210 (16%), Positives = 67/210 (31%), Gaps = 3/210 (1%)

Query: 26  NRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLL 85
           +R  A  F+ +           ++       + +D  D+ +       D           
Sbjct: 2   DRFGADKFSYHFTPV-FGSQVSRETQVVARGFSMDWLDLYDSADFRQCDPIPDEVMRAGH 60

Query: 86  PIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLM-LANE 144
            I W+   +        +  +          G   P+    +++ Y  F     +    E
Sbjct: 61  TISWEEALDRAEHTPEVERFIAALREYGIANGFGVPLYGPDNRDAYAAFGFPAEVTPTEE 120

Query: 145 VIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHT 204
            I+              +L         +L++RE   L+L   G +   IA+ L +S  T
Sbjct: 121 QIVALTMVARTAHDRVCQLVTIEEGEI-SLSQRELEVLRLIAHGKSKPVIAQLLEISADT 179

Query: 205 VNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           V  Y+     KL   +R+ A  KA++   I
Sbjct: 180 VGTYVKRLYAKLGVSDRVGATVKALKLKLI 209


>gi|103488004|ref|YP_617565.1| LuxR family transcriptional regulator [Sphingopyxis alaskensis
           RB2256]
 gi|98978081|gb|ABF54232.1| transcriptional regulator, LuxR family [Sphingopyxis alaskensis
           RB2256]
          Length = 276

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 45/226 (19%), Positives = 73/226 (32%), Gaps = 6/226 (2%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           +   ++L   L     R+   +FAL         P        +HNY      +      
Sbjct: 43  ADREEQLFAALTKAAGRMGFDHFALAFDRRGTGEPAS----ILVHNYPDAWAKVYVGFDL 98

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
           +  D         L    W+ +     +    +  + +        G   P  L    +G
Sbjct: 99  SGTDPIRRASERSLTGFEWRHVDRYIPLSRGDRQLLSVARDSGVGDGFTVPRHLPGEASG 158

Query: 131 YVIFT-SEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARN-LTERETSCLQLAGDG 188
              F       +  +++  A       I    EL        R  LTER+  C+  +  G
Sbjct: 159 TCSFAVRPHADIPADMLHAAEILGAIAIASARELIGSSPLRPRPILTERQRECVLWSARG 218

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            T+ EIA+ LG+S  TV  +L  A  +     R   I  A+  G I
Sbjct: 219 KTAGEIADILGISEETVVRHLKMARERYSVHCRSMLILCALFDGLI 264


>gi|229588916|ref|YP_002871035.1| putative LuxR family regulatory protein [Pseudomonas fluorescens
           SBW25]
 gi|229360782|emb|CAY47640.1| putative LuxR-family regulatory protein [Pseudomonas fluorescens
           SBW25]
          Length = 235

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 46/224 (20%), Positives = 79/224 (35%), Gaps = 11/224 (4%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           +    L  I  RI    + L    S    P  +     +  Y  D             D 
Sbjct: 16  DWERHLRKILRRIGYERYLLSLGPSTTHDPFNR----IMTTYPSDWLKRYKDENFIQVDP 71

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH-KNGYVIF 134
            + H      P+ W   + +           +   G     G++ P+R      +  V  
Sbjct: 72  IIRHCRHHFAPLFWGRARLKARG--CTNRFWKEREGYGLLRGVSIPLRFNEMAGSLNVAQ 129

Query: 135 TSEFLMLANEVIIEAHGACYQVITDFLELFKKRS----SAARNLTERETSCLQLAGDGYT 190
                    + +    G  + +I   LE  +K          +LT RE+  L+  G G T
Sbjct: 130 CVSDTDELADDLNGPLGMLFMLIPFLLEGSQKHLKTVGEPPSSLTLRESEVLKWTGVGKT 189

Query: 191 SEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           + E++  LG S  T+N ++ +A+ KL + +R QA+  A+  G I
Sbjct: 190 TWEMSCILGCSERTINFHIANASRKLGSFSRRQAVGVALAQGLI 233


>gi|292487894|ref|YP_003530769.1| transcriptional activator protein expR [Erwinia amylovora CFBP1430]
 gi|292899116|ref|YP_003538485.1| LuxR family transcriptional regulator [Erwinia amylovora ATCC
           49946]
 gi|291198964|emb|CBJ46075.1| LuxR-family transcriptional regulator [Erwinia amylovora ATCC
           49946]
 gi|291553316|emb|CBA20361.1| Transcriptional activator protein ExpR [Erwinia amylovora CFBP1430]
          Length = 240

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 79/231 (34%), Gaps = 13/231 (5%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           +K S +  ++  +      ++   ++L+        P  +       NY  D  D     
Sbjct: 18  EKGSGIDHITRLIEQQLRALELDFYSLF---IRHPVPFTRPKTFLYSNYPQDWLDHYWRE 74

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  L   +S     IW     +    S+G            F G++  V      
Sbjct: 75  GFYQLDPVLEMCSSPGK--IW---LWDDKTISAGLCVFEHARNYGIFHGLSCSVMASNRS 129

Query: 129 NGYVIFTSEFLM----LANEVIIEAHGACYQVITDFLELFKKRSSAAR-NLTERETSCLQ 183
            G +  ++        L  E  ++        +   + +     +  + + +ERE   L+
Sbjct: 130 VGILSMSTANSQKLIKLTTETELKIQYVLELSMAALININDISMATTKLDFSERELEILK 189

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              +G TS EI+  L +S +TVN +      + +A N+ Q  + A   G I
Sbjct: 190 WTAEGKTSAEISLILSISQNTVNFHQKKMQKRFNAPNKTQIASYAAAIGLI 240


>gi|322835285|ref|YP_004215311.1| LuxR family transcriptional regulator [Rahnella sp. Y9602]
 gi|321170486|gb|ADW76184.1| transcriptional regulator, LuxR family [Rahnella sp. Y9602]
          Length = 251

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 45/245 (18%), Positives = 89/245 (36%), Gaps = 15/245 (6%)

Query: 3   ENTLTGKKSSSLQELSPRLHLIQNRIKARN--FALYTINSALDFPRRQQLICELHNYDLD 60
           E+ ++ ++ +++     +L    +R+      +    +  +L+       +  + N   D
Sbjct: 7   ESAVSLRE-TTVDGAFDQLFAQTSRLGFDALIYDYTPVPRSLEGELITPSLLRMCNVPGD 65

Query: 61  SGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEET-----VIESSGQLSVRLEGGLLPF 115
              +         D    +      P +W   + +       +    +            
Sbjct: 66  MQRLWLENGYYQVDPVQHYALESCAPFVWSYQRPDNTSLQNRLSDLNKPVTHYMCDNNMP 125

Query: 116 AGIAFPVRLGFHKN----GYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAA 171
           +G   P+ L         G        L + ++V+ E              LF       
Sbjct: 126 SGATVPLHLPNGGFVTVTGIHTGAGHELDI-HDVLAELSLLALTFQECVFPLFDSSILTC 184

Query: 172 R--NLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAI 229
           R   L++RE  CL  A +G T++EIA KL  S+ TV  +L +A  KL A NR+QA+ +A+
Sbjct: 185 RHVRLSKRERECLTWAAEGLTAKEIARKLNRSIATVTLHLNTAARKLGASNRVQAVVRAM 244

Query: 230 RFGYI 234
            +  +
Sbjct: 245 HYRLL 249


>gi|182679885|ref|YP_001834031.1| LuxR family transcriptional regulator [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182635768|gb|ACB96542.1| transcriptional regulator, LuxR family [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 255

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 46/229 (20%), Positives = 78/229 (34%), Gaps = 3/229 (1%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++  S   L    HL +    +  F  +T+       +R      L +Y  D  D     
Sbjct: 17  RRIDSADSLCALSHLTEEMCLSLGFPWFTLIRGKQLAKRDDRSILLTSYPQDWVDHVLKE 76

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D   F  +  +  + W  I +   + S    ++          G   P+RL   +
Sbjct: 77  KRHLDDPVHFAASRLVNGLSWNEIGQYVTLNSRQIETLESARRHGLNTGFTIPLRLDGFE 136

Query: 129 NGYVIFT-SEFLMLANEVIIEAHGACYQVITDFLEL--FKKRSSAARNLTERETSCLQLA 185
           N        +  ++ +E  + A             L           +L+ R+  C+ L 
Sbjct: 137 NAMFSMAKRKANVITSEERLLACLVGSVTFARAHALVTADAGIFTPVHLSPRQVDCVALL 196

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             GY+  EIA +LG+S  TV  Y+  A        R Q    A+R GY+
Sbjct: 197 AKGYSDFEIARQLGISPETVREYITKARRSYGVKRRFQLAILAVRDGYL 245


>gi|222081950|ref|YP_002541315.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
 gi|221726629|gb|ACM29718.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
          Length = 260

 Score =  130 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 50/252 (19%), Positives = 83/252 (32%), Gaps = 18/252 (7%)

Query: 1   MSENTLTGKKSSSLQE-----LSPRLHLIQNR-IKARNFALYTINSALDFPRRQQLICEL 54
           M +   T ++  +  +     +      +Q    +A  +    +   LD         +L
Sbjct: 1   MLDEIGTIRRKFTAHDTLDGRIDQAFEAMQQLGFEALVYDYTPVPFDLDGELMVPSFLKL 60

Query: 55  HNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVI-----ESSGQLSVRLE 109
            N   D  +          D           P  W    E           + +   R  
Sbjct: 61  RNISDDMLEYWFDRGYFRIDPVQQVALRTSAPFFWNYNVEADTAINRYLGENTEPVARYL 120

Query: 110 GGLLPFAGIAFPVRLGFHKNGYVIFTS-----EFLMLANEVIIEAHGACYQVITDFLELF 164
                  G+  PV +       V         +F   A   I +     +        LF
Sbjct: 121 NERDMSTGVTVPVHMPRGDYATVTGIRFGANKDFERNALRYIADFGLLAHVFHETAYALF 180

Query: 165 K--KRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRI 222
              +RS     LTERE  CL+ + +G +++EI+  +  SV TV  +L SA  KL A NR 
Sbjct: 181 DSSERSVGKMRLTERERECLRHSAEGLSAKEISRIIDRSVPTVVMHLNSAAKKLGAKNRT 240

Query: 223 QAIAKAIRFGYI 234
           QA+ +A  +  +
Sbjct: 241 QAVVRATHYRLL 252


>gi|325294100|ref|YP_004279964.1| transcriptional regulator, LuxR family [Agrobacterium sp. H13-3]
 gi|325061953|gb|ADY65644.1| transcriptional regulator, LuxR family [Agrobacterium sp. H13-3]
          Length = 258

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 73/235 (31%), Gaps = 13/235 (5%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
           ++ +   +      +        F  + ++  +             +      ++     
Sbjct: 26  QAGNADRVRSEFVTLIREY---GFEYFLVSRRMTGELASTGQILAQHLPEGWIEVYRAKK 82

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQE---ETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
               D           P  W+   E     +      +     G      G AFPV    
Sbjct: 83  YNLVDPVRKVIGMVHKPFQWKEALEGLPRAMHRKRANVFFHDAGRYGLQGGYAFPVHGRA 142

Query: 127 HKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKK-------RSSAARNLTERET 179
              G V    E   L +  +     A   V    L+L  +        + +A  LT RE 
Sbjct: 143 GFIGAVFLGGEDRQLPSLHVELLDAATRAVFWRLLDLSGQVHNLNNAPNVSALELTRREM 202

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L L  DG TS EI  +L +S HTV+ Y+     +  A NR   +A A R G +
Sbjct: 203 EVLTLMADGMTSTEIGRQLSISNHTVDWYINGIQRRFSAKNRQHTVALAFRNGLL 257


>gi|37223239|gb|AAQ90220.1| LuxR [Aliivibrio fischeri]
 gi|37223242|gb|AAQ90222.1| LuxR [Aliivibrio fischeri]
          Length = 232

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/212 (17%), Positives = 78/212 (36%), Gaps = 11/212 (5%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           +++  L  +   I   +   Y           +  +  + NY        +       D 
Sbjct: 26  DINQCLSEMAKII---HCEYYLFAIIYPHSIIKPDVSIIDNYPEKWRKYYDDAGLLKYDP 82

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
            + +  S   PI W  + E+  I+      +R         G +FP+    +  G + F 
Sbjct: 83  VVDYSKSHHSPINWN-VFEKKSIKKESPNVIREAQESGLITGFSFPIHTANNGFGMLSFA 141

Query: 136 SEFLMLANEVIIEAH------GACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGY 189
                +  + +   H           ++ ++ ++      +   LT+RE  CL  A +G 
Sbjct: 142 HSDKDIYTDSLF-LHASTNVPLMLSSLVDNYQKINTTHKKSDSILTKREKECLAWASEGK 200

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNR 221
           ++ +I++ LG S  TV  +L +  +KL+  NR
Sbjct: 201 STWDISKILGCSERTVTFHLTNTQMKLNTTNR 232


>gi|114704741|ref|ZP_01437649.1| putative transcription regulator protein [Fulvimarina pelagi
           HTCC2506]
 gi|114539526|gb|EAU42646.1| putative transcription regulator protein [Fulvimarina pelagi
           HTCC2506]
          Length = 226

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 48/220 (21%), Positives = 77/220 (35%), Gaps = 2/220 (0%)

Query: 15  QELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGD 74
            +L   L +  N       A   + S  +   + +    + N+                 
Sbjct: 8   ADLEAALAMAGNTYGFTYAAALALPSTDEQGLQTRY--LMGNWSHGFQRSYEAAELHRHK 65

Query: 75  DFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
             +   ++  +P  W       + +       RL        G+  PV       G + F
Sbjct: 66  VVVATLSTDPMPFEWDIDTLYGISDPKPSKGARLVAEAGWSEGVLLPVHGMTAMCGALSF 125

Query: 135 TSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEI 194
                + +  VI E     +        +    +     LT RE  CL+LA  G TS EI
Sbjct: 126 AGPNALPSRTVIYEMQSFAFVFFGMLAAVRFDENRRNNPLTPRERDCLRLAMLGKTSSEI 185

Query: 195 AEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              L LS +T++ YL +A  KLDA NR   +A A + GY+
Sbjct: 186 GIVLSLSEYTISQYLTAAQRKLDASNRTHTVAMAAQLGYL 225


>gi|70732607|ref|YP_262370.1| ATP-dependent transcription regulator LuxR [Pseudomonas fluorescens
           Pf-5]
 gi|68346906|gb|AAY94512.1| autoinducer-binding transcriptional regulator, LuxR family
           [Pseudomonas fluorescens Pf-5]
          Length = 252

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 45/237 (18%), Positives = 71/237 (29%), Gaps = 16/237 (6%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQL-ICELHNYDLDSGDIPNILIE 70
           +SL E       + + +              D      +    + N   D  ++      
Sbjct: 16  NSLHERMTGTMTLASELGFDALVYDYSPVPFDQAGELIIPSAMVCNTPRDWLELWCDQGY 75

Query: 71  TYGDDFLFHFNSGLLPIIWQ-----SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLG 125
            + D           P IW             +                  G+  P+ L 
Sbjct: 76  YHIDPVQQVALDSSSPFIWSYKPEAETVLRQALGQQHAPVSSYLHHHQMAHGMTVPIHLP 135

Query: 126 FHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARN--------LTER 177
                    T      A   + +              L +                LT R
Sbjct: 136 RGGFA--SLTGLRSGNATVALQDLQQVQGHFTLLAHALQEHLYPQLSKCVRSYPVDLTRR 193

Query: 178 ETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           E  CL+ A +G TS EIAE+L  S  T+N +L SA  KL A NR+QA+ +A+ +  +
Sbjct: 194 ERECLKWAAEGMTSGEIAERLQRSQATINLHLTSAMHKLGARNRVQAVVRAVHYRLL 250


>gi|170736657|ref|YP_001777917.1| LuxR family transcriptional regulator [Burkholderia cenocepacia
           MC0-3]
 gi|169818845|gb|ACA93427.1| transcriptional regulator, LuxR family [Burkholderia cenocepacia
           MC0-3]
          Length = 321

 Score =  129 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 42/224 (18%), Positives = 69/224 (30%), Gaps = 6/224 (2%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICEL-HNYDLDSGDIPNILIETY 72
           L  L      +   +    FA+  ++       R   +  L   Y               
Sbjct: 99  LSSLLKLFGDVSASLGFPRFAISRVSRRHAGNGRAMSVETLCARYPDHWVAHYAQRDYGP 158

Query: 73  GDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYV 132
            D       +   P  W  I     +    Q  +         +G++ P+R        V
Sbjct: 159 VDPVHRMAFARATPYRWADI---RGLNRIEQRVLGEARDAGLTSGVSIPLREANGDILLV 215

Query: 133 IFTSEFLMLANEVIIEAHGACYQVITDFLE--LFKKRSSAARNLTERETSCLQLAGDGYT 190
              S    +  EV +        +    L   +   R   A  L+ R+  CL     G +
Sbjct: 216 NLASPSPEIKTEVHMRLASLIGALFHQELHRLMKPHRPEPALELSPRQQECLAWVARGKS 275

Query: 191 SEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           S  IA  +G+S HTV+ ++  A   L   +R  A   A+  G I
Sbjct: 276 SWAIAAIVGISPHTVDYHIAEAMKILGINSRTAAAVHAVTTGLI 319


>gi|149184172|ref|ZP_01862490.1| transcriptional regulator, LuxR family protein [Erythrobacter sp.
           SD-21]
 gi|148831492|gb|EDL49925.1| transcriptional regulator, LuxR family protein [Erythrobacter sp.
           SD-21]
          Length = 217

 Score =  129 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/219 (18%), Positives = 61/219 (27%), Gaps = 7/219 (3%)

Query: 18  SPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFL 77
              L           FA    +         ++  +   +     +          D F 
Sbjct: 2   FEILRRYFAEFGFEAFAYMVPSKTEPG----RIEMDAFGFPDAWAETYRSAEMDTIDPFP 57

Query: 78  FHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTS- 136
            +      P+    I  +   +                 G+  P        G       
Sbjct: 58  RYVARSGRPLRLTEISAQAQSKEQKAFL-EQAREHGITDGLIIPTFGIRQNLGVFAIGQV 116

Query: 137 -EFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIA 195
            +  +L    +           T    L  +      NL+ RET  L     G T+ EIA
Sbjct: 117 KDLKVLERASVFALQAVAQAAHTQMEMLASRADGLRTNLSNRETEILHWIALGKTNSEIA 176

Query: 196 EKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             LG+   TV  Y+     KLD  +R  A  KAIR+G I
Sbjct: 177 TILGIGGPTVATYIKRVFDKLDVKDRSSAAVKAIRWGII 215


>gi|271501434|ref|YP_003334459.1| LuxR family transcriptional regulator [Dickeya dadantii Ech586]
 gi|270344989|gb|ACZ77754.1| transcriptional regulator, LuxR family [Dickeya dadantii Ech586]
          Length = 250

 Score =  129 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 43/236 (18%), Positives = 77/236 (32%), Gaps = 12/236 (5%)

Query: 11  SSSLQELSPRLHLIQNRIKARN--FALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++ L+E    L      +      +    +  +L+       + E+ N   D   +    
Sbjct: 13  ATRLEEAFAGLFARTQALGFDAVIYDYTPVPRSLEGALITPSLLEMRNVPDDMRRLWCER 72

Query: 69  IETYGDDFLFHFNSGLLPIIWQ-----SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVR 123
                D           P +W             ++   Q             G   P+ 
Sbjct: 73  GYYQVDPVQHFALESCAPFVWSYQRPDRSALHGRLDEHAQEVTHYMRDNNMPCGATVPLH 132

Query: 124 LGFHKNGYVIFTSEFLMLANE---VIIEAHGACYQVITDFLELFKKRSSAAR--NLTERE 178
           L       +           +    + +     ++       LF       R   L+ RE
Sbjct: 133 LPNGGFVTLTGIVTDQREERDISETLAQLTFLAHRFQESAFPLFDASMLTCRHVKLSNRE 192

Query: 179 TSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             CL  + +G T++EIA KL  SV TV  +L +A  KL A NR+QA+ +A+ +  +
Sbjct: 193 RECLAWSAEGLTAKEIARKLHRSVATVTLHLNTAAKKLGATNRVQAVVRALHYRLL 248


>gi|58533128|gb|AAW78919.1| ExpR [Erwinia amylovora]
          Length = 240

 Score =  129 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 78/231 (33%), Gaps = 13/231 (5%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           +K S    ++  +      ++   ++L+        P  +       NY  D  D     
Sbjct: 18  EKGSGTDHITRLIEQQLRELELDFYSLF---IRHPVPFTRPKTFLYSNYPQDWLDHYWRE 74

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  L   +S     IW     +    S+G            F G++  V      
Sbjct: 75  GFYQLDPVLEMCSSPGK--IW---LWDDKTISAGLCVFEHARNYGIFHGLSCSVMASNRS 129

Query: 129 NGYVIFTSEFLM----LANEVIIEAHGACYQVITDFLELFKKRSSAAR-NLTERETSCLQ 183
            G +  ++        L  E  ++        +   + +     +  + + +ERE   L+
Sbjct: 130 VGILSMSTANSQKLIKLTTETELKIQYVLELSMAALININDISMATTKLDFSERELEILK 189

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              +G TS EI+  L +S +TVN +      + +A N+ Q  + A   G I
Sbjct: 190 WTAEGKTSAEISLILSISQNTVNFHQKKMQKRFNAPNKTQIASYAAAVGLI 240


>gi|312172015|emb|CBX80272.1| Transcriptional activator protein ExpR [Erwinia amylovora ATCC
           BAA-2158]
          Length = 240

 Score =  129 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 44/232 (18%), Positives = 79/232 (34%), Gaps = 15/232 (6%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           +K S +  ++  +      ++   ++L+        P  +       NY  D  D     
Sbjct: 18  EKGSGIDHITRLIEQQLRELELDFYSLF---IRHPVPFTRPKTFLYSNYPQDWLDHYWRE 74

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  L   +S     IW     +    S+G            F G++  V      
Sbjct: 75  GFYQLDPVLEMCSSPGK--IW---LWDDKTISAGLCVFEHARNYGIFHGLSCSVMASNRS 129

Query: 129 NGYVIFTSEFLM----LANEVIIEAHGACYQVITDFLELFKKRSSAARNL--TERETSCL 182
            G +  ++        L  E  ++        +   + +    S A   L  +ERE   L
Sbjct: 130 VGILSMSTANSQKLIKLTTETELKIQYVLELSMAALININ-DISMATTKLDSSERELEIL 188

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +   +G TS EI+  L +S +TVN +      + +A N+ Q  + A   G I
Sbjct: 189 KWTAEGKTSAEISLILSISQNTVNFHQKKMQKRFNAPNKTQIASYAAAIGLI 240


>gi|37223211|gb|AAQ90202.1| LuxR [Aliivibrio fischeri]
          Length = 232

 Score =  129 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/212 (17%), Positives = 79/212 (37%), Gaps = 11/212 (5%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           +++  L  +   I   +   Y           +  +  + NY        +       D 
Sbjct: 26  DINQCLSEMAKII---HCEYYLFAIIYPHSIIKPDVSIIDNYPEKWRKYYDDAGLLEYDP 82

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
            + +  S   PI W  + E+  I+      ++         G +FP+    +  G + F 
Sbjct: 83  VVDYSKSHHSPINWN-VFEKKTIKKESPNVIKEAQESGLITGFSFPIHTASNGFGMLSFA 141

Query: 136 SEFLMLANEVIIEAH------GACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGY 189
                +  + +   H           ++ ++ ++   R  +   LT+RE  CL  A +G 
Sbjct: 142 HSDKDIYTDSLF-LHASTNVPLMLPSLVDNYQKINTTRKKSDSILTKREKECLAWASEGK 200

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNR 221
           ++ +I++ LG S  TV  +L +  +KL+  NR
Sbjct: 201 STWDISKILGCSERTVTFHLTNTQMKLNTTNR 232


>gi|18250686|emb|CAD20930.1| RaiR protein [Rhizobium leguminosarum]
          Length = 265

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 35/195 (17%), Positives = 67/195 (34%), Gaps = 8/195 (4%)

Query: 46  RRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLS 105
                   +  Y  +             D  +     G LP+ W + + ++    +    
Sbjct: 73  ATASNPLLMLTYPPEWVKQYLERDYFSIDPVVRLGRRGFLPVEWSASKWDSGQ--AYGFF 130

Query: 106 VRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLAN-----EVIIEAHGACYQVITDF 160
                  +   G+  PVR    +      TS            + + +     + +    
Sbjct: 131 KEAMAFGVGRQGVTLPVRGPHGERSLFTVTSNHPDAYWRQFRMDSMRDLQFLAHHLHDRA 190

Query: 161 LELFK-KRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAV 219
           + L   ++ +    L+ RE  CL++  +G  +++I  +L +SV  V  YL SA  KL   
Sbjct: 191 MVLSGMRKITDFPQLSRRELQCLEMTANGLLAKQICARLSISVSAVQLYLASARRKLTVA 250

Query: 220 NRIQAIAKAIRFGYI 234
              +A+AKA     I
Sbjct: 251 TTSEAVAKATALELI 265


>gi|325168564|ref|YP_004280354.1| LuxR family transcriptional regulator [Agrobacterium sp. H13-3]
 gi|325064287|gb|ADY67976.1| transcriptional regulator, LuxR family [Agrobacterium sp. H13-3]
          Length = 240

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 42/232 (18%), Positives = 75/232 (32%), Gaps = 7/232 (3%)

Query: 4   NTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGD 63
           + L    + + Q +   +  +        F L++ ++A + P  +++     ++  + GD
Sbjct: 13  SVLAIDAAETFQTIQTEVRSLVAPFGYDRFVLFSASAAREEPI-ERIYWIEGDWFGN-GD 70

Query: 64  IPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVR 123
                          H      P  W     E       ++     G  +   G+  PV 
Sbjct: 71  PVTEETYIRRCAITRHILGAREPFFWTKTFREN--GELYRVVNLPRGPGI--HGLQVPVF 126

Query: 124 LGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARN-LTERETSCL 182
                 G +      +  +                   +L +   ++A   L++RE   L
Sbjct: 127 GPSGLEGAMSLGGTQINASPTTKWILTLLAVAAFYSARKLIEAPVASAIAVLSDREREVL 186

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
                G    EIA  LGLS  T+  +L     +L      QAI  AIR G I
Sbjct: 187 TWTAAGRRQFEIAATLGLSERTIENHLRRIRHRLGVSTTAQAIRIAIRNGEI 238


>gi|37223214|gb|AAQ90204.1| LuxR [Aliivibrio fischeri]
          Length = 232

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 39/212 (18%), Positives = 78/212 (36%), Gaps = 11/212 (5%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           +++  L  +   I   +   Y           +  I  + NY        +       D 
Sbjct: 26  DINQCLSEMAKII---HCDYYLFAIIYPHSIIRPDISIIDNYPEKWRKYYDEAGLLEYDP 82

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
            + +  S   PI W  + E+  I+      ++         G +FP+    +  G + F 
Sbjct: 83  VVNYSKSHHSPINWN-VFEKKSIKKESPNVIKEAQASGLITGFSFPIHTANNGFGMLSFA 141

Query: 136 SEFLMLANEVIIEAH------GACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGY 189
                +  + +   H           ++  + ++      +   LT+RET CL  A +G 
Sbjct: 142 HSDKDIYTDSLF-LHANTNVPLMLPSLVDSYQKINTTHKKSDSILTKRETECLAWASEGK 200

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNR 221
           ++ +I++ LG S  TV  +L +  +KL+  NR
Sbjct: 201 STWDISKILGCSERTVTFHLTNTQMKLNTTNR 232


>gi|330807408|ref|YP_004351870.1| response regulator, NarL family [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375516|gb|AEA66866.1| Putative response regulator, NarL family [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 253

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 46/236 (19%), Positives = 81/236 (34%), Gaps = 13/236 (5%)

Query: 12  SSLQELSPRLHLIQNRIKARN--FALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
            SL E       +   +      +    +    D       + +L N   D   +     
Sbjct: 16  RSLDEQMDNTLGMVQALGFEALVYDYSPVPLDHDGALITPTVLKLRNTPRDWHSLWCEEG 75

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEET-----VIESSGQLSVRLEGGLLPFAGIAFPVRL 124
               D       + + P +W    E        I  S    V          G+  P+ L
Sbjct: 76  YYQIDPVQHLAINAISPFVWSYRPEADTVLQPFIGQSHAPVVSYLQDSRMTCGVTVPMHL 135

Query: 125 GFHKNGYVIFTSEFLMLA-----NEVIIEAHGACYQVITDFLELFKKRSSAAR-NLTERE 178
                  +         +      + + +     + +      L  K + A    LT+RE
Sbjct: 136 PKGGFATLTGLRADTKGSTLQDVRQTLGDFSLISHALQEAAFPLLGKEARACPVRLTKRE 195

Query: 179 TSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             CL+LA +G T+ +IA +L  S+ T+  +L SA  KL A NR+QA+ +A+ +  +
Sbjct: 196 RECLRLAAEGLTAADIARQLNRSLATITLHLTSAMHKLGARNRVQAVVRAVHYRLL 251


>gi|206562110|ref|YP_002232873.1| N-acylhomoserine lactone dependent regulatory protein [Burkholderia
           cenocepacia J2315]
 gi|198038150|emb|CAR54100.1| N-acylhomoserine lactone dependent regulatory protein [Burkholderia
           cenocepacia J2315]
          Length = 262

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 42/224 (18%), Positives = 70/224 (31%), Gaps = 6/224 (2%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICEL-HNYDLDSGDIPNILIETY 72
           L  L      +   +    FA+  ++       R   +  L   Y               
Sbjct: 40  LSSLLKLFGDVSASLGFPRFAISRVSRRHTGNGRAMAVETLCARYPDHWVAHYAQRDYGP 99

Query: 73  GDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYV 132
            D       +   P  W  I     +    Q  +         +G++ P+R        V
Sbjct: 100 VDPVHRMAFARATPYRWADI---RGLNRIEQRVLGEARDAGLTSGVSIPLRETNGDILLV 156

Query: 133 IFTSEFLMLANEVIIEAHGACYQVITDFLE--LFKKRSSAARNLTERETSCLQLAGDGYT 190
              S    +  EV +    +   +    L   +   R   A  L+ R+  CL     G +
Sbjct: 157 NLASPSPEIKTEVHMRLASSIGALFHQELHRLMKPHRPEPALELSPRQQECLAWVARGKS 216

Query: 191 SEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           S  IA  +G+S HTV+ ++  A   L   +R  A   A+  G I
Sbjct: 217 SWAIASIVGISPHTVDYHIAEAMKILGINSRTAAAVHAVTTGLI 260


>gi|222066054|emb|CAX21482.1| ppoR luxR family protein [Pseudomonas putida]
          Length = 235

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 36/214 (16%), Positives = 67/214 (31%), Gaps = 10/214 (4%)

Query: 26  NRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLL 85
           + ++        +N  +    +   +    NY  +  +          D      +    
Sbjct: 27  HLVQDLGMEHLGLNIRIQIATQTPRLYLYSNYPSEWIERYQRDDFYKQDPAARLSHGQTT 86

Query: 86  PIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEV 145
           P++W         +                 G    +    H    V        +A   
Sbjct: 87  PVLWTDELYCEAPQ-----FREAACQHGLRHGWTQSLHDLQHNESQVSVARPAGQIAINE 141

Query: 146 IIE----AHGACYQVITDFLELFKKRS-SAARNLTERETSCLQLAGDGYTSEEIAEKLGL 200
           + E        C+ + +   E            ++ERE   L+ +  G T+ ++A  L L
Sbjct: 142 LYEKAASVQWLCHTLHSVLCEHHLDALCPPQPKMSERELEVLRWSAAGKTAADVASILSL 201

Query: 201 SVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           S  TVN ++ S   K +A N+  AIA A   G+I
Sbjct: 202 SQSTVNFHIRSVITKTNASNKAGAIAIAALRGWI 235


>gi|86358518|ref|YP_470410.1| autoinducer transcriptional regulator protein [Rhizobium etli CFN
           42]
 gi|86282620|gb|ABC91683.1| autoinducer transcriptional regulator protein [Rhizobium etli CFN
           42]
          Length = 260

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 30/231 (12%), Positives = 67/231 (29%), Gaps = 11/231 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++  +   +   + ++Q          +   +                Y         + 
Sbjct: 34  EQIKAATNVDAAIRILQAEYGLDFVTYHLAQTIASKIDSP---FVRTTYPDAWVSRYLLN 90

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +       LP  W  ++       +  + V  +   +   G + PV     +
Sbjct: 91  SYVKVDPIVKQGFERQLPFDWSEVE---PTPEAYAMLVDAQKHGIGGNGYSIPVADKAQR 147

Query: 129 NGYVIFTSEFLMLANEVIIEAHG-----ACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
              +   +         ++           + +    +      +     L+ RE  CL 
Sbjct: 148 RALLSLNARIPADEWSELVRRCRNEWIEIAHLIHRKAVYELHGENDPVPTLSPREIECLH 207

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G   ++I+  LG+S HT   YL +A  KL       A ++A++   I
Sbjct: 208 WTALGKDYKDISVILGISEHTTRDYLKTARFKLGCATISAAASRAVQLRII 258


>gi|37223202|gb|AAQ90196.1| LuxR [Vibrio fischeri ES114]
          Length = 230

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 39/212 (18%), Positives = 79/212 (37%), Gaps = 11/212 (5%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           +++  L  I   I   +   Y           +  +  + NY        +       D 
Sbjct: 24  DINQCLSEIAKII---HCEYYLFAIIYPHSIIKPDVSIIDNYPEKWRKYYDDAGLLEYDP 80

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
            + +  S   PI W  + E+  I+      ++         G +FP+    +  G + F 
Sbjct: 81  VVDYSKSHHSPINWN-VFEKKTIKKESPNVIKEAQESGLITGFSFPIHTASNGFGMLSFA 139

Query: 136 SEFLMLANEVIIEAH------GACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGY 189
                +  + +   H           ++ ++ ++   R  +   LT+RE  CL  A +G 
Sbjct: 140 HSDKDIYTDSLF-LHASTNVPLMLPSLVDNYQKINTTRKKSDSILTKREKECLAWASEGK 198

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNR 221
           ++ +I++ LG S  TV  +L +  +KL+  NR
Sbjct: 199 STWDISKILGCSERTVTFHLTNTQMKLNTTNR 230


>gi|90423532|ref|YP_531902.1| LuxR family transcriptional regulator [Rhodopseudomonas palustris
           BisB18]
 gi|90105546|gb|ABD87583.1| transcriptional regulator, LuxR family [Rhodopseudomonas palustris
           BisB18]
          Length = 242

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 45/233 (19%), Positives = 77/233 (33%), Gaps = 11/233 (4%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNI 67
            + +++  +L   L  I    +  +   +  ++      R  LI     Y  +  +    
Sbjct: 13  IRVAATADDLHHVLRHICEAYQLAHAVFHATDTPAVRAERPLLIL---TYPAEWVENYTR 69

Query: 68  LIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
                 D  +     G L + W +I ++T   +        +   +   G+   VR    
Sbjct: 70  RDYFKIDPVVAIGRVGFLSLDWSTIDQKTASSAK--FFREADEFGVGRHGLTTTVRGPSG 127

Query: 128 KNGYVIFTSEFLMLANEV-----IIEAHGACYQVITDFLELFKKRSSAAR-NLTERETSC 181
           +      TS              I E            +     R       L++RE  C
Sbjct: 128 ERSLFTVTSNANAAQWTRQRDACIHEFQIIANHFHQRAMISTGLRGGDGPLPLSKREKQC 187

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           ++L   G+  ++IA  L LS   +  YL SA  KL A    QAIA A+    I
Sbjct: 188 IELLAKGFLPKQIAALLDLSESAIRLYLCSARRKLQASTTSQAIAIALSLELI 240


>gi|13990973|dbj|BAB47256.1| LuxR family quorum-sensing transcription factor [Agrobacterium
           tumefaciens]
          Length = 269

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 40/222 (18%), Positives = 70/222 (31%), Gaps = 12/222 (5%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDF 76
           +   L    +      FA                I   ++Y  +   +      +  D  
Sbjct: 56  IKSALKTFAHACGFERFAY--------LQTEGSEIRTFNSYPEEWQGVYLESHYSRIDPV 107

Query: 77  LFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTS 136
           ++   + +    W + +  +  +S  +            +G+  PV   F     + F S
Sbjct: 108 VWEAKTRMEIFPWTADEWPSRGKSELRQFRDQAINHGIRSGVTIPVEGSFGSTMMLTFAS 167

Query: 137 EFLMLANEVIIEAHGACYQVITDFLEL----FKKRSSAARNLTERETSCLQLAGDGYTSE 192
                    + +   A   V+     L            R L+ RE  CL+ A  G T+ 
Sbjct: 168 SAPAADVSKLQDGQKAVRAVLAIHYRLKMLAATTIVPPKRLLSPREAMCLKWAAKGKTAP 227

Query: 193 EIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           E A   G++  TV  YL  A  KL+A      +A A   G +
Sbjct: 228 ETAILTGINPRTVQHYLDKAREKLEAATVPHLVAIAKDHGLL 269


>gi|307130193|ref|YP_003882209.1| transcriptional regulator ahyR/asaR family [Dickeya dadantii 3937]
 gi|306527722|gb|ADM97652.1| Transcriptional regulator ahyR/asaR family [Dickeya dadantii 3937]
          Length = 326

 Score =  128 bits (323), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 46/236 (19%), Positives = 78/236 (33%), Gaps = 15/236 (6%)

Query: 14  LQELSPRLHLIQNRIKARNFA-----LYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
                P    + + ++   F         +  +L+       +    N   D   +    
Sbjct: 91  AAAFEPAFEQLYDEVRRLGFDALIYDYTPVPRSLEGELITPSLLRTRNVPDDMVSLWCQS 150

Query: 69  IETYGDDFLFHFNSGLLPIIWQ-----SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVR 123
                D    H      P  W      +     V+    +             G+  P+ 
Sbjct: 151 GYYQVDPVQIHALDSCAPFTWSYCRPENTSLRRVLNEQHRPVSHYMQNHNMRCGVTVPLH 210

Query: 124 LGFHKNGYVIFTSEFLMLANE---VIIEAHGACYQVITDFLELFKKR--SSAARNLTERE 178
           L       V      L   NE   V+       +        LF +        +L+ RE
Sbjct: 211 LPKGGFVTVTAIHTGLDTDNEIETVLARIGLLAHTFQEHVFPLFDEAWYHCRHVHLSPRE 270

Query: 179 TSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             CL  + +G T++EIA KL  S+ TVN +L +A  KL A NR+QA+ +A+ +  +
Sbjct: 271 QECLAWSAEGLTAKEIARKLHRSLATVNLHLNNAARKLGASNRVQAVVRAMHYRLL 326


>gi|71492988|gb|AAZ32754.1| MrtR [Mesorhizobium tianshanense]
          Length = 272

 Score =  128 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 31/231 (13%), Positives = 68/231 (29%), Gaps = 11/231 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++  +   +   + ++Q          +    A     +         Y         + 
Sbjct: 46  EQIKAAANVDAAIRILQAEYGLDFVTYH---LAQTIAAKIDSPFVRTTYPDAWVSRYLLN 102

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +       LP  W  ++       +  + V  +   +   G + PV     +
Sbjct: 103 SYVKVDPIVKQGFERQLPFDWSEVE---PTPEAYAMLVDAQKHGIGGNGYSIPVADKAQR 159

Query: 129 NGYVIFTSEFLMLANEVIIEAHG-----ACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
              +   +         ++           + +    +      +     L+ RE  CL 
Sbjct: 160 RALLSLNARIPAEEWAELVRRCRNEWIEIAHLIHRKAVYELHGENDPVPALSPREIECLH 219

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G   ++I+  LG+S HT   YL +A  KL       A ++A++   I
Sbjct: 220 WTALGKDYKDISVILGISEHTTRDYLKTARFKLGCATISAAASRAVQLRII 270


>gi|167736311|dbj|BAG07412.1| LuxR-like protein [Gluconacetobacter polyoxogenes]
          Length = 236

 Score =  128 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 41/229 (17%), Positives = 76/229 (33%), Gaps = 9/229 (3%)

Query: 7   TGKKSSSLQELSPR-LHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIP 65
             + +++  +L    L  + +        ++     L+     +       Y  +  +  
Sbjct: 14  DLENAATKHDLLSIYLDAVLSVGN-----VHVTIVELNRIEDPKENFIHVGYPTEWVNFY 68

Query: 66  NILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLG 125
                   D  +        P  W  I+     E      +R         G+  PV   
Sbjct: 69  IENNYIVSDPIIKKSRFMSHPYFWHEIRNINKSEKK---IIRDVSEFGIKKGLTIPVHTH 125

Query: 126 FHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLA 185
                 + F      +  E+ +         I  + +L +    +   LT RE  CL+  
Sbjct: 126 DRLIYAICFAFTDKNVDQEIELYLRALSNFFIAGYKKLDEPTDMSPPILTPREKECLRWT 185

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             G +S E    +G+S  TVN ++ +A +KL   NRI  + +AI  G I
Sbjct: 186 AKGKSSWETGMIVGVSERTVNFHINNALLKLKCTNRIMGVVRAICAGLI 234


>gi|260466633|ref|ZP_05812821.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
 gi|259029639|gb|EEW30927.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
          Length = 256

 Score =  128 bits (322), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 64/226 (28%), Positives = 106/226 (46%), Gaps = 5/226 (2%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           + ++ +   R   I   I A  F L+ ++ + +    + + C   +Y   +      +  
Sbjct: 33  AVTIPDAVRRCRWISVDINASAFGLFFVSPSPERA--RLVPCFDSDYPGVAVAT-KFISA 89

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSV--RLEGGLLPFAGIAFPVRLGFHK 128
             G++ + H  +   P  W       + E  G+L+   ++       +GIA PV     +
Sbjct: 90  ANGEEIVRHTRNSTEPRWWADDGVAAMAEMFGKLAWTEQMAPLAPGTSGIALPVHADRGQ 149

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDG 188
            G V+F    + L  + + E H  C+ +      +    +   R +++RE  CL+L  +G
Sbjct: 150 CGLVVFLGSEIALPQDTLYEIHARCFSLFAAVARILPSDAGRTRAISKRELECLKLTANG 209

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            TSEEIA  L LSVHT N YL  +T KL+AVNR QA+AKA+R G I
Sbjct: 210 NTSEEIARLLKLSVHTANQYLTQSTQKLNAVNRNQAVAKALRLGLI 255


>gi|241205631|ref|YP_002976727.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859521|gb|ACS57188.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 241

 Score =  128 bits (322), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 31/231 (13%), Positives = 69/231 (29%), Gaps = 11/231 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++  +   +   + ++Q          +    A     +         Y         + 
Sbjct: 15  EQIKAAANVDAAIRILQTEYGLDFVTYH---LAQTIAAKIDSPFVRTTYPDAWVSRYLLN 71

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +       LP  W  ++       +  + V  +   +   G + PV     +
Sbjct: 72  SYVKVDPIVKQGFERQLPFDWSEVE---PTPEAYAMLVDAQKHGIGGNGYSIPVADKAQR 128

Query: 129 NGYVIFTSEFLMLANEVIIEAHG-----ACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
              +   +         ++           + +    +      +    +L+ RE  CL 
Sbjct: 129 RALLSLNARIPAEEWTELVRRCRNEWIEIAHLIHRKAVYELHGENDPVPSLSPREIECLH 188

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G   ++I+  LG+S HT   YL +A  KL       A ++A++   I
Sbjct: 189 WTALGKDYKDISVILGISEHTTRDYLKTARFKLGCATISAAASRAVQLRII 239


>gi|37223223|gb|AAQ90210.1| LuxR [Aliivibrio fischeri]
          Length = 232

 Score =  128 bits (322), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 42/216 (19%), Positives = 81/216 (37%), Gaps = 11/216 (5%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
            S  +++  L  +   +   +   Y +         +  I  L NY        +     
Sbjct: 22  RSNNDINQCLSDMTKMV---HCEYYLLAIIYPHSMVKSDISILDNYPKKWRQYYDDANLI 78

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  + + NS   PI W  I E   +       ++         G +FP+    +  G 
Sbjct: 79  KYDPIVDYSNSNHSPINWN-IFENNAVNKKSPNVIKEAKSSGLITGFSFPIHTANNGFGM 137

Query: 132 VIFTSEFLMLANEVIIEAH------GACYQVITDFLELFKKRSSAARNLTERETSCLQLA 185
           + F         + +   H           ++ ++ ++    + +  +LT+RE  CL  A
Sbjct: 138 LSFAHSEKDNYIDSLF-LHACMNIPLIVPSLVDNYRKINIANNKSNNDLTKREKECLAWA 196

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNR 221
            +G +S +I++ LG S  TV  +L +A +KL+  NR
Sbjct: 197 CEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNR 232


>gi|190404427|ref|YP_001961058.1| rcorf83 [Agrobacterium rhizogenes]
 gi|158322223|gb|ABW33640.1| rcorf83 [Agrobacterium rhizogenes]
          Length = 224

 Score =  128 bits (321), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 41/216 (18%), Positives = 70/216 (32%), Gaps = 9/216 (4%)

Query: 23  LIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNS 82
            +++ + +  F  +          R       ++Y     DI      +  D  +     
Sbjct: 14  ALKSFVNSHGFERFAYLQTEGLEIR-----TFNSYPEGWQDIYLGGQYSRIDPVITEAKR 68

Query: 83  GLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLA 142
            +    W +        S  +            +G+  PV   F     + F S    + 
Sbjct: 69  RMEMFYWTADDWPARGTSELRRFRDQAIEHGIRSGLTIPVEGSFGSTMMLTFASSEKKVE 128

Query: 143 NEVIIEAHGACYQVITDFLEL----FKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKL 198
              +++A  A   V+     L         +  R L+ RE  CL  A  G ++ E A   
Sbjct: 129 KAKLLDAQKAVRTVLAIHYRLKIIASTTIIAPKRLLSPREAMCLMWAAKGKSAPETAMLT 188

Query: 199 GLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           G++  TV  YL  A  KLDA      +A A   G +
Sbjct: 189 GINARTVQHYLDKAREKLDAATVPHLVAIAKDHGLV 224


>gi|218679157|ref|ZP_03527054.1| LuxR family transcriptional regulator [Rhizobium etli CIAT 894]
          Length = 265

 Score =  128 bits (321), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 47/233 (20%), Positives = 78/233 (33%), Gaps = 14/233 (6%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           + +    +  I    +A  +    +   LD       + +L N   D  D          
Sbjct: 22  IDQAFEAMKQIG--FEALIYDYTPVPYDLDGAIMIPSLLKLRNISDDMHDYWFNHGYFRI 79

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVI-----ESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
           D           P  W    +   +             R         G+  PV +    
Sbjct: 80  DPVQQVALRSTAPFFWNYDTDADTLIKRFMSDDTAPVARYLNERDMSTGVTVPVHMPRGD 139

Query: 129 NGYVIFTSEFLMLANEV-----IIEAHGACYQVITDFLELFKKRSSA--ARNLTERETSC 181
              V           E      I + +   +        LF K + +     LTERE  C
Sbjct: 140 YATVTGIRFGRNDDFERYALRYIADFNLLAHVFHETAYSLFDKTAKSVGTVRLTEREREC 199

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           L+ + +GY+++EI+  +G SV TV  +L +A  KL A NR QA+ +A  +  +
Sbjct: 200 LRHSAEGYSAKEISRIIGRSVPTVVMHLNAAAKKLGARNRTQAVVRATHYRLL 252


>gi|148553102|ref|YP_001260684.1| LuxR family transcriptional regulator [Sphingomonas wittichii RW1]
 gi|148498292|gb|ABQ66546.1| transcriptional regulator, LuxR family [Sphingomonas wittichii RW1]
          Length = 254

 Score =  128 bits (321), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 46/229 (20%), Positives = 72/229 (31%), Gaps = 6/229 (2%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           + + S  +LS  +     +   R FAL       D  + +     L NY     D     
Sbjct: 23  EAAESSAQLSEVIAGAIQQFGFRWFALV---DDGDLYKHRSGCMMLTNYPSSWVDEVISA 79

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D            + W  I +      +    +          G   P R+   +
Sbjct: 80  RLYRDDPVHAASIRSPTGLCWDRIPDVIAPTRAQLSVLERGRAHGLTTGYTVPFRIPGER 139

Query: 129 NGYVIFTSE-FLMLANEVIIEAHGACYQVITDFLELFKKRSSAAR--NLTERETSCLQLA 185
             +                I A             L K R+  A    LT R+  CL+L 
Sbjct: 140 GAFFSIARPKDRSFTYSEAISAQLLGGIAFEAGRALVKGRAVKAHGAPLTPRQIDCLRLI 199

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             G T  E+ + LGLS  T++ Y+ +A  +     R Q +  A R GY+
Sbjct: 200 AAGKTEWEMGKILGLSPSTIHEYVEAARRRYGVKTRSQLVLAAARDGYV 248


>gi|149186879|ref|ZP_01865189.1| transcriptional regulator, LuxR family protein [Erythrobacter sp.
           SD-21]
 gi|148829546|gb|EDL47987.1| transcriptional regulator, LuxR family protein [Erythrobacter sp.
           SD-21]
          Length = 226

 Score =  128 bits (321), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 36/209 (17%), Positives = 68/209 (32%), Gaps = 6/209 (2%)

Query: 28  IKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPI 87
           +  + FA    +          ++ +   Y     +          D F  H       +
Sbjct: 20  LGFQGFAYMVPSRDSPL----TMVYKSRGYPEKFIETYQREKLYLIDPFPAHVTRHKSTL 75

Query: 88  IWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG--YVIFTSEFLMLANEV 145
               I ++  +  +    +     +    G+  P      +     +   ++F ++ N+ 
Sbjct: 76  RISEIAQQAKLSRAETDYIDRMKKMGITDGLIIPTFGMDLRIVKFVLGQVTDFSVIENDN 135

Query: 146 IIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTV 205
           + E             EL ++     R L  RE   L     G T+ EIA  LG++  TV
Sbjct: 136 LFEFTATLQMAHRRLDELARQDEPIRRRLPRREVEILHWIAKGKTNAEIAAILGVAAPTV 195

Query: 206 NAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             ++     KLD  +R     K  R+G I
Sbjct: 196 ATHIARMFQKLDVNDRAALAVKGFRYGII 224


>gi|18699286|gb|AAL78509.1|AF456804_1 probable transcriptional activator TraR [Sinorhizobium meliloti]
 gi|38374154|gb|AAR19282.1| TraR [Sinorhizobium meliloti]
          Length = 234

 Score =  128 bits (321), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 41/222 (18%), Positives = 67/222 (30%), Gaps = 12/222 (5%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDF 76
           +   L    +      FA           +    +   ++Y      I      +  D  
Sbjct: 21  IKSALRNFAHACGYDRFAY--------LQKEAFQVKTFNSYPGSWEGIYLGSDYSSIDPV 72

Query: 77  LFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTS 136
           +           W +        S  +             G+  PV   +     + F S
Sbjct: 73  VTEAKRRGDVFFWTADDWPARGSSPLRRFRDEAIDHGIRCGVTMPVEGSYGSAMMLTFAS 132

Query: 137 EFLMLANEVIIEAHGACYQVITDFLEL----FKKRSSAARNLTERETSCLQLAGDGYTSE 192
               +     ++   A   V+T    L     K   +  + L+ RE  CL  A  G T+ 
Sbjct: 133 PERNIDISGALDPKKAIQMVMTVHYRLKMIAAKTAVNPKQMLSPREMLCLVWATRGKTAP 192

Query: 193 EIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           E A   G++  TV  YL  A  KL A +  Q +A A   G +
Sbjct: 193 ETAMLTGINPRTVQHYLDKARAKLGAESVPQLVAIAKDRGLV 234


>gi|37223217|gb|AAQ90206.1| LuxR [Aliivibrio fischeri]
          Length = 233

 Score =  128 bits (321), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 41/212 (19%), Positives = 81/212 (38%), Gaps = 11/212 (5%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           +++  L  +   +   +   Y +         +  I  L NY     +  +       D 
Sbjct: 26  DINQCLSDMTKMV---HCEYYLLAIIYPHSMVKSDISILDNYPKKWREYYDDANLIKYDP 82

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
            + + NS   PI W  I E   +       ++         G +FP+    +  G + F 
Sbjct: 83  IVDYSNSNHSPINWN-IFENNAVNKKSPNVIKEAKTSGLITGFSFPIHTANNGFGMLSFA 141

Query: 136 SEFLMLANEVIIEAH------GACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGY 189
                   + +   H           ++ ++ ++    + +  +LT+RE  CL  A +G 
Sbjct: 142 HSEKDNYIDSLF-LHACMNIPLIVPSLVDNYRKINIANNKSNNDLTKREKECLAWACEGK 200

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNR 221
           +S +I++ LG S  TV  +L +A +KL+  NR
Sbjct: 201 SSWDISKILGCSERTVTFHLTNAQMKLNTTNR 232


>gi|163745782|ref|ZP_02153141.1| transcription regulator, LuxR family, putative [Oceanibulbus
           indolifex HEL-45]
 gi|161380527|gb|EDQ04937.1| transcription regulator, LuxR family, putative [Oceanibulbus
           indolifex HEL-45]
          Length = 253

 Score =  127 bits (320), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 35/208 (16%), Positives = 72/208 (34%), Gaps = 4/208 (1%)

Query: 29  KARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPII 88
                + +  ++       +                   +               +LP+ 
Sbjct: 40  GIDLVSYHGDSTGAPAILYRYEATGAET--PRWHSRFLDVETLRESPVEAIARQQVLPVY 97

Query: 89  WQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI--FTSEFLMLANEVI 146
           W ++ +E  +  + +  +    G  P  GI+  V      +  V   F ++   L++  +
Sbjct: 98  WSAVSKEARLTRAERAYMDRLLGRYPNDGISLKVHGPGGDSAVVGLGFAAKQARLSSIAL 157

Query: 147 IEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVN 206
            +   A       +  L + +S     L+ RE   L+    G ++  IAE LG+S HTV+
Sbjct: 158 YKLLCAAQIAHLRYCALAESQSPRDFGLSPREVEVLEWIATGKSNGVIAEILGISPHTVD 217

Query: 207 AYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             +     KLD  +R  A  + +  G +
Sbjct: 218 TIVRRIFAKLDVNDRTTAAIRGLGAGLL 245


>gi|10954765|ref|NP_066700.1| hypothetical protein pRi1724_p120 [Agrobacterium rhizogenes]
 gi|10567429|dbj|BAB16238.1| riorf119 [Agrobacterium rhizogenes]
          Length = 224

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/222 (19%), Positives = 68/222 (30%), Gaps = 12/222 (5%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDF 76
           +   L    N      FA                I   ++Y  +  DI      +  D  
Sbjct: 11  IKSALKSFANSHGFERFAY--------LQTEALEIRTFNSYPEEWQDIYLGSHYSRIDPV 62

Query: 77  LFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTS 136
           +      +    W +        S  +            +G+  PV   F     + F S
Sbjct: 63  ITEAKRRMETFSWTADDWPARGSSELRRFRDQAIEHGIRSGLTIPVEGSFGSTMMLTFAS 122

Query: 137 EFLMLANEVIIEAHGACYQVITDFLEL----FKKRSSAARNLTERETSCLQLAGDGYTSE 192
                 N  +++   A   V+     L         +  R L+ RE  CL  A  G ++ 
Sbjct: 123 SEKKAENGKVLDGQKATRAVLAIHYRLKIIAATTIVAPKRLLSPREAMCLMWAAKGKSAP 182

Query: 193 EIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           E A   G++  TV  YL  A  KLDA      +A A   G +
Sbjct: 183 ETAMLTGINARTVQHYLDKAREKLDAATVPHLVAIAKDHGLV 224


>gi|197103145|ref|YP_002128523.1| transcriptional regulator, LuxR family [Phenylobacterium zucineum
           HLK1]
 gi|196480421|gb|ACG79948.1| transcriptional regulator, LuxR family [Phenylobacterium zucineum
           HLK1]
          Length = 252

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 38/228 (16%), Positives = 69/228 (30%), Gaps = 10/228 (4%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICEL-HNYDLDSGDIP 65
             ++  S+ EL          +    F    +   +  P R++ +               
Sbjct: 18  DAQQVESIPELEAVFAKTLEPLGVDVF----VGVQIADPLRERHVEVTFGRTHAAWQAHY 73

Query: 66  NILIETYGDDFLFHFNSGLLPIIWQSIQEETVI-ESSGQLSVRLEGGLLPFAGIAFPVRL 124
                   D  +        P+ W  +       +      +          G+  P+  
Sbjct: 74  EAQGHAARDPIVREMLRSTEPLFWSDLPARRGALKPDEARVMEEARSFGLNEGLMTPLHH 133

Query: 125 GFHKNGYVIFTSEFLMLA-NEVIIEAHGACYQ---VITDFLELFKKRSSAARNLTERETS 180
                  V+   E L     +     H        +     +           L+ R+  
Sbjct: 134 VDGSVSAVLMMGERLASDAPDTRAALHLLSIYYGSLARKLRQRNDGGEPQKAKLSARQIE 193

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKA 228
           CL+ A +G +S  I + L LS  TV+ +L SA  KL    R+QA+A+A
Sbjct: 194 CLRWAREGKSSYVIGQILSLSARTVDEHLASACRKLGVHTRMQAVAQA 241


>gi|229526554|ref|ZP_04415958.1| transcriptional regulator LuxR family [Vibrio cholerae bv. albensis
           VL426]
 gi|229336712|gb|EEO01730.1| transcriptional regulator LuxR family [Vibrio cholerae bv. albensis
           VL426]
          Length = 250

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 72/227 (31%), Gaps = 7/227 (3%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
             ++S S   +   +    +         ++ +S LD    +++     ++  D G+  +
Sbjct: 23  QLEESHSFSTVQDIVRQRAHFYGYDKIVFFSAHSTLDGII-ERIYWIEGDWFDD-GENID 80

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                       H      P  W    +   +       V    G     G+  P+    
Sbjct: 81  AATYIKYCPITRHIIETDRPFFWTKKPD---VNREQYRVVAKPKGSGI-HGLQIPIFGHL 136

Query: 127 HKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSS-AARNLTERETSCLQLA 185
              G V    + +  +     E              L +      +  L++RE   L L 
Sbjct: 137 GLEGAVSLGGKAIDSSPRARCELSLLSTYAFFAARRLLESSDPNRSALLSKREKEVLSLT 196

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFG 232
             G    +IA  LG+S  T+  +L +A +KL      + I  AI+ G
Sbjct: 197 ALGRRQADIAIALGVSPRTIENHLRNARLKLGGATTAETIRIAIQRG 243


>gi|116253119|ref|YP_768957.1| AHL-dependent transcriptional regulator [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115257767|emb|CAK08865.1| putative AHL-dependent transcriptional regulator [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 241

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 31/231 (13%), Positives = 69/231 (29%), Gaps = 11/231 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++  +   +   + ++Q          +    A     +         Y         + 
Sbjct: 15  EQIKAAANVDAAIRILQAEYGLDFVTYH---LAQTIAAKIDSPFVRTTYPDAWVSRYLLN 71

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +       LP  W  ++       +  + V  +   +   G + PV     +
Sbjct: 72  SYVKVDPIVKQGFERQLPFDWSEVE---PTPEAYAMLVDAQKHGIGGNGYSIPVADKAQR 128

Query: 129 NGYVIFTSEFLMLANEVIIEAHG-----ACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
              +   +         ++           + +    +      +    +L+ RE  CL 
Sbjct: 129 RALLSLNARIPAEEWAELVRRCRNEWIEIAHLIHRKAVYELHGENDPVPSLSPREIECLH 188

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G   ++I+  LG+S HT   YL +A  KL       A ++A++   I
Sbjct: 189 WTALGKDYKDISVILGISEHTTRDYLKTARFKLGCATISAAASRAVQLRII 239


>gi|217976294|ref|YP_002360441.1| transcriptional regulator, LuxR family [Methylocella silvestris
           BL2]
 gi|217501670|gb|ACK49079.1| transcriptional regulator, LuxR family [Methylocella silvestris
           BL2]
          Length = 244

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 45/240 (18%), Positives = 83/240 (34%), Gaps = 18/240 (7%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  +   S + L   +  I++     N A    +                 Y  +  + 
Sbjct: 12  LLQLETDLSDETLDGFIEYIRHHYGLANIAYLCPSFRGR---SVADPFMALTYREEWVEH 68

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                    D         +LP+ W  +          ++        +   G+  PVR 
Sbjct: 69  YKDEGYGLIDPVHNIGARSVLPLDWARLPRAEK--KVQRMFGEAADAGVGRQGLTIPVRG 126

Query: 125 GFHKNGYVI----------FTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNL 174
             +    +           +      L  +++  AH    +      +  +   +A    
Sbjct: 127 PTNGLWALFSVTSDEADTEWARRRFELTKDMVHIAHYVHQRAYKLHAKEDEIDLNAI--- 183

Query: 175 TERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           T+RE   L+ + +G +  +I+  + +SV TV A+L SA  KL A+NR+ A+ KAIR G I
Sbjct: 184 TKREIEALEWSAEGKSLADISILMRISVETVKAHLDSARYKLCALNRVHAVTKAIRAGLI 243


>gi|37223220|gb|AAQ90208.1| LuxR [Aliivibrio fischeri]
 gi|37223236|gb|AAQ90218.1| LuxR [Aliivibrio fischeri]
 gi|37223247|gb|AAQ90225.1| LuxR [Aliivibrio fischeri]
          Length = 232

 Score =  127 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 42/216 (19%), Positives = 81/216 (37%), Gaps = 11/216 (5%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
            S  +++  L  +   +   +   Y +         +  I  L NY        +     
Sbjct: 22  RSNNDINQCLSDMTKMV---HCEYYLLAIIYPHSMVKSDISILDNYPKKWRQYYDDANLI 78

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  + + NS   PI W  I E   +       ++         G +FP+    +  G 
Sbjct: 79  KYDPIVDYSNSNHSPINWN-IFENNAVNKKSPNVIKEAKTSGLITGFSFPIHTANNGFGM 137

Query: 132 VIFTSEFLMLANEVIIEAH------GACYQVITDFLELFKKRSSAARNLTERETSCLQLA 185
           + F         + +   H           ++ ++ ++    + +  +LT+RE  CL  A
Sbjct: 138 LSFAHSEKDNYIDSLF-LHACMNIPLIVPSLVDNYRKINIANNKSNNDLTKREKECLAWA 196

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNR 221
            +G +S +I++ LG S  TV  +L +A +KL+  NR
Sbjct: 197 CEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNR 232


>gi|15601642|ref|NP_233273.1| LuxR family transcriptional regulator [Vibrio cholerae O1 biovar
           eltor str. N16961]
 gi|121726448|ref|ZP_01679712.1| transcriptional regulator, LuxR family [Vibrio cholerae V52]
 gi|147671672|ref|YP_001215191.1| LuxR family transcriptional regulator [Vibrio cholerae O395]
 gi|153802474|ref|ZP_01957060.1| transcriptional regulator, LuxR family [Vibrio cholerae MZO-3]
 gi|153819712|ref|ZP_01972379.1| transcriptional regulator, LuxR family [Vibrio cholerae NCTC 8457]
 gi|153822367|ref|ZP_01975034.1| transcriptional regulator, LuxR family [Vibrio cholerae B33]
 gi|227812454|ref|YP_002812464.1| transcriptional regulator, LuxR family [Vibrio cholerae M66-2]
 gi|229510178|ref|ZP_04399658.1| transcriptional regulator LuxR family [Vibrio cholerae B33]
 gi|229517693|ref|ZP_04407138.1| transcriptional regulator LuxR family [Vibrio cholerae RC9]
 gi|254850052|ref|ZP_05239402.1| transcriptional regulator [Vibrio cholerae MO10]
 gi|298499668|ref|ZP_07009474.1| LuxR family transcriptional regulatory, chaperone HchA-associated
           [Vibrio cholerae MAK 757]
 gi|9658321|gb|AAF96785.1| transcriptional regulator, LuxR family [Vibrio cholerae O1 biovar
           El Tor str. N16961]
 gi|121631043|gb|EAX63420.1| transcriptional regulator, LuxR family [Vibrio cholerae V52]
 gi|124121993|gb|EAY40736.1| transcriptional regulator, LuxR family [Vibrio cholerae MZO-3]
 gi|126509730|gb|EAZ72324.1| transcriptional regulator, LuxR family [Vibrio cholerae NCTC 8457]
 gi|126520130|gb|EAZ77353.1| transcriptional regulator, LuxR family [Vibrio cholerae B33]
 gi|146314055|gb|ABQ18595.1| transcriptional regulator, LuxR family [Vibrio cholerae O395]
 gi|227011596|gb|ACP07807.1| transcriptional regulator, LuxR family [Vibrio cholerae M66-2]
 gi|227015536|gb|ACP11745.1| transcriptional regulator, LuxR family [Vibrio cholerae O395]
 gi|229345729|gb|EEO10702.1| transcriptional regulator LuxR family [Vibrio cholerae RC9]
 gi|229352623|gb|EEO17563.1| transcriptional regulator LuxR family [Vibrio cholerae B33]
 gi|254845757|gb|EET24171.1| transcriptional regulator [Vibrio cholerae MO10]
 gi|297541649|gb|EFH77700.1| LuxR family transcriptional regulatory, chaperone HchA-associated
           [Vibrio cholerae MAK 757]
          Length = 253

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 72/227 (31%), Gaps = 7/227 (3%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
             ++S S   +   +    +         ++ +S LD    +++     ++  D G+  +
Sbjct: 26  QLEESHSFSTVQDIVRQRAHFYGYDKIVFFSAHSTLDGII-ERIYWIEGDWFDD-GENID 83

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                       H      P  W    +   +       V    G     G+  P+    
Sbjct: 84  AATYIKYCPITRHIIETDRPFFWTKKPD---VNREQYRVVAKPKGSGI-HGLQIPIFGHL 139

Query: 127 HKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSS-AARNLTERETSCLQLA 185
              G V    + +  +     E              L +      +  L++RE   L L 
Sbjct: 140 GLEGAVSLGGKAIDSSPRARCELSLLSTYAFFAARRLLESSDPNRSALLSKREKEVLSLT 199

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFG 232
             G    +IA  LG+S  T+  +L +A +KL      + I  AI+ G
Sbjct: 200 ALGRRQADIAIALGVSPRTIENHLRNARLKLGGATTAETIRIAIQRG 246


>gi|167736315|dbj|BAG07414.1| AHL-dependent transcriptional regulator [Gluconacetobacter
           intermedius]
          Length = 236

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 42/229 (18%), Positives = 76/229 (33%), Gaps = 9/229 (3%)

Query: 7   TGKKSSSLQELSPR-LHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIP 65
             + +++  +L    L  + +        ++     L+     +       Y  +  +  
Sbjct: 14  DLENAATKHDLLSIYLDAVLSVGN-----VHVTIVELNRIEDPKENFIHVGYPTEWVNFY 68

Query: 66  NILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLG 125
                   D  +        P  W  I+     E      +R         G+  PV   
Sbjct: 69  IENNYIVSDPIIKKSRFMSHPYFWHEIKNINKAEKK---IIRDVSEFGIKKGLTIPVHTH 125

Query: 126 FHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLA 185
                 + F      +  E+ +         IT + +L +    +   LT RE  CL   
Sbjct: 126 DRVIYAICFAFTDKNIDREIELYLRALSNFFITGYKKLDEPADMSLPILTPREKECLTWT 185

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             G +S E    +G+S  TVN ++ +A +KL   NRI  + +AI  G I
Sbjct: 186 AKGKSSWETGMIVGVSERTVNFHINNALLKLKCTNRIMGVVRAICAGLI 234


>gi|229505968|ref|ZP_04395477.1| transcriptional regulator LuxR family [Vibrio cholerae BX 330286]
 gi|229605500|ref|YP_002876204.1| transcriptional regulator LuxR family [Vibrio cholerae MJ-1236]
 gi|229356319|gb|EEO21237.1| transcriptional regulator LuxR family [Vibrio cholerae BX 330286]
 gi|229371986|gb|ACQ62408.1| transcriptional regulator LuxR family [Vibrio cholerae MJ-1236]
          Length = 250

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 72/227 (31%), Gaps = 7/227 (3%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
             ++S S   +   +    +         ++ +S LD    +++     ++  D G+  +
Sbjct: 23  QLEESHSFSTVQDIVRQRAHFYGYDKIVFFSAHSTLDGII-ERIYWIEGDWFDD-GENID 80

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                       H      P  W    +   +       V    G     G+  P+    
Sbjct: 81  AATYIKYCPITRHIIETDRPFFWTKKPD---VNREQYRVVAKPKGSGI-HGLQIPIFGHL 136

Query: 127 HKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSS-AARNLTERETSCLQLA 185
              G V    + +  +     E              L +      +  L++RE   L L 
Sbjct: 137 GLEGAVSLGGKAIDSSPRARCELSLLSTYAFFAARRLLESSDPNRSALLSKREKEVLSLT 196

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFG 232
             G    +IA  LG+S  T+  +L +A +KL      + I  AI+ G
Sbjct: 197 ALGRRQADIAIALGVSPRTIENHLRNARLKLGGATTAETIRIAIQRG 243


>gi|317050861|ref|YP_004111977.1| regulatory protein LuxR [Desulfurispirillum indicum S5]
 gi|316945945|gb|ADU65421.1| regulatory protein LuxR [Desulfurispirillum indicum S5]
          Length = 243

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 38/187 (20%), Positives = 61/187 (32%), Gaps = 9/187 (4%)

Query: 51  ICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEG 110
               H       +   +      D           P+ W   Q       +    +    
Sbjct: 62  TLVQHQCPEPWLETYVVRKLWRTDPVFQQVRRSPEPLRWSQTQNRHSPNPA----LLEAS 117

Query: 111 GLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIE---AHGACYQVITDFLELFKKR 167
                 GI+     G      +        +     +           + +  + +  ++
Sbjct: 118 RHGLTDGISIG--YGAGNRTLISLAGSRQQIHAISSLACRVLPLLAPLIHSASVRIAHRQ 175

Query: 168 SSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAK 227
                NL+ERE   L    +G ++EEI+  L +S  TV  +L     KLDAVNR  AIAK
Sbjct: 176 DIPDTNLSERERELLFWTAEGKSTEEISMILAISRDTVKYHLKRIYQKLDAVNRHHAIAK 235

Query: 228 AIRFGYI 234
           A+R G I
Sbjct: 236 ALRAGLI 242


>gi|86359968|ref|YP_471858.1| LuxR family transcriptional regulator [Rhizobium etli CFN 42]
 gi|86284070|gb|ABC93131.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli CFN 42]
          Length = 264

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 47/243 (19%), Positives = 81/243 (33%), Gaps = 16/243 (6%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNF-----ALYTINSALDFPRRQQLICELHNYDLDSG 62
            ++ ++ + L  R+      +K   F         +   +D       + +L N   D  
Sbjct: 9   RRQFTTHETLEGRIDQAFEAMKQLGFEALIYDYTPVPYDIDGVIMVPSLLKLRNIAEDMH 68

Query: 63  DIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESS-----GQLSVRLEGGLLPFAG 117
           D          D           P  W    +   +             R         G
Sbjct: 69  DYWFDRGYFRIDPVQQVALRTSAPFFWNYDPDADTLIRRFMSEDTAPVTRYLSERDMSTG 128

Query: 118 IAFPVRLGFHKNGYVIFTSEFLMLANEV-----IIEAHGACYQVITDFLELFKKRS-SAA 171
           +  PV +       V           E      I + +   +        LF ++  S  
Sbjct: 129 VTVPVHMPRGDYATVTGIRFGRNSDFERHALRYIADFNLLAHVFHETAYALFDRKDKSVG 188

Query: 172 RNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRF 231
             LTERE  CL+ + +GY+++EI+  +  SV TV  +L +A  KL A NR QA+ +A  +
Sbjct: 189 IRLTERERECLRHSAEGYSAKEISRIIDRSVPTVVMHLNAAAKKLGARNRTQAVVRATHY 248

Query: 232 GYI 234
             +
Sbjct: 249 RLL 251


>gi|311279344|ref|YP_003941575.1| transcriptional regulator, LuxR family [Enterobacter cloacae SCF1]
 gi|308748539|gb|ADO48291.1| transcriptional regulator, LuxR family [Enterobacter cloacae SCF1]
          Length = 237

 Score =  126 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 36/227 (15%), Positives = 68/227 (29%), Gaps = 15/227 (6%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDF 76
           +  +L    N +   ++A   ++      +    I  + NY  +           Y D  
Sbjct: 13  IKNQLETTLNTLGDLSWAYVVLSK-----KDMSCIFGVTNYPDEWVTQYKEKGLQYTDPV 67

Query: 77  LFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTS 136
           +    + L P  W          +  +L ++         G  F +    +    + F  
Sbjct: 68  VITALNRLTPFSWNEKLLVRSDFNFEKLFIQ-ASQFGIINGYTFVLHDNQNNLVTLSFII 126

Query: 137 EF-LMLANEVIIEAH-----GACYQVITDFL---ELFKKRSSAARNLTERETSCLQLAGD 187
                     ++  H          V   +L    L +K +      T RE   L     
Sbjct: 127 PAAKGAEIMELLIQHKGDISLLLASVHETYLTLTSLSEKDTDKHSQFTPRENEILHWTSL 186

Query: 188 GYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           G T +E    LG+ V TV  ++ +   K+   N   A+   +    I
Sbjct: 187 GKTYQETGMILGIKVRTVKFHMSNIVKKMGVANARHAVRLGVELQLI 233


>gi|9622950|gb|AAF89989.1|AF210630_2 AHL-dependent transcriptional regulator CinR [Rhizobium
           leguminosarum]
          Length = 241

 Score =  126 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 30/231 (12%), Positives = 67/231 (29%), Gaps = 11/231 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++  +   +   + ++Q          +   +                Y         + 
Sbjct: 15  EQIKAAANVDAAIRILQAEYNLDFVTYHLAQTIASKIDSP---FVRTTYPDAWVSRYLLN 71

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +       LP  W  ++       +  + V  +   +   G + PV     +
Sbjct: 72  SYVKVDPIVKQGFERQLPFDWSEVE---PTPEAYAMLVDAQKHGIGGNGYSIPVADKAQR 128

Query: 129 NGYVIFTSEFLMLANEVIIEAHG-----ACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
              +   +         ++           + +    +      +     L+ RE  CL 
Sbjct: 129 RALLSLNARIPADEWTELVRRCRNEWIEIAHLIHRKAVYELHGENDPVPALSPREIECLH 188

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G   ++I+  LG+S HT   YL +A  KL       A ++A++   I
Sbjct: 189 WTALGKDYKDISVILGISEHTTRDYLKTARFKLGCATISAAASRAVQLRII 239


>gi|327189685|gb|EGE56833.1| autoinducer transcriptional regulator protein [Rhizobium etli
           CNPAF512]
          Length = 277

 Score =  126 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 30/231 (12%), Positives = 67/231 (29%), Gaps = 11/231 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++  +   +   + ++Q          +   +                Y         + 
Sbjct: 51  EQIKAAPNVDAAIRILQAEYGLDFVTYHLAQTIASKIDSP---FVRTTYPDAWVSRYLLN 107

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +       LP  W  ++       +  + V  +   +   G + PV     +
Sbjct: 108 SYVKVDPIVKQGFERQLPFDWSEVE---PTPEAYAMLVDAQKHGIGGNGYSIPVADKAQR 164

Query: 129 NGYVIFTSEFLMLANEVIIEAHG-----ACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
              +   +         ++           + +    +      +     L+ RE  CL 
Sbjct: 165 RALLSMNARIPADHWAELVRRCRNEWIEIAHLIHQKAVYELYGENDPVPALSPREIECLH 224

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G   ++I+  LG+S HT   YL +A  KL       A ++A++   I
Sbjct: 225 WTALGKDYKDISVILGISEHTTRDYLKTARFKLGCATISAAASRAVQLRII 275


>gi|316931973|ref|YP_004106955.1| autoinducer-binding domain-containing protein [Rhodopseudomonas
           palustris DX-1]
 gi|315599687|gb|ADU42222.1| Autoinducer-binding domain protein [Rhodopseudomonas palustris
           DX-1]
          Length = 242

 Score =  126 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 43/227 (18%), Positives = 73/227 (32%), Gaps = 11/227 (4%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
               +    ELS  + +    +    FA   +   LD   R      +  Y  +      
Sbjct: 11  HLSSAEDQAELSGAMAVTAAALDLSCFAYLALPQKLDGTPR-----LMSTYPKEWTSHYL 65

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                  D  +        P  W     E  +  + +  +          G   P+  G 
Sbjct: 66  RSHYERIDPVIMQALRDTEPFRWGIGSTERYLSPAQKRLLDEASQYGIRLGFTVPIHDGH 125

Query: 127 HKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAAR------NLTERETS 180
                V F         E  + ++    Q++  F     +R  A+        L+ RE  
Sbjct: 126 GPVAAVTFAGNQREAQFERFVTSNPRMLQLMAMFFHSHVRRKLASDLRVDGAALSAREFE 185

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAK 227
           CL+ A  G ++ +I   LG+S HT  +YL +A  KL     +QA  +
Sbjct: 186 CLEWAARGKSAWDIGRILGISHHTAISYLNNAKAKLGVRTVVQAALR 232


>gi|253987735|ref|YP_003039091.1| transcription regulator SdiA [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|211638613|emb|CAR67232.1| similar to probable transcription regulator sdia of escherichia
           coli [Photorhabdus asymbiotica subsp. asymbiotica ATCC
           43949]
 gi|253779185|emb|CAQ82345.1| similar to probable transcription regulator SdiA of Escherichia
           coli [Photorhabdus asymbiotica]
          Length = 242

 Score =  126 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 43/222 (19%), Positives = 78/222 (35%), Gaps = 10/222 (4%)

Query: 21  LHLIQNRIK-ARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFH 79
           +  I   I     F L+++     FP   + +    NY      +         D  L  
Sbjct: 23  IDEICELIDKISGFRLFSLVLKTRFPVSGREVYFFDNYHESWRALYIEKKYWMIDPVLH- 81

Query: 80  FNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFL 139
               + P   +        ES+G+    +       +G+ F +       G      +  
Sbjct: 82  -FRPVPPTFSRVWDLNFFAESNGKELWYMTQEHGFRSGVTFGLPAFSGTYGIFSVAGKDG 140

Query: 140 MLANE-------VIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSE 192
            + N+        I++ +    + +    +  +       + + RE   L+   DG  S 
Sbjct: 141 PIDNDTMYKCSGEILKVYIRIIRYLISHTKYLQTFYIDEISFSHRELEVLRYTADGMISS 200

Query: 193 EIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           EIA  + ++  TV+ +L +   KL   N+ QAIAKA   GYI
Sbjct: 201 EIASTICVTKSTVDFHLMNIVKKLGCRNKFQAIAKAALLGYI 242


>gi|15966568|ref|NP_386921.1| putative transcription regulator protein [Sinorhizobium meliloti
           1021]
 gi|307300395|ref|ZP_07580175.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
 gi|307318260|ref|ZP_07597695.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|15075839|emb|CAC47394.1| Transcription regulator LuxR family [Sinorhizobium meliloti 1021]
 gi|306895942|gb|EFN26693.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|306904561|gb|EFN35145.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
          Length = 260

 Score =  126 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 48/243 (19%), Positives = 84/243 (34%), Gaps = 18/243 (7%)

Query: 4   NTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGD 63
           +TL G+    + ++   +  I    +A  +    +   LD       + +L N   D  D
Sbjct: 16  DTLDGR----IDQVFEAMKSIG--FEALIYDYTPVPRDLDGTIMVPSLLKLRNISEDMHD 69

Query: 64  IPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESS-----GQLSVRLEGGLLPFAGI 118
                     D           P  W    +   +             R         G+
Sbjct: 70  YWFDRGYFRIDPVQQVALRTSTPFFWNYDPDADTLIRRFMSDDTAPVARYLSERDMSTGV 129

Query: 119 AFPVRLGFHKNGYVIFTSEFLMLANE-----VIIEAHGACYQVITDFLELFKKRS--SAA 171
             PV +       V         A E      I + +   +        LF  ++  +  
Sbjct: 130 TVPVHMPRGDYATVTGVRFGGNRAFEGHALRYIADFNLLAHVFHEAAYSLFDAQAFNAGT 189

Query: 172 RNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRF 231
             LTERE  CL+ + +G++++EI+  +  SV TV  +L +A  KL A NR QA+ +A  +
Sbjct: 190 ARLTERERECLRYSAEGHSAKEISRIIHRSVPTVVMHLNAAAKKLGAKNRTQAVVRATHY 249

Query: 232 GYI 234
             +
Sbjct: 250 RLL 252


>gi|116249629|ref|YP_765467.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115254277|emb|CAK03896.1| putative LuxR family transcriptional regulator [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 270

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 47/233 (20%), Positives = 79/233 (33%), Gaps = 14/233 (6%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           + +    +  I    +A  +    +   LD       + +L N   D  D          
Sbjct: 27  IDQAFEAMKQIG--FEALIYDYTPVPYDLDGAIMIPSLLKLRNISDDMHDYWFNRGYFRI 84

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESS-----GQLSVRLEGGLLPFAGIAFPVRLGFHK 128
           D           P  W    +   + +           R         G+  PV +    
Sbjct: 85  DPVQQVALRTSAPFFWNYDPDADTLINRFMTEDTAPVTRYLSERDMSTGVTVPVHMPRGD 144

Query: 129 NGYVIFTSEFLMLANEV-----IIEAHGACYQVITDFLELFKKRSSA--ARNLTERETSC 181
              V           E      I + +   +        LF  R+ +     LTERE  C
Sbjct: 145 YATVTGIRFGRNKDFERHALRYIADFNLLAHVFHETAYSLFDTRAKSVGTIRLTEREREC 204

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           L+ + +GY+++EI+  +  SV TV  +L +AT KL A NR QA+ +A  +  +
Sbjct: 205 LRHSAEGYSAKEISRIIDRSVPTVVMHLNAATKKLGARNRTQAVVRATHYRLL 257


>gi|190894575|ref|YP_001984868.1| putative LuxR family transcriptional regulator [Rhizobium etli CIAT
           652]
 gi|190700236|gb|ACE94318.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli CIAT 652]
 gi|327189865|gb|EGE57000.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli CNPAF512]
          Length = 265

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 47/233 (20%), Positives = 77/233 (33%), Gaps = 14/233 (6%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           + +    +  I    +A  +    +   LD       + +L N   D  D          
Sbjct: 22  IDQAFEAMKQIG--FEALIYDYTPVPYDLDGAIMIPSLLKLRNISDDMHDYWFDRGYFRI 79

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVI-----ESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
           D           P  W    +   +             R         G+  PV +    
Sbjct: 80  DPVQQVALRTSAPFFWNYDPDADTLIKGFMSEDTAPVTRYLSERDMSTGVTVPVHMPRGD 139

Query: 129 NGYVIFTSEFLMLANEV-----IIEAHGACYQVITDFLELFKK--RSSAARNLTERETSC 181
              V           E      I + +   +        LF +  RS     LTERE  C
Sbjct: 140 YATVTGIRFGRNNDFERHALRYIADFNLLAHVFHEAAYSLFDRKARSVGTVRLTEREREC 199

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           L+ + +GY+++EI+  +  SV TV  +L +A  KL A NR QA+ +A  +  +
Sbjct: 200 LRHSAEGYSAKEISRIIDRSVPTVVMHLNAAAKKLGARNRTQAVVRATHYRLL 252


>gi|241258818|ref|YP_002978702.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240863288|gb|ACS60951.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 275

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 47/233 (20%), Positives = 79/233 (33%), Gaps = 14/233 (6%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           + +    +  I    +A  +    +   LD       + +L N   D  D          
Sbjct: 32  IDQAFEAMKQIG--FEALIYDYTPVPYDLDGAIMIPSLLKLRNISDDMHDYWFNRGYFRI 89

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESS-----GQLSVRLEGGLLPFAGIAFPVRLGFHK 128
           D           P  W    +   + +           R         G+  PV +    
Sbjct: 90  DPVQQVALRTSAPFFWNYDPDADTLINRFMTEDTAPVTRYLSERDMSTGVTVPVHMPRGD 149

Query: 129 NGYVIFTSEFLMLANEV-----IIEAHGACYQVITDFLELFKKRSSA--ARNLTERETSC 181
              V           E      I + +   +        LF  R+ +     LTERE  C
Sbjct: 150 YATVTGIRFGRNKDFERHALRYIADFNLLAHVFHETAYSLFDTRAKSVGTIRLTEREREC 209

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           L+ + +GY+++EI+  +  SV TV  +L +AT KL A NR QA+ +A  +  +
Sbjct: 210 LRHSAEGYSAKEISRIIDRSVPTVVMHLNAATKKLGARNRTQAVVRATHYRLL 262


>gi|18104535|gb|AAL59595.1|AF393621_2 CinR [Rhizobium etli]
          Length = 241

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 30/231 (12%), Positives = 67/231 (29%), Gaps = 11/231 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++  +   +   + ++Q          +   +                Y         + 
Sbjct: 15  EQIKAAPNVDAAIRILQAEYGLDFVTYHLAQTIASKIDSP---FVRTTYPDAWVSRYLLN 71

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +       LP  W  ++       +  + V  +   +   G + PV     +
Sbjct: 72  SYVKVDPIVKQGFERQLPFDWSEVE---PTPEAYAMLVDAQKHGIGGNGYSIPVADKAQR 128

Query: 129 NGYVIFTSEFLMLANEVIIEAHG-----ACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
              +   +         ++           + +    +      +     L+ RE  CL 
Sbjct: 129 RALLSMNARIPADHWAELVRRCRNEWIEIAHLIHQKAVYELYGENDPVPALSPREIECLH 188

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G   ++I+  LG+S HT   YL +A  KL       A ++A++   I
Sbjct: 189 WTALGKDYKDISVILGISEHTTRDYLKTARFKLGCATISAAASRAVQLRII 239


>gi|229528208|ref|ZP_04417599.1| transcriptional regulator LuxR family [Vibrio cholerae 12129(1)]
 gi|229334570|gb|EEO00056.1| transcriptional regulator LuxR family [Vibrio cholerae 12129(1)]
          Length = 250

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 72/227 (31%), Gaps = 7/227 (3%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
             ++S S   +   +    +         ++ +S LD    +++     ++  D G+  +
Sbjct: 23  QLEESHSFSTVQDIVRQRAHFYGYDKIVFFSAHSTLDGII-ERIYWIEGDWFDD-GENID 80

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                       H      P  W    +   +       V    G     G+  P+    
Sbjct: 81  AATYIKYCPITRHIIETDRPFFWTKKPD---VNREQYRVVAKPKGSGI-HGLQIPIFGHL 136

Query: 127 HKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSS-AARNLTERETSCLQLA 185
              G V    + +  +     E              L +      +  L++RE   L L 
Sbjct: 137 GLEGAVSLGGKAIDSSPRARCELSLLSTYAFFAARRLLEYSDPNRSALLSKREKEVLSLT 196

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFG 232
             G    +IA  LG+S  T+  +L +A +KL      + I  AI+ G
Sbjct: 197 ALGRRQADIAIALGVSPRTIENHLRNARLKLGGATTAETIRIAIQRG 243


>gi|218661626|ref|ZP_03517556.1| autoinducer transcriptional regulator protein [Rhizobium etli
           IE4771]
          Length = 243

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 30/231 (12%), Positives = 67/231 (29%), Gaps = 11/231 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++  +   +   + ++Q          +   +                Y         + 
Sbjct: 17  EQIKAAPHVDAAIRILQAGYGLDFVTYHLAQTIASKIDSP---FVRTTYPDAWVSRYLLN 73

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +       LP  W  ++       +  + V  +   +   G + PV     +
Sbjct: 74  SYVKVDPIVKQGFERQLPFDWSEVE---PTPEAYAMLVDAQKHGIGGNGYSIPVADKAQR 130

Query: 129 NGYVIFTSEFLMLANEVIIEAHG-----ACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
              +   +         ++           + +    +      +     L+ RE  CL 
Sbjct: 131 RALLSMNARIPAEEWAELVRRCRNEWIEIAHLIHRKAVYELHGENDPVPALSPREIECLH 190

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G   ++I+  LG+S HT   YL +A  KL       A ++A++   I
Sbjct: 191 WTALGKDYKDISVILGISEHTTRDYLKTARFKLGCATISAAASRAVQLRII 241


>gi|37223228|gb|AAQ90213.1| LuxR [Aliivibrio logei]
          Length = 232

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 43/216 (19%), Positives = 82/216 (37%), Gaps = 11/216 (5%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
            S  +++  L  +   +   +   Y +         +  I  L NY        +     
Sbjct: 22  RSNNDINQCLSDMTKMV---HCEYYLLAIIYPHSMVKSDISILDNYPKKWRQYYDDANLI 78

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  + + NS   PI W  I E   +       ++         G +FP+    +  G 
Sbjct: 79  KYDPIVDYSNSNHSPINWN-IFENNAVNKKSPNVIKEAKTSGLITGFSFPIHTANNGFGM 137

Query: 132 VIFTSEFLMLANEVIIEAH------GACYQVITDFLELFKKRSSAARNLTERETSCLQLA 185
           + F         + +   H           ++ ++ ++    + +  +LT+RE  CL  A
Sbjct: 138 LSFAHSEKDNYIDSLF-LHACMNIPLIVPSLVDNYRKINIANNKSNNDLTKREKECLAWA 196

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNR 221
            +G +S +I++ LG SV TV  +L +A +KL+  NR
Sbjct: 197 CEGKSSWDISKILGCSVRTVTFHLTNAQMKLNTTNR 232


>gi|332525929|ref|ZP_08402070.1| LuxR family transcriptional regulator [Rubrivivax benzoatilyticus
           JA2]
 gi|332109480|gb|EGJ10403.1| LuxR family transcriptional regulator [Rubrivivax benzoatilyticus
           JA2]
          Length = 242

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 40/239 (16%), Positives = 82/239 (34%), Gaps = 14/239 (5%)

Query: 4   NTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGD 63
           + L    +S       RL      +    F +      +  P +  ++  L N   D  +
Sbjct: 10  DFLDIGTASDHATFKSRLVSFAQNLD---FQIVQAVLMIKRPSQPSVVSRLSNLPSDFAE 66

Query: 64  IPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVR 123
                 ++  D  L    +  +P ++    + T +E+        +       GI+  + 
Sbjct: 67  ASMDEADSRRDPVLQRLRTASVPFVY---DQTTYVEAGAGDLWETQARYGFRTGISMSLH 123

Query: 124 LGFHKNGYVIFTSEFLMLANE-----VIIEAHGACYQVITDFLELF---KKRSSAARNLT 175
           +   +        E  + A+E     ++ +              +             LT
Sbjct: 124 MPGGRQFLFGVDREQALPADERELMRLMADLQLLAVHAQETAARVMMPKLDSLPKRPKLT 183

Query: 176 ERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            RE   LQ   +G ++  I + L +S HTV  +L +A  KL+  ++  A+ KA+  G +
Sbjct: 184 PREREVLQWTREGKSAWAIGQILSMSEHTVVFHLRNAMTKLEVSSKHSAVLKAMEIGLL 242


>gi|254521823|ref|ZP_05133878.1| transcriptional regulator, LuxR family [Stenotrophomonas sp. SKA14]
 gi|219719414|gb|EED37939.1| transcriptional regulator, LuxR family [Stenotrophomonas sp. SKA14]
          Length = 230

 Score =  126 bits (317), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 45/231 (19%), Positives = 79/231 (34%), Gaps = 7/231 (3%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            L  +++ SL  +   LH I   +      ++   + L     Q++     ++  +  D 
Sbjct: 4   LLELERARSLDAVGAVLHGIAAPLGYDRVLVFATGTGLKR-GTQRVYWINGDWLGEGSDT 62

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
                  +      H      P  W     + +     Q+  +  G  L   G+  PV  
Sbjct: 63  DLA-GYLHACPVNRHVLDSDAPFFWSKR--QGLRGERYQVVKQPRGEGL--HGLQVPVFG 117

Query: 125 GFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNL-TERETSCLQ 183
                G + F    +  +    ++   A          L +  ++ + +L + RE   L+
Sbjct: 118 TTGLEGAISFAGTSIDASASARLQLEAAATAAFRAARRLAEVPAALSGSLLSTREREVLR 177

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G    EIA  LGLS  TV  +L  A  +L      QA+  A R G I
Sbjct: 178 WVAAGRRQAEIATTLGLSARTVENHLRHARQRLGVATTAQAVRAATRRGEI 228


>gi|2791836|gb|AAC38403.1| transcriptional activator CarR [Pectobacterium carotovorum subsp.
           carotovorum]
          Length = 244

 Score =  126 bits (316), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 32/232 (13%), Positives = 71/232 (30%), Gaps = 21/232 (9%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           E+   +      +    F+ + ++              + NY     +          D 
Sbjct: 4   EIHSFIKRKLKGVGDVWFSYFMMSKT-----STSHPYIISNYPEAWMNEYLKKEMFLSDP 58

Query: 76  FLFHFNSGLLPIIWQSIQE-ETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
            +    + + P  W          ++       +       +G  F +    +    +  
Sbjct: 59  IIVASLARITPFSWDDNDLVTLRAKNQDVFISSV--QHDISSGYTFVLHDHDNNVATLSI 116

Query: 135 TSEFLMLAN---------EVIIEAHGACYQVITDFLELFKKRSSAARN----LTERETSC 181
            +                ++ +       +V+     +  +      +    L+ RET  
Sbjct: 117 ANHLEDADFEKCMKSHENDLQMLLVNVHEKVMAYQRAIKDQAKPPDSSRNALLSPRETEV 176

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGY 233
           L L   G T +E++  LG+S  TV  ++ ++  KLD +N   AI KA+    
Sbjct: 177 LFLVSSGRTYKEVSRILGISEVTVKFHINNSVRKLDVINSRHAITKALELNL 228


>gi|239908483|ref|YP_002955225.1| LuxR family transcriptional regulator [Desulfovibrio magneticus
           RS-1]
 gi|239798350|dbj|BAH77339.1| LuxR family transcriptional regulator [Desulfovibrio magneticus
           RS-1]
          Length = 257

 Score =  126 bits (316), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 35/183 (19%), Positives = 59/183 (32%), Gaps = 7/183 (3%)

Query: 56  NYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPF 115
           NY ++          +  D  +    +   P  W    +        +  + L       
Sbjct: 75  NYPVEWLQTYKEKNFSGIDVIVKRNFTSFTPQYWDHTYKAHKP---AREFITLASDFNLI 131

Query: 116 AGIAFPVR--LGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARN 173
            G  +  R      +     F+  F      VI         +      + + R      
Sbjct: 132 HGYTYGARPFGFCKQASLFSFSGNFKKYDPTVIAILQTIVPHLHLASSRIIESRLIQHNR 191

Query: 174 --LTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRF 231
             L+ RE   L     G +S +I+  L +S  TVN ++ +   KLD  NR QA+A A   
Sbjct: 192 KLLSGREREVLSWLKHGKSSWDISTILQISECTVNYHIYNIIKKLDVQNRPQAVAVATHL 251

Query: 232 GYI 234
           G +
Sbjct: 252 GIL 254


>gi|297580055|ref|ZP_06941982.1| transcriptional regulator [Vibrio cholerae RC385]
 gi|297535701|gb|EFH74535.1| transcriptional regulator [Vibrio cholerae RC385]
          Length = 253

 Score =  126 bits (316), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 73/227 (32%), Gaps = 7/227 (3%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
             ++S S  ++   +    +         ++ +S LD    +++     ++  D G+  +
Sbjct: 26  QLEESHSFSKVQDIVRQRAHFYGYDKIVFFSAHSTLDGII-ERIYWIEGDWFDD-GENID 83

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                       H      P  W    +   +       V    G     G+  P+    
Sbjct: 84  AATYIKYCPITRHIIETDRPFFWTKKPD---VNREQYRVVAKPKGSGI-HGLQIPIFGHL 139

Query: 127 HKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSS-AARNLTERETSCLQLA 185
              G V    + +  +     E              L +      +  L++RE   L L 
Sbjct: 140 GLEGAVSLGGKAIDSSPRARCELSLLSTYAFFAARRLLESSDPNRSALLSKREKEVLSLT 199

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFG 232
             G    +IA  LG+S  T+  +L +A +KL      + I  AI+ G
Sbjct: 200 ALGRRQADIAIALGVSPRTIENHLRNARLKLGGATTAETIRIAIQRG 246


>gi|15966467|ref|NP_386820.1| putative transcription regulator protein [Sinorhizobium meliloti
           1021]
 gi|15075738|emb|CAC47293.1| Transcription regulator LuxR family [Sinorhizobium meliloti 1021]
          Length = 247

 Score =  126 bits (316), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 54/231 (23%), Positives = 92/231 (39%), Gaps = 4/231 (1%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            +      +  EL   +  + +R    +F +  +  A +    ++L   L N+  +    
Sbjct: 20  EIDPASVRTEYELLHLMRRLISRYGFAHFMIARLPLADEQRFSERL--VLSNWPAELVQQ 77

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQ-SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVR 123
            +        + +       LP+     + E     +     +RL          A  + 
Sbjct: 78  YDAGETFQTSELVERLRQTKLPVTGGPELMEPAGKGAGKAAFIRLPPHAGMGH-FAVLLH 136

Query: 124 LGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
             + +    + +      A       + A  Q+       F   S A   L+ RE  CL+
Sbjct: 137 TTYGEPFVAVLSGTRDEPAGAERATLYLALLQLFECLERTFDAGSGAREKLSSREVECLR 196

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            A  G +S+EIA  LG+S +TV++Y  SAT KLDAVNR+QAIA+A+R   I
Sbjct: 197 WAAAGKSSDEIAIILGISAYTVSSYFKSATRKLDAVNRMQAIARAMRMKLI 247


>gi|13472562|ref|NP_104129.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
 gi|14023308|dbj|BAB49915.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
          Length = 256

 Score =  126 bits (316), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 67/226 (29%), Positives = 107/226 (47%), Gaps = 5/226 (2%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           + ++ +   R   I   I A  F LY ++ + +    + + C   +Y   +      +  
Sbjct: 33  AVTIPDAVRRCRWISVDINASAFGLYFVSPSPERA--RLVPCFDSDYPGIAVAT-KFIAG 89

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLL--PFAGIAFPVRLGFHK 128
             G++ + H ++   P  W       + E  G L+   +   L    +GIAFPV     +
Sbjct: 90  ANGEEIVRHTHNSTEPRWWTDDGLAAMAEMFGNLAWTAQLSPLAPGTSGIAFPVHADRGQ 149

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDG 188
            G V+F    + L  + + E H  C+ +      +    +   R +++RE  CL+L  +G
Sbjct: 150 CGLVVFLGSKMALPQDALYEIHARCFSLFAAVARIRPSDAGRMRAISKRELECLKLTANG 209

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            TSEEIA  L LSVHT N YL  +T KL+AVNR QA+AKA+R G I
Sbjct: 210 NTSEEIARLLKLSVHTANQYLTQSTQKLNAVNRNQAVAKALRLGLI 255


>gi|209552217|ref|YP_002284132.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209539329|gb|ACI59261.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 258

 Score =  126 bits (316), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 82/233 (35%), Gaps = 14/233 (6%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           + +    +  I    +A  +    +   LD       + +L N   D  D          
Sbjct: 22  IDQAFEAMKQIG--FEALIYDYTPVPYDLDGAIMIPSLLKLRNIADDMHDYWFDRGYFRI 79

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESS-----GQLSVRLEGGLLPFAGIAFPVRLGFHK 128
           D           P  W    +   + +           R         G+  PV +    
Sbjct: 80  DPVQQVALRSTAPFFWNYDTDADTLINRFMSDDTAPVARYLNERDMSTGVTVPVHMPGGD 139

Query: 129 NGYVIFTS-----EFLMLANEVIIEAHGACYQVITDFLELFKKRSSA--ARNLTERETSC 181
              V         EF   A   I + +   +        LF K++ +     LTERE  C
Sbjct: 140 YATVTGIRFGGNSEFERHALRYIADFNLLAHVFHETAYSLFDKKALSVGTVRLTEREREC 199

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           L+ + +G++++EI+  +G SV TV  +L +A  KL A NR QA+ +A  +  +
Sbjct: 200 LRHSAEGFSAKEISRIIGRSVPTVVMHLNAAAKKLGARNRTQAVVRATHYRLL 252


>gi|326326038|ref|YP_004250847.1| putative transcriptional activator protein solR-LuxR [Vibrio
           nigripulchritudo]
 gi|323669089|emb|CBJ93133.1| Putative transcriptional activator protein solR-LuxR [Vibrio
           nigripulchritudo]
          Length = 232

 Score =  126 bits (316), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 42/231 (18%), Positives = 80/231 (34%), Gaps = 15/231 (6%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           ++++ ++  +LH + N ++  NFA       ++       I  ++ Y     DI      
Sbjct: 11  ANTVSDVKCQLHKLANLLEFDNFAF---GIKVNNLTGIPTIDMINTYSDQWNDIYKKNNF 67

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
              D  +   ++   PIIW+                 +        G + P       + 
Sbjct: 68  ISKDPIVLEGSATSNPIIWEESL------KPTHEIFEIANDFNLNIGWSKPSHKPNGVSS 121

Query: 131 YVIFTSEFLMLANEVII----EAHGACYQVITDFLELFKKRS--SAARNLTERETSCLQL 184
              F+     L    +                 F  +       S    LT RE   L+ 
Sbjct: 122 LFSFSRSSESLTEAELWKQTPYLLWVANIAEQAFERVNSGYHGYSLVEVLTPREIEILKW 181

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYIC 235
           + +G T+ E +  L +S  TV  ++ +A  KL+  N+  A+ KA+  G +C
Sbjct: 182 SAEGKTASETSMILSISERTVTFHITNAVKKLNTCNKTSAVIKAVTLGLVC 232


>gi|37223233|gb|AAQ90216.1| LuxR [Aliivibrio fischeri]
          Length = 232

 Score =  126 bits (316), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 42/216 (19%), Positives = 81/216 (37%), Gaps = 11/216 (5%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
            S  +++  L  +   +   +   Y +         +  I  L NY        +     
Sbjct: 22  RSNNDINQCLSDMTKMV---HCEYYLLAIIYPHSMVKSDISILDNYPKKWRQYYDDANLI 78

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  + + NS   PI W  I E   +       ++         G +FP+    +  G 
Sbjct: 79  KYDPIVDYSNSNHSPINWN-IFENNAVNKKSPNVIKEAKSSGLITGFSFPIHTANNGFGM 137

Query: 132 VIFTSEFLMLANEVIIEAH------GACYQVITDFLELFKKRSSAARNLTERETSCLQLA 185
           + F         + +   H           ++ ++ ++    + +  +LT+RE  CL  A
Sbjct: 138 LSFAHSEKDNYIDSLF-LHACMNIPLIVPSLVDNYRKINIANNKSNNDLTKREKECLAWA 196

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNR 221
            +G +S +I++ LG S  TV  +L +A +KL+  NR
Sbjct: 197 CEGKSSWDISKILGCSKRTVTFHLTNAQMKLNTTNR 232


>gi|153825393|ref|ZP_01978060.1| transcriptional regulator, LuxR family [Vibrio cholerae MZO-2]
 gi|255746365|ref|ZP_05420312.1| transcriptional regulator LuxR family [Vibrio cholera CIRS 101]
 gi|262158280|ref|ZP_06029397.1| transcriptional regulator LuxR family [Vibrio cholerae INDRE 91/1]
 gi|262169155|ref|ZP_06036848.1| transcriptional regulator LuxR family [Vibrio cholerae RC27]
 gi|262192074|ref|ZP_06050237.1| transcriptional regulator LuxR family [Vibrio cholerae CT 5369-93]
 gi|149740939|gb|EDM55016.1| transcriptional regulator, LuxR family [Vibrio cholerae MZO-2]
 gi|255736119|gb|EET91517.1| transcriptional regulator LuxR family [Vibrio cholera CIRS 101]
 gi|262022436|gb|EEY41144.1| transcriptional regulator LuxR family [Vibrio cholerae RC27]
 gi|262029962|gb|EEY48609.1| transcriptional regulator LuxR family [Vibrio cholerae INDRE 91/1]
 gi|262032056|gb|EEY50631.1| transcriptional regulator LuxR family [Vibrio cholerae CT 5369-93]
 gi|327485870|gb|AEA80276.1| transcriptional regulator, LuxR family [Vibrio cholerae LMA3894-4]
          Length = 239

 Score =  126 bits (316), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 72/227 (31%), Gaps = 7/227 (3%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
             ++S S   +   +    +         ++ +S LD    +++     ++  D G+  +
Sbjct: 12  QLEESHSFSTVQDIVRQRAHFYGYDKIVFFSAHSTLDGII-ERIYWIEGDWFDD-GENID 69

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                       H      P  W    +   +       V    G     G+  P+    
Sbjct: 70  AATYIKYCPITRHIIETDRPFFWTKKPD---VNREQYRVVAKPKGSGI-HGLQIPIFGHL 125

Query: 127 HKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSS-AARNLTERETSCLQLA 185
              G V    + +  +     E              L +      +  L++RE   L L 
Sbjct: 126 GLEGAVSLGGKAIDSSPRARCELSLLSTYAFFAARRLLESSDPNRSALLSKREKEVLSLT 185

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFG 232
             G    +IA  LG+S  T+  +L +A +KL      + I  AI+ G
Sbjct: 186 ALGRRQADIAIALGVSPRTIENHLRNARLKLGGATTAETIRIAIQRG 232


>gi|189218591|ref|YP_001939232.1| LuxR family transcriptional regulator [Methylacidiphilum infernorum
           V4]
 gi|189185449|gb|ACD82634.1| Transcriptional regulator LuxR family [Methylacidiphilum infernorum
           V4]
          Length = 251

 Score =  125 bits (315), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 80/226 (35%), Gaps = 7/226 (3%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           E    L  IQ  I +   A   +        ++ L    H++  D             D 
Sbjct: 24  EFKTVLKKIQELIPSSLIACGLVKINSLNEVKKMLKIINHSFPSDLIAFYLQQKYQKADP 83

Query: 76  FLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFP-VRLGFHKNGYVIF 134
            +         I+ ++       ++     ++    +    G++F  V    ++     F
Sbjct: 84  VVKTALRLRGNIVRRTEIFRYFQDNFRSQYLKDASDISLHTGLSFGIVEEKTYRASLFSF 143

Query: 135 TSEFLMLANEVIIEAHGACYQVITDFL------ELFKKRSSAARNLTERETSCLQLAGDG 188
             + +  +       +G  Y +    L      E+ K    + + LT RE   L+   DG
Sbjct: 144 CDKEIEKSPRHETILNGLKYPLHLALLNCSHPQEVEKPAKESPQALTARELEILKWIMDG 203

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            T+ EI+  L +S  TV  +L +  +KLD  NR QA+A A     +
Sbjct: 204 KTNWEISCILKISEATVKFHLKNIFLKLDVQNRCQAVATAFHRRLL 249


>gi|190892657|ref|YP_001979199.1| autoinducer transcriptional regulator protein [Rhizobium etli CIAT
           652]
 gi|190697936|gb|ACE92021.1| autoinducer transcriptional regulator protein [Rhizobium etli CIAT
           652]
          Length = 260

 Score =  125 bits (315), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 30/231 (12%), Positives = 66/231 (28%), Gaps = 11/231 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++  +   +   + ++Q          +   +                Y         + 
Sbjct: 34  EQIKAAPNVDAAIRILQAEYGLDFVTYHLAQTIASKIDSP---FVRTTYPDAWVSRYLLN 90

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +       LP  W  ++       +  + V  +   +   G + PV     +
Sbjct: 91  SYVKVDPIVKQGFERQLPFDWSEVE---PTPEAYAMLVDAQKHGIGGNGYSIPVADKAQR 147

Query: 129 NGYVIFTSEFLMLANEVIIEAHG-----ACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
              +   +         ++           + +    +            L+ RE  CL 
Sbjct: 148 RALLSMNARIPADGWSELVRRCRNEWIEIAHLIHQKAVYELYGEHDPVPALSPREIECLH 207

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G   ++I+  LG+S HT   YL +A  KL       A ++A++   I
Sbjct: 208 WTALGKDYKDISVILGISEHTTRDYLKTARFKLGCATISAAASRAVQLRII 258


>gi|149907939|ref|ZP_01896607.1| transcriptional regulator, LuxR family [Moritella sp. PE36]
 gi|149808945|gb|EDM68876.1| transcriptional regulator, LuxR family [Moritella sp. PE36]
          Length = 244

 Score =  125 bits (314), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 43/228 (18%), Positives = 86/228 (37%), Gaps = 7/228 (3%)

Query: 10  KSSSLQE-LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           +++S  + +S  L      I  +  A   I++ ++F    +      N   +  +I    
Sbjct: 19  RANSNSDSISDILTKTNELIPFQ-AATIAIDTNIEFALTAKQQIFTQNLSEEWQEIYFQR 77

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  L    +    + W++   +    S      ++    +   G++  V+     
Sbjct: 78  KFFNQDPILSAIANTTSAVDWRTATSQANYISDD--FKQMSKKYVGSDGLSILVKT-DVG 134

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFK--KRSSAARNLTERETSCLQLAG 186
           +  +        L  E           +   F    +  ++S    NL++RE   L  A 
Sbjct: 135 STLISLVIPESSLDAEHNQLIEYIAPHIHEVFNRQGENIRKSLWKPNLSKRELEVLNWAK 194

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +G ++ + +  L +S  TV  +  +   KL+ VNR QAIA+AI FG +
Sbjct: 195 EGKSNWDTSLILAISERTVKFHFSNIFKKLEVVNRSQAIARAIHFGLV 242


>gi|209550247|ref|YP_002282164.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536003|gb|ACI55938.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 241

 Score =  125 bits (314), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 30/231 (12%), Positives = 68/231 (29%), Gaps = 11/231 (4%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
           ++  +   +   + ++Q          +   +                Y         + 
Sbjct: 15  EQIKAAANVDAAIRILQAEYGLGFVTYHLAQTIASKIDSP---FVRTTYPDAWVSRYLLN 71

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
                D  +       LP  W  ++       +  + V  +   +   G + PV     +
Sbjct: 72  SYVKVDPIVKQGFERQLPFDWSEVE---PTPEAYAMLVDAQKHGIGGNGYSIPVADKAQR 128

Query: 129 NGYVIFTSEFLMLANEVIIEAHG-----ACYQVITDFLELFKKRSSAARNLTERETSCLQ 183
              +   +   +     ++           + +    +      +     L+ RE  CL 
Sbjct: 129 RALLSVNARIPVEEWTELVRRCRNEWIEIAHLIHRKAVYELHGENDPVPALSPREIECLH 188

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
               G   ++I+  LG+S HT   YL +A  KL       A ++A++   I
Sbjct: 189 WTALGKDYKDISVILGISEHTTRDYLKTARFKLGCATISAAASRAVQLRII 239


>gi|290454885|emb|CBI67623.1| sR protein [Pseudomonas fuscovaginae]
          Length = 237

 Score =  125 bits (314), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 36/208 (17%), Positives = 59/208 (28%), Gaps = 11/208 (5%)

Query: 33  FALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSI 92
           F  Y++      P          NY                D  + H  +   P+ W + 
Sbjct: 34  FEQYSLGLRFPLPISSPKFHLSSNYSPAWESAYIDNNYFSIDQTVKHGLTEHRPLCWSAD 93

Query: 93  QEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLAN----EVIIE 148
                  +                G   P R      G +        + +    E   +
Sbjct: 94  -----AFTEHLHFWEDAKYYQLVHGWCTPSRAKHDTMGMLSLVRSASPITSLEFNEKETK 148

Query: 149 AHGACYQVITDFLELFKK--RSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVN 206
                +   +  L           A  LT RE   L+ +  G T  E    L +   TV 
Sbjct: 149 LLWISHIAHSTMLNFIAPNYIPEIAATLTVREVETLKWSATGKTYTETGLILSIDERTVK 208

Query: 207 AYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +L +A  KL + N+++A  KA   G +
Sbjct: 209 FHLVNAMRKLHSSNKVEAAMKAYALGML 236


>gi|2495418|sp|Q46751|CARR_PECCC RecName: Full=Transcriptional activator protein CarR
 gi|765139|gb|AAC45995.1| CarR [Pectobacterium carotovorum]
          Length = 244

 Score =  125 bits (314), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 32/232 (13%), Positives = 71/232 (30%), Gaps = 21/232 (9%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           E+   +      +    F+ + ++              + NY                D 
Sbjct: 4   EIHSFIKRKLKGVGDVWFSYFMMSK-----NSTSQPYIISNYPEAWMKEYIKKEMFLSDP 58

Query: 76  FLFHFNSGLLPIIWQSIQ-EETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
            +    + + P  W          ++       +       +G  F +    +    +  
Sbjct: 59  IIVASLARITPFSWDDNDIVTLRAKNQDVFISSV--QHDISSGYTFVLHDHDNNVATLSI 116

Query: 135 TSEFLMLAN---------EVIIEAHGACYQVITDFLELFKKRSSAARN----LTERETSC 181
            +                ++ +       +V+     +  + +    +    L+ RET  
Sbjct: 117 ANHLEDANFEKCMKNHENDLQMLLVNVHEKVMAYQRAINDQDNPPDNSRNALLSPRETEV 176

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGY 233
           L L   G T +E++  LG+S  TV  ++ ++  KLD +N   AI KA+    
Sbjct: 177 LFLVSSGRTYKEVSRILGISEVTVKFHINNSVRKLDVINSRHAITKALELNL 228


>gi|254462681|ref|ZP_05076097.1| autoinducer-binding transcriptional regulator LuxR [Rhodobacterales
           bacterium HTCC2083]
 gi|206679270|gb|EDZ43757.1| autoinducer-binding transcriptional regulator LuxR
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 244

 Score =  125 bits (314), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 42/220 (19%), Positives = 79/220 (35%), Gaps = 15/220 (6%)

Query: 21  LHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHF 80
           L+ +   ++        +N+  D       +     YD    +          D  L   
Sbjct: 31  LNDLCENLELDYATYCAVNTVSDQ------VIGFTTYDDAWKEHYTSQRFQNIDPTLHLP 84

Query: 81  NSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLM 140
              + PI WQ ++E        ++        +   G++ P+   + + G +  T +  +
Sbjct: 85  MRSIAPIDWQRLREHR---DFDRVFEHARDFKIKDQGLSVPIHGPYGEVGLISVTRDCSL 141

Query: 141 LANEVII-----EAHGACYQVITDFLELFK-KRSSAARNLTERETSCLQLAGDGYTSEEI 194
              E +      E   A   +    ++      +     L+ RE   LQ    G +  +I
Sbjct: 142 GTWEKLRKNVITELQTAAVSLHDTVMQSDTLGYALRRPQLSSRECEVLQWTAAGKSQIDI 201

Query: 195 AEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              L +S  TV  +L SA  KL A++  QA+ +AI  G+I
Sbjct: 202 GVILTISSRTVEVHLRSARSKLSALSTPQAVGRAIGMGFI 241


>gi|307292969|ref|ZP_07572815.1| Autoinducer-binding domain protein [Sphingobium chlorophenolicum
           L-1]
 gi|306881035|gb|EFN12251.1| Autoinducer-binding domain protein [Sphingobium chlorophenolicum
           L-1]
          Length = 263

 Score =  124 bits (313), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 35/200 (17%), Positives = 59/200 (29%), Gaps = 2/200 (1%)

Query: 32  NFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQS 91
            F    +      PR  +    + NY  +             D           P  W  
Sbjct: 35  GFPYVAMIQHGGLPRLVERALVITNYPAEFVRFYTESHAYVIDPVYEVSQLLDRPFSWDE 94

Query: 92  IQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFL-MLANEVIIEAH 150
           I     +  +               G+  P+ +    +    F      M +  ++   H
Sbjct: 95  IPGYVDLTGTQSALFEEARLHGLVHGVTVPLHIPSESHASCTFARAEPIMASPSLLTTLH 154

Query: 151 GACYQVITDFLELFKK-RSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYL 209
                     L L    R      LT RE  C  L   G +  EI++ LGLS  +V  ++
Sbjct: 155 IVAAFGFKAGLRLHHASRGHDVPRLTRREAQCTALVAVGKSDWEISQILGLSETSVRYFV 214

Query: 210 GSATVKLDAVNRIQAIAKAI 229
             A  +     R + +A+A+
Sbjct: 215 SHAKQRYGVYKRSELVARAL 234


>gi|260430562|ref|ZP_05784535.1| regulatory protein, LuxR [Citreicella sp. SE45]
 gi|260418591|gb|EEX11848.1| regulatory protein, LuxR [Citreicella sp. SE45]
          Length = 253

 Score =  124 bits (312), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 42/250 (16%), Positives = 79/250 (31%), Gaps = 24/250 (9%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARN--FALYTINSALDFPRRQQLICELHNYD 58
           +SE +  G++   +     ++      +      +    + S          + E  N  
Sbjct: 12  LSEGSHLGQR---VDAAFRQMQG----VGFDGMIYDYTPMVSGPGADVPIPSVFEQRNLG 64

Query: 59  LDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQE-----ETVIESSGQLSVRLEGGLL 113
            +     +       D           P  W    +       ++    +  +       
Sbjct: 65  DEMRQHWSEDEYIRLDPVQRVAMRSAAPFCWSYDSDIDSIIRPMLTPDIEPVMSYLRERE 124

Query: 114 PFAGIAFPVRLGFHKNGYVI---------FTSEFLMLANEVIIEAHGACYQVITDFLELF 164
            F+G+  P+ L       V          ++        ++ + AH      + + L   
Sbjct: 125 VFSGVTVPIHLPNGDFATVTGVSLGRRQNWSGGTSRAIADLSLIAHLFNQSAV-ELLGFD 183

Query: 165 KKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQA 224
            +  +    LT RE  CL  A  G +++E A  +  SV TV  +L +A  KL A NR  A
Sbjct: 184 HEDGTQEVRLTPRERECLTYASFGNSAKETARIIDRSVPTVVMHLNAAMRKLGARNRTHA 243

Query: 225 IAKAIRFGYI 234
           +  A R   I
Sbjct: 244 VTIATRRRLI 253


>gi|218672647|ref|ZP_03522316.1| transcriptional regulator, LuxR family protein [Rhizobium etli
           GR56]
          Length = 265

 Score =  124 bits (312), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 47/228 (20%), Positives = 77/228 (33%), Gaps = 13/228 (5%)

Query: 20  RLHLIQNR-IKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLF 78
               ++    +A  +    +   LD       + +L N   D  D          D    
Sbjct: 32  AFEAMKRLGFEALIYDYTPVPYDLDGAIMIPSLLKLRNIADDMHDYWFGRGYFRIDPVQQ 91

Query: 79  HFNSGLLPIIWQSIQEETVIESS-----GQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
                  P  W        + +           R         G+  PV +       V 
Sbjct: 92  VALRSSAPFFWNYDTNADTLINRFMSDDTAPVTRYLRERDMSTGVTVPVHMPGGDYATVT 151

Query: 134 FTSEFLMLANEV-----IIEAHGACYQVITDFLELFKK--RSSAARNLTERETSCLQLAG 186
                     E      I + +   +        LF +  RS    +LTERE  CL+ + 
Sbjct: 152 GIRFGEDSDFERHALRYIADFNLLAHVFHETAYSLFDRKARSVGTIHLTERERECLRHSA 211

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +GY+++EI+  +G SV TV  +L +A  KL A NR QA+ +A  +  +
Sbjct: 212 EGYSAKEISRIIGRSVPTVVMHLNAAAKKLGARNRTQAVVRATHYRLL 259


>gi|150397799|ref|YP_001328266.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
 gi|150029314|gb|ABR61431.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
          Length = 247

 Score =  124 bits (312), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 57/230 (24%), Positives = 95/230 (41%), Gaps = 2/230 (0%)

Query: 5   TLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDI 64
            +      +  EL   +  + +R    +F +  +  A +    ++L+  L N+  +    
Sbjct: 20  EIDPASVRTEYELLHLMRRLISRYGFAHFMIARLPMADEQRFSERLM--LSNWPAELVQQ 77

Query: 65  PNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
            +          +       LPI       E   + +G+    L       A  A  +  
Sbjct: 78  YDASETFQASLLIERLRQTKLPIAGGPELMEPARKGAGKAPAILLPPHADMAHFAVLLHT 137

Query: 125 GFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQL 184
            + +   V+ + +    A       + A  Q+       F   S A   L+ RE  CL+ 
Sbjct: 138 TYGEPFVVVLSGKRDEPAGGERATLYLALVQLFECLERTFDAGSGAREKLSSREIECLRW 197

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           A  G +S+EIA  LG+S +TV++Y  SAT KLDAVNR+QAIA+A+R   I
Sbjct: 198 AAAGKSSDEIAIILGISAYTVSSYFKSATRKLDAVNRMQAIARAMRMKLI 247


>gi|312959686|ref|ZP_07774203.1| transcriptional regulator, LuxR family, autoinducer-regulated
           [Pseudomonas fluorescens WH6]
 gi|311286403|gb|EFQ64967.1| transcriptional regulator, LuxR family, autoinducer-regulated
           [Pseudomonas fluorescens WH6]
          Length = 254

 Score =  124 bits (312), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 49/237 (20%), Positives = 87/237 (36%), Gaps = 14/237 (5%)

Query: 12  SSLQELSPRLHLIQNRIKARN--FALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
            SL E      L+  ++      +    + +  D       + EL N   D   +     
Sbjct: 16  RSLDEQMDNTFLLAQQLGFDALVYDYTPVPTDQDGALITPSVLELRNTPPDWHALWCGKG 75

Query: 70  ETYGDDFLFHFNSGLLPIIWQ-----SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
               D       S + P +W          + +I+                 G++ P+ L
Sbjct: 76  FYQIDPVQHLALSTVSPFVWSYEAKTDTPLQKIIDPCHAPVSSYLHDQQLTCGVSVPIHL 135

Query: 125 GFHKNGYVI-----FTSEFLMLANEVIIEAHGACYQVITDFLELF--KKRSSAARNLTER 177
                  +        S  L  A + + E     + +      LF  + R+    +LT+R
Sbjct: 136 PRGGFASLTGLRTGKASSVLQDAQQTLSEFSVISHALQEAAYPLFSKELRTYPYIHLTKR 195

Query: 178 ETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           E  CL+ A +G T+ +IA +L  S+  V+ +L SA  KL A NR+QA+ +A  +  +
Sbjct: 196 ERECLKWAAEGLTAAQIATQLSRSLAVVSLHLASAMHKLGAKNRVQAVVRATHYRLL 252


>gi|2873371|gb|AAC38168.1| CarR [Serratia marcescens]
          Length = 244

 Score =  124 bits (312), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 38/230 (16%), Positives = 75/230 (32%), Gaps = 23/230 (10%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDF 76
           +  +L    N +    FA + ++ +            + NY     D          D  
Sbjct: 9   IERKLKAYGNVL----FAYFMMDKS-----SLSNPVFISNYPQKCIDTYIDNKLFINDPV 59

Query: 77  LFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTS 136
           + +    + P  W       +   +  +++ L        G  F +    +    +   +
Sbjct: 60  IHYSLKRVTPFSWDDNDLAVLRSENEDVAMYLR-EHDITVGYTFVLHDHDNNLAILTIAN 118

Query: 137 EFLMLANEVII-----EAHGACYQVITDFL---ELFKKRSSAARNL-----TERETSCLQ 183
                  E  I     +            +      K +++    L     T RET  L 
Sbjct: 119 NDEKNDFEDFIKNRENDLQMLLVTTHEKAMKHKHFVKGKTAPLDCLQSALITPRETEVLF 178

Query: 184 LAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGY 233
           L   G T +E++  LG+S  TV  ++ ++  KL+ +N   AI+KA+    
Sbjct: 179 LVSRGNTYKEVSRTLGISEATVKFHINNSVRKLNVINSRHAISKALELNL 228


>gi|170694163|ref|ZP_02885318.1| transcriptional regulator, LuxR family [Burkholderia graminis
           C4D1M]
 gi|170140903|gb|EDT09076.1| transcriptional regulator, LuxR family [Burkholderia graminis
           C4D1M]
          Length = 262

 Score =  124 bits (312), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 42/225 (18%), Positives = 65/225 (28%), Gaps = 9/225 (4%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELH----NYDLDSGDIPNILIET 71
           +++  +    +      F  Y I+              L      Y  D           
Sbjct: 39  DITSLVESFGHEAGKLGFPHYMISRVTRSRSTSTRRTALEMIGARYPQDWVRYYQRRDYA 98

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D           P  W  I     +  + +  +   G     AG++ PV         
Sbjct: 99  STDPVHRAAFLQSAPFRWHDI---IGLSKAERRLLDEAGEAGLRAGLSIPVHQSDGSILL 155

Query: 132 VIFTSEFLMLANEVIIEAHGA-CYQVITDFLELFKKRSSA-ARNLTERETSCLQLAGDGY 189
              +     + + +          Q   +   L    S   A  LT R+  CL     G 
Sbjct: 156 FNLSGPLRSVNDTINSRLAYLISVQFHYELHRLALIPSRRMAHLLTARQLECLTWVARGK 215

Query: 190 TSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           TS EI E LG S +TV  ++  A   L+  +R  A   A   G I
Sbjct: 216 TSAEIGEILGRSRYTVEFHIKEAMDALNIRSRTAAAVHATVQGII 260


>gi|90797252|gb|ABD97988.1| transcriptional activator AlpR [Azospirillum lipoferum]
          Length = 234

 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 33/223 (14%), Positives = 66/223 (29%), Gaps = 7/223 (3%)

Query: 12  SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIET 71
           +    L  R       +    +A   +    D  +         NY  +           
Sbjct: 16  TDEDALFRRFESAATELGYPFYAFGALWGDPDAIKLNPAPAVRLNYPAEWVAHYFSTGYN 75

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D  +         + W  ++                      +GIA P+R        
Sbjct: 76  KIDPVVLVAPYAQTSVTWDELRSYRP------EFFDDAATFGLRSGIAIPLRAIQGCYVL 129

Query: 132 VIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTS 191
            + + +   +  +         + +   +  L +   +    LT      ++L+  G ++
Sbjct: 130 CVASGDDRPIRPKERARLELFAHGLFAAYQRLRE-LPAQDHGLTANTVQVIRLSMAGLST 188

Query: 192 EEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            EI  +L L++  V+  L  A  KL   N  Q   KAI+ G +
Sbjct: 189 AEICSRLKLTMDGVHWCLKDARKKLKCANTAQVYLKAIQQGIV 231


>gi|78222725|ref|YP_384472.1| LuxR family transcriptional regulator [Geobacter metallireducens
           GS-15]
 gi|78193980|gb|ABB31747.1| transcriptional regulator, LuxR family [Geobacter metallireducens
           GS-15]
          Length = 246

 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 37/237 (15%), Positives = 75/237 (31%), Gaps = 13/237 (5%)

Query: 4   NTLTGKKS-SSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSG 62
             +   +S + ++ L    H + + +     A+                    +Y  +  
Sbjct: 14  ELIDASRSCADMERLKRLFHSLNDLLSFD-MAVCGTARFDGAGTMNAQQIINISYPEEWL 72

Query: 63  DIPNILIETYGDDFLFH--FNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAF 120
            +         D  +     +    P  W     +       Q  + L        G +F
Sbjct: 73  SLYAEHDFAAVDPVVRAHIADFSAKP--WSEAYLKWG---RPQPFLSLAEDFGIRKGYSF 127

Query: 121 PV---RLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTER 177
            V            +  + ++ +   +++       ++ +   ++     S+    LT R
Sbjct: 128 GVLSSNDRTASIFSLCVSEKYPVHTPQILDILAPYFHEALRRTVQTDL-PSACLATLTPR 186

Query: 178 ETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           E   +    +G    EI+  LG+S  TV  +  +   KL A NR  A+A AI  G I
Sbjct: 187 EIEVISWLANGKNYWEISVILGISERTVKFHTSTIVQKLGAANRSHAVAIAISTGLI 243


>gi|253987738|ref|YP_003039094.1| transcription regulator SdiA [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|211638616|emb|CAR67235.1| similar to probable transcription regulator sdia of escherichia
           coli [Photorhabdus asymbiotica subsp. asymbiotica ATCC
           43949]
 gi|253779188|emb|CAQ82348.1| similar to probable transcription regulator SdiA of Escherichia
           coli [Photorhabdus asymbiotica]
          Length = 242

 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 50/234 (21%), Positives = 87/234 (37%), Gaps = 27/234 (11%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           + E+   ++ I        F+L+++     FP   + +   +NY     ++         
Sbjct: 23  VSEVFEIINKI------SGFSLFSLILKARFPISNREVYFFNNYHESWRNLYIERKYWMI 76

Query: 74  DDFLFHFNSGLLPI------IWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
           D  L        P+      IW         ES+GQ    +       +GI F +     
Sbjct: 77  DPTL-----NFRPVPPSFSKIWDLDFFS---ESNGQELWYVSQKHGFRSGITFGLPAFSG 128

Query: 128 KNGYVIFTSEFLMLANE-------VIIEAHGACYQVITDFLELFKKRSSAARNLTERETS 180
             G      +   + NE        I+  +    + +T   +  +       + + RE  
Sbjct: 129 TYGIFSVAGKDGHIDNETMYKCSGEILGVYIRIIRYLTSHTKYLQFFYVDETSFSNRELE 188

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            L+   DG TS EIA  + ++  TV+ +L +   KL   N+ QAIAKA+  GYI
Sbjct: 189 VLRYTADGMTSSEIALTICVTKSTVDFHLMNIVKKLGCRNKFQAIAKAVLLGYI 242


>gi|188533099|ref|YP_001906896.1| Transcriptional activator protein [Erwinia tasmaniensis Et1/99]
 gi|188028141|emb|CAO95998.1| Transcriptional activator protein [Erwinia tasmaniensis Et1/99]
          Length = 240

 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 44/232 (18%), Positives = 68/232 (29%), Gaps = 20/232 (8%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDF 76
           +S +L    + +    +A   ++      +    I  + NY  +           Y D  
Sbjct: 11  ISKQLEAALSDLGEFIWAYVVLSK-----KDMSCIFGVTNYPGEWVKQYREKGLQYTDPV 65

Query: 77  LFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT- 135
           +    + L P  W             +L  R         G  F +    +    + FT 
Sbjct: 66  VITSLNRLTPFAWDENLLAGSGFRFSKLFDRAR-EFGVTNGYTFVLHDYNNNLVTLSFTF 124

Query: 136 SEFLMLANEVII-----EAHGACYQVITDFLEL--------FKKRSSAARNLTERETSCL 182
           +                E       V   +L L         + RS  A   TERE   L
Sbjct: 125 TPECRAEATETFIKNKGEISLLLASVHETYLTLTSLSEKNASRSRSENASRFTERENEIL 184

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             A  G T  E A  LG+   TV  ++ +   KL   N   AI   +    I
Sbjct: 185 YWASVGKTYPETAMILGIKTCTVKFHMSNIVKKLGVANARHAIRLGMELQLI 236


>gi|229589152|ref|YP_002871271.1| putative LuxR family regulatory protein [Pseudomonas fluorescens
           SBW25]
 gi|229361018|emb|CAY47880.1| putative LuxR-family regulatory protein [Pseudomonas fluorescens
           SBW25]
          Length = 254

 Score =  123 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 84/237 (35%), Gaps = 14/237 (5%)

Query: 12  SSLQELSPRLHLIQNRIKARN--FALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
            SL E      ++  ++      +    +    D       + EL N   D   +     
Sbjct: 16  RSLDEQMDNTFILAQQLGFDALVYDYTPVPIDQDGALITPSVLELRNTPPDWHALWCSKG 75

Query: 70  ETYGDDFLFHFNSGLLPIIWQ-----SIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRL 124
               D       S + P +W          + +I+                 G++ P+ L
Sbjct: 76  FYQIDPVQHLALSTVSPFVWSYDVKVDTPLQKIIDPCHAPVSTYLHDQQLTCGVSVPIHL 135

Query: 125 GFHKNGYVI-----FTSEFLMLANEVIIEAHGACYQVITDFLELF--KKRSSAARNLTER 177
                  +           L  A + + +     + +      LF  + R+    +LT+R
Sbjct: 136 PRGGFASLTGLRTGKAHSVLQDAQQTLSDFSLISHALQEAAYPLFSKELRTYPHIHLTKR 195

Query: 178 ETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           E  CL+ A DG T+ EIA +L  S+  V  +L SA  KL A NR+QA+ +A  +  +
Sbjct: 196 ERECLKWAADGLTAAEIATQLSRSLAVVTLHLASAMHKLGAKNRVQAVVRATHYRLL 252


>gi|227112193|ref|ZP_03825849.1| quorum-sensing transcriptional activator [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 244

 Score =  123 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 32/232 (13%), Positives = 71/232 (30%), Gaps = 21/232 (9%)

Query: 16  ELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDD 75
           E+   +      +    F+ + ++              + NY                D 
Sbjct: 4   EIHSFIKRKLKGVGDVWFSYFMMSK-----NSTSQPYIISNYPEAWMKEYIKKEMFLSDP 58

Query: 76  FLFHFNSGLLPIIWQSIQE-ETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
            +    + + P  W          ++       +       +G  F +    +    +  
Sbjct: 59  IIVASLARITPFSWDDNDLVTLRAKNQDVFISSV--QHDISSGYTFVLHDHDNNVATLSI 116

Query: 135 TSEFLMLAN---------EVIIEAHGACYQVITDFLELFKKRSSAARN----LTERETSC 181
            +                ++ +       +V+     +  + +    +    L+ RET  
Sbjct: 117 ANHLEDANFEKCMKNHENDLQMLLVNVHEKVMAYQRAINVQDNPPDNSRNALLSPRETEV 176

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGY 233
           L L   G T +E++  LG+S  TV  ++ ++  KLD +N   AI KA+    
Sbjct: 177 LFLVSSGRTYKEVSRILGISEVTVKFHINNSVRKLDVINSRHAITKALELNL 228


>gi|222086655|ref|YP_002545189.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
 gi|221724103|gb|ACM27259.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
          Length = 243

 Score =  123 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 48/235 (20%), Positives = 78/235 (33%), Gaps = 6/235 (2%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLD 60
           +S    T   + +    +  L    +       A      + D       +    +    
Sbjct: 13  LSAELAT---ARTQTAFAQALERTSSAFGFSQVAFLNAPVSEDSMLTP--LVIEGSVQPQ 67

Query: 61  SGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIE-SSGQLSVRLEGGLLPFAGIA 119
                +          L      ++P  W  +++    +    +    L        GI 
Sbjct: 68  FLRDFDRQQLLRRCPMLQRVRDSVMPRAWHLLEKNISQDMELPRELHALLLSHNCPMGIV 127

Query: 120 FPVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERET 179
            P+     +     F      L    + E +    Q    +  + +   S    L+ RE 
Sbjct: 128 IPINSSDGQRLVFWFMGNRSSLGQSELNELNMIMLQAHDIYNCIKRNDGSVLHMLSAREL 187

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             ++    G TS EI + L LS HTVNAY+ +A  KLD VNR Q +AKAIR   I
Sbjct: 188 EVVRWTAQGKTSVEIGQILSLSDHTVNAYMMNAIKKLDCVNRTQLVAKAIRLKLI 242


>gi|251787751|ref|YP_003002472.1| LuxR family transcriptional regulator [Dickeya zeae Ech1591]
 gi|247536372|gb|ACT04993.1| transcriptional regulator, LuxR family [Dickeya zeae Ech1591]
          Length = 250

 Score =  123 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 39/232 (16%), Positives = 70/232 (30%), Gaps = 20/232 (8%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDF 76
           +   +           +A   +N           +  + NY  +  DI       + D  
Sbjct: 15  IQNFIDRKLKSYGDLKYAYLIMNKKKPTD-----VVIISNYPPEWVDIYRSNNYQHIDPV 69

Query: 77  LFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT- 135
           +    + + P  W      +      ++   L        G  F +    +    + F  
Sbjct: 70  ILTAINKISPFSWDDDLVISSKLKFSRIFN-LSKEYDIVNGYTFVLHDPGNNLATLSFMV 128

Query: 136 SEFLMLANEVIIE-----AHGACYQVITDFLELFKK--------RSSAARNLTERETSCL 182
            E      E II+                   L ++        +   A   ++RE   L
Sbjct: 129 EEHRSSELEEIIQNNRDKLQMLLISAHEKLTSLHREMSRNRHNSKPQEADIFSQRENEIL 188

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             A  G T +EIA  LG++  TV  ++G+   KL  +N   AI   +    I
Sbjct: 189 YWASMGKTYQEIALILGITTSTVKFHIGNVVKKLGVLNAKHAIRLGVEMNLI 240


>gi|260461786|ref|ZP_05810032.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
 gi|319785327|ref|YP_004144803.1| Autoinducer-binding domain protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|259032427|gb|EEW33692.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
 gi|317171215|gb|ADV14753.1| Autoinducer-binding domain protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 245

 Score =  123 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 38/205 (18%), Positives = 64/205 (31%), Gaps = 11/205 (5%)

Query: 29  KARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPII 88
              +FA  ++ S             + NY                D  +    +G  P  
Sbjct: 37  DLLSFAYLSLPSLPSG-----KPKLISNYPPRWAMQYLENQYEKLDPVILRARNGGRPFQ 91

Query: 89  WQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIE 148
           W S      +  + Q             G+  P+     +   V F ++        +IE
Sbjct: 92  WGSDLWGGKMSPAQQQLFDEAARFSIRCGLTIPIVDLRGRTAAVTFAADEPRPVFLRVIE 151

Query: 149 AHGACYQVITDFLELFKKRSSAARN------LTERETSCLQLAGDGYTSEEIAEKLGLSV 202
            +    Q++        +R            LT RE  CL+ A  G ++      LG+  
Sbjct: 152 RYEQALQLMATCFHRCVRRKLPGDRTVDGILLTSREYMCLRSAARGNSAWVTGRILGIKP 211

Query: 203 HTVNAYLGSATVKLDAVNRIQAIAK 227
            T+  +L +A  KL    + QAIA 
Sbjct: 212 RTIAFHLENAKKKLGVRTQNQAIAL 236


>gi|92109679|ref|YP_571965.1| LuxR family transcriptional regulator [Nitrobacter hamburgensis
           X14]
 gi|91802761|gb|ABE65133.1| transcriptional regulator, LuxR family [Nitrobacter hamburgensis
           X14]
          Length = 234

 Score =  123 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 33/223 (14%), Positives = 70/223 (31%), Gaps = 14/223 (6%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDF 76
           +   +           +A   +++               +Y ++  +I      T  D  
Sbjct: 21  IHNAIKNFTVASGFDRYAYIHVHAGDGVGFT--------DYPVEWQNIYLEKRYTVIDPV 72

Query: 77  LFHFNSGLLPIIWQSIQEETVIESSG-QLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFT 135
           +      +    W +        S   +            +G++ P+R  + +   +   
Sbjct: 73  VTTAKRTMKMFAWSAEDPTVWRGSREIKQFYSEATDFGIRSGVSVPIRTSYGRTAMITLA 132

Query: 136 SEFLM---LANEVIIEAHGAC-YQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTS 191
           S+         + +  A       +          +     +L+ +E + L  +  G + 
Sbjct: 133 SDRRQVELPPWDPMQAALALAYIHIHLSLASASSLKVGEV-SLSAQEATSLSWSSHGKSM 191

Query: 192 EEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             IA+ LG+   TV  YL +A  KL A N  QA+  A+    I
Sbjct: 192 NVIADLLGIKPRTVQFYLDNARDKLGASNLQQAVRIAMEKKLI 234


>gi|190014846|ref|YP_001967610.1| TraR [Agrobacterium tumefaciens]
 gi|71849649|gb|AAZ50597.1| TraR [Agrobacterium tumefaciens]
          Length = 234

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 43/222 (19%), Positives = 70/222 (31%), Gaps = 12/222 (5%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDF 76
           L   L  I        +A   I          + I  + NY  +             D  
Sbjct: 21  LKTGLADIAEHYGFTGYAYLHIQH--------RHITAVTNYHREWQSTYFDKKLVALDPV 72

Query: 77  LFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTS 136
           +    S      W   QE   +    +            +GI  P+R            S
Sbjct: 73  VKRARSRKHIFTWSGEQERPSLSRDERSFYARAADFGIRSGITIPIRTANGSMSMFTLAS 132

Query: 137 EFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARN----LTERETSCLQLAGDGYTSE 192
           +  ++  +  I+A  A   +      +   R++        L  +E S L+    G T E
Sbjct: 133 DKPVIDLDREIDAVAAASTIGQIHARISYLRTTPTAEDAAWLDPKEASYLRWIAVGMTME 192

Query: 193 EIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           EIA+  G+  ++V   L  A  + D  ++   IA AIR   I
Sbjct: 193 EIADVEGVKYNSVRVKLREAMKRFDVHSKAHMIALAIRRKLI 234


>gi|116250449|ref|YP_766287.1| GerE family transcriptional regulator [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115255097|emb|CAK06171.1| putative GerE family transcriptional regulator [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 234

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 53/226 (23%), Positives = 87/226 (38%), Gaps = 8/226 (3%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
            ++ +  +    L          NFAL  I+ A   P  ++ I   +  +   G     L
Sbjct: 16  SRAINRTDFFRLLKSAAQHYNFDNFALARISEA-SAPFGERDIVITNVAERRVGLFITTL 74

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
            E  G            P+  +S Q E        +      G+  F     P+     +
Sbjct: 75  KEALGTVRAKTAQFLATPVHGRSAQPEDYPSD--LVFNEFLSGVFLF----IPLFTPEGR 128

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDG 188
              ++   E        I +      ++     E        +  LT+RE+  ++   +G
Sbjct: 129 RYCLVLCGERQEPDQSEIADMLLDAMRIFDKLYE-EILTPEMSGRLTQRESEIVKWTSEG 187

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            TS EIA  LGLS HTVN+++ +A  KLDAVNR+  +A A+R G +
Sbjct: 188 KTSAEIAIILGLSEHTVNSHITAAARKLDAVNRVHMVAIALRNGLV 233


>gi|190573818|ref|YP_001971663.1| putative LuxR family transcriptional regulator [Stenotrophomonas
           maltophilia K279a]
 gi|190011740|emb|CAQ45360.1| putative LuxR family transcriptional regulatory protein
           [Stenotrophomonas maltophilia K279a]
          Length = 234

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 78/235 (33%), Gaps = 7/235 (2%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLD 60
           + +  L  +++ SL  +   L  I   +      ++   + L+    Q++     ++  D
Sbjct: 4   LVQALLEMERARSLSAVGAVLRGIAAPLGYDRVLVFATGTGLER-GTQRVYWIEGDWFGD 62

Query: 61  SGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAF 120
             D        +      H      P  W     + V     Q+  +  G  L   G+  
Sbjct: 63  GSDTDLA-GYLHACPVNRHVLDSDAPFFWSK--HQGVRGERYQIVKQPRGEGL--HGLQV 117

Query: 121 PVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSS-AARNLTERET 179
           PV       G +      +  +    ++   A          L +  +  +   L+ RE 
Sbjct: 118 PVFGTTGLEGAISVAGTSIDASASARLQLAAAATAAFRAARHLVESPAELSGSALSTRER 177

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L+    G    EIA  LGLS  TV  +L  A  +L      QA+  A R G I
Sbjct: 178 EVLRWVAAGRRQAEIAATLGLSTRTVENHLRHARQRLGVATTAQAVRAANRRGEI 232


>gi|218461489|ref|ZP_03501580.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli Kim 5]
          Length = 234

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 53/226 (23%), Positives = 87/226 (38%), Gaps = 8/226 (3%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
            ++ +  +    L          NFAL  I+ A   P  ++ +      +   G     L
Sbjct: 16  SRAINRTDFFRLLKAAAQHYHFDNFALARISEA-SAPFGERDVVITSVPERRVGLFIATL 74

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
            ET G            P+       E     S +L      G+  F     P+     +
Sbjct: 75  KETLGTVRAKSAQFLATPV--HGRSAEPDTYPSDRLFNEFRSGVFLF----IPLFTPEGR 128

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDG 188
              ++ + E        I +      ++     E        +  LT+RE+  ++   +G
Sbjct: 129 RYCLVLSGEREEPDQGEIADLLLDAMRIFDKLYE-EILTQEMSGRLTQRESEIVKWTSEG 187

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            TS EIA  LGLS HTVN+++ +A  KLDAVNR+  +A A+R G +
Sbjct: 188 KTSAEIAIILGLSEHTVNSHITAAARKLDAVNRVHMVAIALRNGLV 233


>gi|307315516|ref|ZP_07595067.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
 gi|306898770|gb|EFN29428.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
          Length = 234

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 39/228 (17%), Positives = 77/228 (33%), Gaps = 12/228 (5%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           + + +  +  L  +   +    +A   +     F         + NY  +  D       
Sbjct: 15  ARTREMFNGALTELARELGFEYYAYLNLQPVGTFA--------VSNYSPEWQDRYFSKSF 66

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
           +  D  +    S +    W S     V     +       G    +GI  PV   F +  
Sbjct: 67  SEIDPVVQIAKSTMRAFTWSSENTRKVKSRRVRQFYLDAAGFGIRSGITIPVATAFRRIA 126

Query: 131 YVIFTSEFLMLANEVIIEAHGACYQVITDFLELF----KKRSSAARNLTERETSCLQLAG 186
            +   S    L   + I+   A   V    + +     +  +  +  +T ++   L+ + 
Sbjct: 127 MLTIASHKPSLLLNLDIDPVAAATAVAQLHVRIEQAQIEPTAKPSIRMTAKQALMLKWSS 186

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +G +  EIA    ++   VN ++ +A  KL A  + QA A A +   I
Sbjct: 187 EGKSMSEIATIENMTYANVNFHMNNARRKLGASTQAQATALATKLRLI 234


>gi|86356279|ref|YP_468171.1| LuxR family transcriptional regulator [Rhizobium etli CFN 42]
 gi|86280381|gb|ABC89444.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli CFN 42]
          Length = 234

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 52/226 (23%), Positives = 87/226 (38%), Gaps = 8/226 (3%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
            ++ +  +    L          NFAL  I+ A   P  ++ I   +  +   G     L
Sbjct: 16  SRAINRTDFFRLLKAAAQHYHFDNFALARISEA-SAPFGERDIVITNVAERRVGLFIATL 74

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
            E  G            P+       ++    S  L      G+  F     P+     +
Sbjct: 75  REALGTTRAKSAQFLATPV--HGRSAQSDTYPSDLLFNEFRSGVFLF----IPLFTPEGR 128

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDG 188
              ++ + E        I +      ++     E        +  LT+RE+  ++   +G
Sbjct: 129 RYCLVLSGEREEPDQGEIADMLLDAMRIFDKLYE-EILTPEMSGRLTQRESEIVKWTSEG 187

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            TS EIA  LGLS HTVN+++ +A  KLDAVNR+  +A A+R G +
Sbjct: 188 KTSAEIAIILGLSEHTVNSHITAAARKLDAVNRVHMVAIALRNGLV 233


>gi|123441908|ref|YP_001005891.1| quorum-sensing transcriptional activator [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|122088869|emb|CAL11676.1| quorum-sensing transcriptional activator [Yersinia enterocolitica
           subsp. enterocolitica 8081]
          Length = 244

 Score =  122 bits (307), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 37/235 (15%), Positives = 66/235 (28%), Gaps = 21/235 (8%)

Query: 15  QELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGD 74
           +++   +           ++   +N              + NY LD             D
Sbjct: 13  EDIKNYIQRRIKAYGDLRYSYLVMNKKTPL-----HPTIISNYPLDWVKKYKKNSYHLID 67

Query: 75  DFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
             +      + P  W         +S+     +L        G  F +    +    +  
Sbjct: 68  PVILTAKDKVAPFAWDDNSV-INKKSTDSAVFKLAREYNIVNGYTFVLHDNSNNMATLNI 126

Query: 135 T-SEFLMLANEVIIEA-----HGACYQVITDFLEL-------FKKRSSAARN--LTERET 179
           +      ++ +  IE                 L L        + R+        + RE 
Sbjct: 127 SNGSDDSISFDESIEINKEKIQMLLILTHEKMLGLYQSNSDKNENRNPKIERDIFSPREN 186

Query: 180 SCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             L  A  G T  EI+  LG+   TV  ++G+   KL  +N   AI   I    I
Sbjct: 187 EILYWASVGKTYAEISIILGIKRSTVKFHIGNVVRKLGVLNAKHAIRLGIELKLI 241


>gi|117619760|ref|YP_858670.1| transcriptional activator protein AhyR/asaR [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|117561167|gb|ABK38115.1| transcriptional activator protein AhyR/asaR [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 203

 Score =  122 bits (307), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 49/228 (21%), Positives = 76/228 (33%), Gaps = 57/228 (25%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
           K+    ++  +L    +++    F  + +        ++  +   +N      D  +   
Sbjct: 15  KAKKTSDIQQQLERFSHQM---GFDYFRLLIIFPISMQKSHVALFNNCPTSWFDAYSERH 71

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
               D  +F       PI W  +                                    +
Sbjct: 72  YLTQDPVVFLGLKQTQPIFWNKLDC---------------------------------DS 98

Query: 130 GYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTE---RETSCLQLAG 186
            ++   S                   +    L+L K R    + LTE   RE  CL  A 
Sbjct: 99  PWLPSAS------------------YIFNSALQLIKSRPDLMKYLTELSDREKECLFWAS 140

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           +G TS EIA  LG+S  TVN +L   T K D+ NR QAIAK+I  G I
Sbjct: 141 EGKTSWEIATILGISERTVNFHLNQVTNKTDSKNRNQAIAKSISSGII 188


>gi|37524335|ref|NP_927679.1| hypothetical protein plu0320 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36783758|emb|CAE12615.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 242

 Score =  122 bits (307), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 51/234 (21%), Positives = 86/234 (36%), Gaps = 23/234 (9%)

Query: 16  ELSPRLHL-IQNRIK-ARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           ++ P     I   I     F+L+++     FP   + +   +NY     D+         
Sbjct: 17  DVDPHFVAEICELINKISGFSLFSLLLKARFPISNREVYFFNNYHESWRDLYIEKKYWMI 76

Query: 74  DDFLFHFNSGLLPI------IWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
           D  L        P+      IW         +S+GQ    +       +GI F +     
Sbjct: 77  DPVL-----NFRPVPPSFSKIWDLDFFS---KSNGQELWYVNQKYGFRSGITFGLPAFSG 128

Query: 128 KNGYVIFTSEFLMLANE-------VIIEAHGACYQVITDFLELFKKRSSAARNLTERETS 180
             G      +   + NE        I+  +    + +T   +  +       + + RE  
Sbjct: 129 TYGIFSVAGKDGPIDNETMYKCSGEILGVYIRIIRYLTSHTKYLQSFYIDETSFSNRELE 188

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            L+   DG TS EI+  + ++  TV+ +L +   KLD  N+ QAIAKA   GYI
Sbjct: 189 VLRYTADGMTSIEISSTICVTKSTVDFHLMNIVKKLDCKNKFQAIAKAALLGYI 242


>gi|163758741|ref|ZP_02165828.1| putative AHL-dependent transcriptional regulator [Hoeflea
           phototrophica DFL-43]
 gi|162284031|gb|EDQ34315.1| putative AHL-dependent transcriptional regulator [Hoeflea
           phototrophica DFL-43]
          Length = 239

 Score =  122 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 48/223 (21%), Positives = 78/223 (34%), Gaps = 11/223 (4%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDF 76
           +   +   +   +  +   +   + +              Y  +             D  
Sbjct: 21  VEEAVFAFRAEYQVAHATYHLAQTTISALDS---AYVRTTYSAEWVSRYLQRNYVDIDPV 77

Query: 77  LFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTS 136
           L       LP  W  ++    +     L        L  +G + P+     +   +   S
Sbjct: 78  LKEGVQRQLPFDWSELEMSAAVLP---LFEDALAHGLGPSGYSIPIIDKNFRRALLSINS 134

Query: 137 EFLMLANEVIIEAHGACYQ-----VITDFLELFKKRSSAARNLTERETSCLQLAGDGYTS 191
                A   ++  H A +      +    ++     +  A +L+ RE  CL LA  G   
Sbjct: 135 FETGEAWSDLVNRHKAAWAEAAFLIHDMAMKEIHGGNDQALHLSPREIECLTLAARGKDH 194

Query: 192 EEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           ++IA  LGLS HTV  YL SA  KL +VN  QAIA+AIR   I
Sbjct: 195 KDIALILGLSGHTVQGYLKSARHKLGSVNIPQAIAEAIRSRII 237


>gi|222066056|emb|CAX21483.1| ppoR luxR family protein [Pseudomonas putida]
          Length = 235

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 32/222 (14%), Positives = 68/222 (30%), Gaps = 10/222 (4%)

Query: 18  SPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFL 77
                +  +  +  +     +N  +    +   +    NY  +  +          D   
Sbjct: 19  QRLFDIAVHLAQNLDMVYLGLNVRIQIATQTPRLYLYSNYPKEWIERYQRDEFYKQDAAA 78

Query: 78  FHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSE 137
              +S  +P++W         +       +         G    +    H    +     
Sbjct: 79  NASHSSTMPVLWNDDLYREAPK-----FRQAACQYGLCHGWTQSLHDLQHNESQISVARP 133

Query: 138 FLMLANEVIIE----AHGACYQVITDFLELFKKRS-SAARNLTERETSCLQLAGDGYTSE 192
              +    + +        C+ +     E            +++RE   L+ +  G T+ 
Sbjct: 134 TGTIGITELYDKAGSVQWLCHTLHAVLGEYHLNALCPPQPKMSKRELEVLKWSAAGKTAA 193

Query: 193 EIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           ++A  L LS  TVN ++ S   K  A N+  A+A A   G+I
Sbjct: 194 DVACILSLSQSTVNFHIRSVITKTSAANKAGAVAIAALRGWI 235


>gi|209547895|ref|YP_002279812.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533651|gb|ACI53586.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 234

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 52/226 (23%), Positives = 88/226 (38%), Gaps = 8/226 (3%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
            ++ +  +    L          NFAL  I+     P  ++ I   +  +   G     L
Sbjct: 16  SRAINRTDFFRLLKSAAQHYNFDNFALARISET-SAPFGERDIVITNVAERRVGLFITTL 74

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
            E  G            P+  +S++ E     S  +      G+  F     P+     +
Sbjct: 75  KEALGTVRAKSAQFLATPVHGRSVRPEDY--RSDLVFNEFLSGVFLF----IPLFTPEGR 128

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDG 188
              ++ + E        I +      ++     E        +  LT+RE   ++   +G
Sbjct: 129 RYCLVLSGERQEPDQSEIADMLLDAMRIFDKLYE-EILTQEMSGRLTQREQEIVKWTSEG 187

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            TS EIA  LGLS HTVN+++ +A  KLDAVNR+  +A A+R G +
Sbjct: 188 KTSAEIAIILGLSEHTVNSHITAAARKLDAVNRVHMVAIALRNGLV 233


>gi|83593514|ref|YP_427266.1| LuxR family transcriptional regulator [Rhodospirillum rubrum ATCC
           11170]
 gi|83576428|gb|ABC22979.1| transcriptional regulator, LuxR family [Rhodospirillum rubrum ATCC
           11170]
          Length = 239

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 50/230 (21%), Positives = 78/230 (33%), Gaps = 14/230 (6%)

Query: 19  PRLHLIQNRIKARNFA-----LYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
             L     +  A  FA        +  A D       I E  N  +D  +I         
Sbjct: 10  AHLDAACRQAMALGFAAVLYDYSPVPRAHDGTLITPTILETRNLPVDMAEIWCKQGYYQI 69

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESS-----GQLSVRLEGGLLPFAGIAFPVRLGFHK 128
           D           P +W    +++ + +       +  +          G+  P+R G   
Sbjct: 70  DPVQDAALLVSAPFVWSHEGDQSDVMARVLRAEHRPVLDYLRHRGLTRGVTVPIRCGEGA 129

Query: 129 NGYVIFTSEFLML--ANEVIIEAHGACYQVITDFLELFKKRSS--AARNLTERETSCLQL 184
                  +         + +                 F   S      +LT RE  CL L
Sbjct: 130 LATFTAIAPSGAPFPPEDRLSSLGLLGQSFHDRVYPGFPAASHLCPVVHLTRRERECLAL 189

Query: 185 AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            G+G T++EIA ++  SV TV  +L +AT KL A NR QAIA+A  +  +
Sbjct: 190 CGEGLTAKEIAYRIDRSVPTVVFHLSAATRKLGARNRFQAIARAAYYRLL 239


>gi|294664209|ref|ZP_06729588.1| transcriptional regulator ahyR/asaR family [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
 gi|292606021|gb|EFF49293.1| transcriptional regulator ahyR/asaR family [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
          Length = 254

 Score =  122 bits (306), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 48/244 (19%), Positives = 78/244 (31%), Gaps = 17/244 (6%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNF-----ALYTINSALDFPRRQQLICELHNYDLDSG 62
           G+   +LQ L   L  +   + A  F         +  +L+       +    N   D  
Sbjct: 9   GRDLQALQTLDSCLDRVFRNVCALGFQSLVYDYAPVPLSLEGALITPTVFMQRNAPGDMQ 68

Query: 63  DIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIES-----SGQLSVRLEGGLLPFAG 117
            +         D           P +W    + +           +   R         G
Sbjct: 69  HVWCEHGYYQHDPVQQRATRRTTPFVWSYRTDGSCPGVEYVGGQHRQVTRYLCDSGMGTG 128

Query: 118 IAFPVRLGFHKNGYVIFTSEFLMLANEVIIEAHGA-------CYQVITDFLELFKKRSSA 170
           +  P+ L            +        + EA           +Q     L   ++R   
Sbjct: 129 VTVPLHLPGGAFATFSGAIDAAAAQAPRLAEAQLLPFLLLAHAFQARAQELLDPQERRCH 188

Query: 171 ARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIR 230
              LT RE  CLQ +  G TS+ IA  L  S  TVN +L SA  KL A NR++A+ + + 
Sbjct: 189 HIALTRRERECLQYSAKGLTSKRIAAALNRSTATVNLHLNSAARKLGARNRVEAVVRGMH 248

Query: 231 FGYI 234
           +  +
Sbjct: 249 YRLL 252


>gi|294625280|ref|ZP_06703918.1| transcriptional regulator ahyR/asaR family [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
 gi|292600401|gb|EFF44500.1| transcriptional regulator ahyR/asaR family [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
          Length = 254

 Score =  121 bits (305), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 48/244 (19%), Positives = 78/244 (31%), Gaps = 17/244 (6%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNF-----ALYTINSALDFPRRQQLICELHNYDLDSG 62
           G+   +LQ L   L  +   + A  F         +  +L+       +    N   D  
Sbjct: 9   GRDLQALQTLDSCLDRVFRDVCALGFQSLVYDYAPVPLSLEGALITPTVFMQRNAPGDMQ 68

Query: 63  DIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIES-----SGQLSVRLEGGLLPFAG 117
            +         D           P +W    + +           +   R         G
Sbjct: 69  HVWCEHGYYQHDPVQQRATRRTTPFVWSYRTDGSCPGVEYVGGQHRQVTRYLCDSGMGTG 128

Query: 118 IAFPVRLGFHKNGYVIFTSEFLMLANEVIIEAHGA-------CYQVITDFLELFKKRSSA 170
           +  P+ L            +        + EA           +Q     L   ++R   
Sbjct: 129 VTVPLHLPGGAFATFSGAIDAAAAQAPRLAEAQLLPFLLLAHAFQARAQELLDPQERRCH 188

Query: 171 ARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIR 230
              LT RE  CLQ +  G TS+ IA  L  S  TVN +L SA  KL A NR++A+ + + 
Sbjct: 189 HIALTRRERECLQYSAKGLTSKRIAAALNRSTATVNLHLNSAARKLGARNRVEAVVRGMH 248

Query: 231 FGYI 234
           +  +
Sbjct: 249 YRLL 252


>gi|4883696|gb|AAD31608.1|AF065246_2 conjugal transfer regulatory protein [Agrobacterium tumefaciens]
          Length = 234

 Score =  121 bits (305), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 43/222 (19%), Positives = 70/222 (31%), Gaps = 12/222 (5%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDF 76
           L   L  I        +A   I          + I  + NY  +             D  
Sbjct: 21  LKTGLADIAEHFVFTGYAYLHIQH--------RHITAVTNYHREWQSTYFDKKLVALDPV 72

Query: 77  LFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTS 136
           +    S      W   QE   +    +            +GI  P+R            S
Sbjct: 73  VKRARSRKHIFTWSGEQERPSLSRDERSFYARAADFGIRSGITIPIRTANGSMSMFTLAS 132

Query: 137 EFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARN----LTERETSCLQLAGDGYTSE 192
           +  ++  +  I+A  A   +      +   R++        L  +E S L+    G T E
Sbjct: 133 DKPVIDLDREIDAVAAASTIGQIHARISYLRTTPTAEDAAWLDPKEASYLRWIAVGMTME 192

Query: 193 EIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           EIA+  G+  ++V   L  A  + D  ++   IA AIR   I
Sbjct: 193 EIADVEGVKYNSVRVKLREAMKRFDVHSKAHLIALAIRRKLI 234


>gi|241203072|ref|YP_002974168.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240856962|gb|ACS54629.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 234

 Score =  121 bits (305), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 50/226 (22%), Positives = 87/226 (38%), Gaps = 8/226 (3%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
            ++ +  +    L          NFAL  I+ A   P  ++ +   +  +   G     L
Sbjct: 16  SRAINRTDFFRLLKSAAQHYNFDNFALARISEA-SAPFGERDVVITNVAERRVGLFITTL 74

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
            E  G            P+       +  +  S  +      G+  F     P+     +
Sbjct: 75  KEALGTVRAKTAQFLATPV--HGRSAQPEVYPSDLVFNEFLSGVFLF----IPLFTPEGR 128

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDG 188
              ++ + E        I +      ++     E        +  LT+RE+  ++   +G
Sbjct: 129 RYCLVLSGERQEPDQSEIADILLDAMRIFDKLYE-EILTPEMSGRLTQRESEIVKWTSEG 187

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            TS EIA  LGLS HTVN+++ +A  KLDAVNR+  +A A+R G +
Sbjct: 188 KTSAEIAIILGLSEHTVNSHITAAARKLDAVNRVHMVAIALRNGLV 233


>gi|78048691|ref|YP_364866.1| LuxR family transcriptional regulator [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325926244|ref|ZP_08187599.1| response regulator containing a CheY-like receiver domain and an
           HTH DNA-binding domain [Xanthomonas perforans 91-118]
 gi|78037121|emb|CAJ24866.1| transcriptional regulator, LuxR family [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325543331|gb|EGD14759.1| response regulator containing a CheY-like receiver domain and an
           HTH DNA-binding domain [Xanthomonas perforans 91-118]
          Length = 254

 Score =  121 bits (305), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 42/247 (17%), Positives = 76/247 (30%), Gaps = 15/247 (6%)

Query: 1   MSENTLTGKKSSS-LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDL 59
           +  +    +   S L  +   +  +    ++  +    +  +L+       +    N   
Sbjct: 8   LGCDLQALQTLDSCLDRVFRDVCALG--FQSLVYDYAPVPLSLEGALITPTVFMQRNAPG 65

Query: 60  DSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIES-----SGQLSVRLEGGLLP 114
           D   +         D           P +W    +             +   R       
Sbjct: 66  DMQHVWCEHGYYQHDPVQQRATRRTTPFVWSYRTDGHCAGVEYVGGQHRQVTRYLCDSGM 125

Query: 115 FAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIEAH-----GACYQVITDFLELFKKRSS 169
             G+  P+ L            +        + EA         +       EL + +  
Sbjct: 126 GTGVTVPLHLPGGAFATFSGAIDAAAAQAPRLAEAQVLPFLLLAHAFQARAQELLEPQER 185

Query: 170 AAR--NLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAK 227
                 LT RE  CLQ +  G TS+ IA  L  S  TVN +L SA  KL A NR++A+ +
Sbjct: 186 RCHHIALTRRERECLQYSAKGLTSKRIAAALNRSTATVNLHLNSAARKLGARNRVEAVVR 245

Query: 228 AIRFGYI 234
            + +  +
Sbjct: 246 GMHYRLL 252


>gi|218682848|ref|ZP_03530449.1| transcriptional regulator, LuxR family protein [Rhizobium etli CIAT
           894]
          Length = 230

 Score =  121 bits (305), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 55/234 (23%), Positives = 85/234 (36%), Gaps = 5/234 (2%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLD 60
           M    L G ++ SL   +  L  + +     +  L    S+ D     + +    +    
Sbjct: 1   MLSAELAGARTRSL--FAQALGRVSSAFGLSHATLMHAPSSEDLLL--RPLLIETSLPAA 56

Query: 61  SGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAF 120
                +      G  F        +P +W  + +    ++       L       AGIA 
Sbjct: 57  YIREFDRAHMMRGCPFGLRLRESAVPPVWH-LNDAVNGQAFPAELRALMLRHAIPAGIAM 115

Query: 121 PVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETS 180
           P      +     F  E   LA   + E        +  +  + +        L+ RE  
Sbjct: 116 PTITADGQRLVFWFCGERAALAQSEVNELAMIILHALDAYNAVKRNEECTHNALSIRELE 175

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            ++    G TS EI + L LS HTVNAY+ +A  KLD VNR Q +AKAIR   I
Sbjct: 176 VVRWTAQGKTSIEIGQILTLSDHTVNAYMTNAIKKLDCVNRTQLVAKAIRLKLI 229


>gi|116253270|ref|YP_769108.1| LuxR/GerE family transcriptional regulatory protein [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115257918|emb|CAK09016.1| putative LuxR/GerE family transcriptional regulatory protein
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 238

 Score =  121 bits (305), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 51/224 (22%), Positives = 79/224 (35%), Gaps = 3/224 (1%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           + +    +  L  I       +  L    S  D   +   +    +         +    
Sbjct: 17  ARTRSLFAQALGRISTAFGLSHATLMHAPSPEDLLLKP--LLIESSLPAAYVRDFDRAHM 74

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             G  F     +  +P  W  + + +  ++       L       AG+A P      +  
Sbjct: 75  MRGCPFGVRLRASAVPPAWH-LNDASNGQAFPAELRALMLRHAIPAGVAMPTTAADGQRL 133

Query: 131 YVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYT 190
              F  E   L    I E        +  +  + +    A   L+ RE   ++    G T
Sbjct: 134 VFWFCGERAALGQSEINELVMIILHALDAYNAVKRNEECAHNALSNRELEVVRWTAQGKT 193

Query: 191 SEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           S EI + L LS HTVNAY+ +A  KLD VNR Q +AKAIR   I
Sbjct: 194 SIEIGQILTLSDHTVNAYMTNAIKKLDCVNRTQLVAKAIRLKLI 237


>gi|134291173|ref|YP_001114942.1| response regulator receiver protein [Burkholderia vietnamiensis G4]
 gi|134134362|gb|ABO58687.1| transcriptional regulator, LuxR family [Burkholderia vietnamiensis
           G4]
          Length = 260

 Score =  121 bits (305), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 40/228 (17%), Positives = 74/228 (32%), Gaps = 16/228 (7%)

Query: 16  ELSPRLHLIQNRIKARNFALYTIN-SALDFPRRQQLI---CELHNYDLDSGDIPNILIET 71
           ++S     + + +    F  Y +   AL   R +  I       +Y  +           
Sbjct: 39  DISSLSDSLGDAVLPLGFPCYAVTRIALTCYRSRPSISMEAICTHYPNNWVQHYLQHNYG 98

Query: 72  YGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGY 131
             D       +   P  W  I + +  E   +  +          G++ P+R        
Sbjct: 99  AVDPVHRAAFTSSGPYRWADITDLSQNE---RHVLAEACDAGLKNGLSIPIREIGGSILL 155

Query: 132 VIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARN-----LTERETSCLQLAG 186
           +  +     +      +       VI++   L   R +         L+ R+  CL    
Sbjct: 156 INLSGPSSRINTGTKRQL----ASVISNLFRLELDRLAPPHPNEFIQLSPRQRQCLSWVA 211

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            G TS +I   L +S HTV  ++  A   L+  +RI A   A  +G +
Sbjct: 212 QGKTSSDICMILKISRHTVEYHITEAMRVLNVNSRIAAAVIASNYGLL 259


>gi|294637446|ref|ZP_06715736.1| transcriptional activator protein CarR [Edwardsiella tarda ATCC
           23685]
 gi|291089387|gb|EFE21948.1| transcriptional activator protein CarR [Edwardsiella tarda ATCC
           23685]
          Length = 239

 Score =  121 bits (304), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 36/232 (15%), Positives = 70/232 (30%), Gaps = 17/232 (7%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
            Q++   +    +      FA   +N      +    I  + NY  +   +         
Sbjct: 9   AQDIKRFIDQSLSYYGQLQFAYLLLNK-----KNPTEITIISNYPDEWVTLYKEHHYQQI 63

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
           D  + +    + P +W         + +      L        G  F +    ++   + 
Sbjct: 64  DPVVIYALRRVSPFLWDEKI-TVNAKLNLSKIFSLAKKYQVNKGYTFVLHDADNQLAMLS 122

Query: 134 FTSEFLMLA--NEVIIEAHGACYQVITDFLELFKKRSSAARNL---------TERETSCL 182
              +   L+   +               F+   ++      N+         + RE   L
Sbjct: 123 LMVDDHSLSIVEQNQGALQMLLINAHERFMTGQRQLQVQQHNIKSNNMENIFSARENEIL 182

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             A  G T +EIA  LG+   TV  ++G+   KL  +N   AI   +    I
Sbjct: 183 YWASMGKTYQEIALILGIKSGTVKFHIGNVVKKLGVLNAKHAIRLGVELQLI 234


>gi|110633760|ref|YP_673968.1| LuxR family transcriptional regulator [Mesorhizobium sp. BNC1]
 gi|110284744|gb|ABG62803.1| transcriptional regulator, LuxR family [Chelativorans sp. BNC1]
          Length = 241

 Score =  121 bits (304), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 42/232 (18%), Positives = 76/232 (32%), Gaps = 11/232 (4%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNI 67
            +   S + +   + L+++ +   + + + +N +   P     +               +
Sbjct: 14  VETVRSAKNIEEAIFLLRDGLGLAHVSFH-LNVSGAAPLDYPYVR--TTLPSQWISRYVL 70

Query: 68  LIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFH 127
                 D  +    S L P  W  ++     E   +         +   G + P    F 
Sbjct: 71  RTYVGHDPVMREGFSSLRPFSWHELEMS---EKEREFMEDARSHGIGAQGYSIPTVDRFS 127

Query: 128 KNGYVIFTSEFLMLANEVIIEAHG-----ACYQVITDFLELFKKRSSAARNLTERETSCL 182
           +   +  T++  +      I  H          +    L        +   L  RE  CL
Sbjct: 128 RRSLLSLTADLDLGLWAGFIRRHASSVIEISQVLHQKALNELGIGEPSGATLAPRERECL 187

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
                G  S++IA  L LS +TV +YL +A  KL      QA+A A R   I
Sbjct: 188 LWTARGKDSKDIAGILDLSEYTVRSYLRTARQKLQCRTLSQAVATATRQRII 239


>gi|222149400|ref|YP_002550357.1| transcriptional regulator LuxR family [Agrobacterium vitis S4]
 gi|221736383|gb|ACM37346.1| transcriptional regulator LuxR family [Agrobacterium vitis S4]
          Length = 241

 Score =  121 bits (304), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 52/234 (22%), Positives = 85/234 (36%), Gaps = 3/234 (1%)

Query: 4   NTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICEL-HNYDLDSG 62
            TL   + ++++       +++   +A   +  +I  A        L   +     ++ G
Sbjct: 7   QTLLSTEITAMESREHCAEILRTVAQAFGLSHGSILLAPCATDVHLLPLVMETTLPMEFG 66

Query: 63  DIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETV--IESSGQLSVRLEGGLLPFAGIAF 120
              +          +  F   +LP  W     E     E        L        G+ F
Sbjct: 67  HEFDRHQFVKFCPVVKKFAGSILPRTWDMKFREPNDMAEEWPPAMRDLMMRFKLIVGVVF 126

Query: 121 PVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETS 180
                  +  ++ F  +   L+   + E       V   +  L +        L+ RE  
Sbjct: 127 IFPSLDSRLYFMRFDGDRSPLSQCEVNELGMLAMAVFDTYDRLRRTELMNVDVLSVRELE 186

Query: 181 CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            L+    G TS EI + L LS HT+NAY+ +A  KLD VNR Q +AKAIR   I
Sbjct: 187 VLRWTAQGKTSVEIGQILSLSDHTINAYMTTAMKKLDCVNRTQLVAKAIRLKLI 240


>gi|207722200|ref|YP_002252637.1| hypothetical solr-related protein [Ralstonia solanacearum MolK2]
 gi|206587375|emb|CAQ17958.1| hypothetical solr-related protein [Ralstonia solanacearum MolK2]
          Length = 459

 Score =  121 bits (304), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 40/203 (19%), Positives = 62/203 (30%), Gaps = 11/203 (5%)

Query: 38  INSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETV 97
            ++ +  P  +  +     Y                D  +    S    I+W        
Sbjct: 262 YSARMPLPVSKPAVAIFDTYPAGWMQHYQANGFLDIDPTVRAGASSGDMIVWP-----VS 316

Query: 98  IESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVIIEA----HGAC 153
           I                  G+A          G +        L    +       H   
Sbjct: 317 IRDEAARLWSDARDAGLNVGVARSSWTAHGAFGLLTLARHADPLTAAELGRLSIATHWLA 376

Query: 154 YQVITDFLELFKKRSSAARN--LTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGS 211
               T        +     N  LT RE   L   G+G T+ EI + L +S  TVN ++ +
Sbjct: 377 NLAHTLMSPFLVPKLVPESNAVLTAREREVLCWTGEGKTAYEIGQILRISERTVNFHVNN 436

Query: 212 ATVKLDAVNRIQAIAKAIRFGYI 234
             +KL A N++QA+ KAI  G I
Sbjct: 437 VLLKLAATNKVQAVVKAIATGLI 459


>gi|330973265|gb|EGH73331.1| regulatory protein, LuxR [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 240

 Score =  121 bits (304), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 42/228 (18%), Positives = 72/228 (31%), Gaps = 9/228 (3%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
           T  +      +   L  ++    +     +     L       L     N D   GD   
Sbjct: 21  TISELDGQTAIENALEWLRRECNSERAMFFQFKGPL------LLTFITSNVDEAWGDAYR 74

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                  D  +  + + L  + WQ    +  + +       L         I++      
Sbjct: 75  QHDLIMQDPVIRCYRNQLGFLNWQDAFRQYPVSA---FYDELVDACELLPAISYGYTNHC 131

Query: 127 HKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAG 186
                V        +   +  E       ++     + +     +R LT RE   LQ A 
Sbjct: 132 RGADSVTSVCTLGEVERPISAEQKYLMSSLMPVLHSVARGLKFCSRGLTHRELEVLQWAR 191

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           DG T+ EI+    +S  TV  +L +   KL   NR QA+ +A+  G I
Sbjct: 192 DGKTAWEISMIRDVSESTVKYHLKTIYSKLGVANRAQAVGEALCRGLI 239


>gi|190890329|ref|YP_001976871.1| transcriptional regulator protein, LuxR family [Rhizobium etli CIAT
           652]
 gi|190695608|gb|ACE89693.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli CIAT 652]
          Length = 234

 Score =  121 bits (304), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 51/226 (22%), Positives = 86/226 (38%), Gaps = 8/226 (3%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
            ++ +  +    L          NFAL  I+ A   P  ++ +   +  +   G     L
Sbjct: 16  SRAINRTDFFRLLKAAAQHYHFDNFALARISEA-SAPFGERDVVITNVPERRVGLFIATL 74

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
            E  G+           P+       E     S +L      G+  F     P+     +
Sbjct: 75  REALGNVRAKSAQFLATPV--HGRSAEPAAYPSDRLFNEFRSGVFLF----IPLFTPEGR 128

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDG 188
              ++ +          I +      ++     E        +  LT+RE   ++   +G
Sbjct: 129 RYCLVLSGVREEPDQGEIADMLLDAMRIFDKLYE-EILTHEMSGRLTQREAEIVKWTSEG 187

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            TS EIA  LGLS HTVN+++ +A  KLDAVNR+  +A A+R G +
Sbjct: 188 KTSAEIAIILGLSEHTVNSHITAAARKLDAVNRVHMVAIALRNGLV 233


>gi|66045102|ref|YP_234943.1| regulatory protein, LuxR [Pseudomonas syringae pv. syringae B728a]
 gi|63255809|gb|AAY36905.1| regulatory protein, LuxR [Pseudomonas syringae pv. syringae B728a]
          Length = 240

 Score =  121 bits (303), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 42/228 (18%), Positives = 72/228 (31%), Gaps = 9/228 (3%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
           T  +      +   L  ++    +     +     L       L     N D   GD   
Sbjct: 21  TITELDGQTAIENALEWLRRECNSERAMFFQFKGPL------LLTFITSNVDEAWGDAYR 74

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                  D  +  + + L  + WQ    +  + +       L         I++      
Sbjct: 75  QHDLIMQDPVIRCYRNQLGFLNWQDAFRQYPVSA---FYDELVDACELLPAISYGYTNHC 131

Query: 127 HKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAG 186
                V        +   +  E       ++     + +     +R LT RE   LQ A 
Sbjct: 132 RGADSVTSVCTLGEVERPISAEQKYLMSSLMPVLHSVARGLKFCSRGLTHRELEVLQWAR 191

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           DG T+ EI+    +S  TV  +L +   KL   NR QA+ +A+  G I
Sbjct: 192 DGKTAWEISMIRDVSESTVKYHLKTIYSKLGVANRAQAVGEALCRGLI 239


>gi|222080193|ref|YP_002540056.1| transcriptional regulator [Agrobacterium vitis S4]
 gi|221738838|gb|ACM39617.1| transcriptional regulator [Agrobacterium vitis S4]
          Length = 227

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 40/222 (18%), Positives = 70/222 (31%), Gaps = 12/222 (5%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDF 76
           L   L  I +      +A   I          + I  + NY  +   +         D  
Sbjct: 14  LKTGLADIADHFGFTGYAYLHIQH--------RHITAVTNYHPEWQSVYFDKKFDALDPV 65

Query: 77  LFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTS 136
           +    S      W    E   +    +            +GI  P++            S
Sbjct: 66  VKRARSRKHIFTWSGEHERPTLSKDERAFYAHAADFGIRSGITIPIKTANGSMSMFTLAS 125

Query: 137 EFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARN----LTERETSCLQLAGDGYTSE 192
           E  ++  +  I+A  A   +      +   R++        L  +E + L+    G T E
Sbjct: 126 EKPVIDLDREIDAVAAAGTIGQIHARISFLRTTPTAEDAAWLDPKEATYLRWIAVGKTME 185

Query: 193 EIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           EIA+  G+  ++V   L  A  + D  ++    A AIR   I
Sbjct: 186 EIADVEGVKYNSVRVKLREAMKRFDVRSKAHLTALAIRRKLI 227


>gi|116049068|ref|YP_792130.1| transcriptional regulator [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115584289|gb|ABJ10304.1| probable transcriptional regulator [Pseudomonas aeruginosa
           UCBPP-PA14]
          Length = 243

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 45/234 (19%), Positives = 81/234 (34%), Gaps = 4/234 (1%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFP-RRQQLICELHNYDL 59
           + ++    +K+++ + +   +     R+      + ++           +L     ++  
Sbjct: 8   LFDSVARLRKAATTEAVCREMVEFAARLGFDRVIVCSLFPRPGEDELIDELFFVHGDWAE 67

Query: 60  DSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIA 119
                              H      P  W     E     + ++   +   L    G+ 
Sbjct: 68  GRSAQERD-AYLLHCPVTRHILELDEPFFWSKNPSEDPARMTYRIVRGVR-DLGQVNGMQ 125

Query: 120 FPVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSS-AARNLTERE 178
            PV       G V F  E L L     + A   C  +      L    S+  A+ L+ERE
Sbjct: 126 VPVFGRNGLEGAVSFAGERLDLNAGCKLAAQAFCPILFFALKRLRGPVSAGDAQALSERE 185

Query: 179 TSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFG 232
              LQ    G    E+A  L +S  TV  +L +A  +L A +  QA+A+A+R G
Sbjct: 186 REVLQWIALGKQQAEVAAILMISERTVENHLRAARRRLGAASTAQAVARALRLG 239


>gi|325919969|ref|ZP_08181953.1| response regulator containing a CheY-like receiver domain and an
           HTH DNA-binding domain [Xanthomonas gardneri ATCC 19865]
 gi|325549544|gb|EGD20414.1| response regulator containing a CheY-like receiver domain and an
           HTH DNA-binding domain [Xanthomonas gardneri ATCC 19865]
          Length = 254

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 44/244 (18%), Positives = 78/244 (31%), Gaps = 17/244 (6%)

Query: 8   GKKSSSLQELSPRLHLIQNRIKARNF-----ALYTINSALDFPRRQQLICELHNYDLDSG 62
           G+   +L  L+  L  +   + A  F         +  +++       +    N   D  
Sbjct: 9   GRDLQALHTLNACLDRVFRDVCAFGFKSLVYDYAPVPLSMEGALITPSVFMQRNAPGDMR 68

Query: 63  DIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETV-----IESSGQLSVRLEGGLLPFAG 117
            +         D         + P +W    +        +    +   R         G
Sbjct: 69  HVWCEHGYYQHDPVQQRATRRMTPFVWSYRTDGNQEGVEYVGGQHRQVTRYLCDSGMGTG 128

Query: 118 IAFPVRLGFHKNGYVIFTSEFLMLANEVIIEAHG-----ACYQVITDFLELFKKRSSAAR 172
           +  P+ L            + +      + EA         +       EL   +     
Sbjct: 129 VTVPLHLPGGAFATFSGAVDAVAAEAPRLAEAQLSPFLLLAHAFQARAQELLDPQERRCH 188

Query: 173 --NLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIR 230
              LT RE  CLQ +  G T++ IA  L  S  TVN +L SA  KL A NR++A+ + + 
Sbjct: 189 HIALTRRERECLQYSAKGLTAKSIAAALNRSTATVNLHLNSAARKLGARNRVEAVVRGMH 248

Query: 231 FGYI 234
           +  +
Sbjct: 249 YRLL 252


>gi|15965591|ref|NP_385944.1| putative transcription regulator HSL-dependent protein
           [Sinorhizobium meliloti 1021]
 gi|307302711|ref|ZP_07582467.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
 gi|307318559|ref|ZP_07597993.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|15074772|emb|CAC46417.1| Quorum sensing system, AHL autoinducer-binding, luxR family,
           regulator of sinI [Sinorhizobium meliloti 1021]
 gi|306895899|gb|EFN26651.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|306903075|gb|EFN33666.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
          Length = 245

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 41/229 (17%), Positives = 75/229 (32%), Gaps = 15/229 (6%)

Query: 15  QELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGD 74
            +      L++      +        A   P   ++    H +   + +I         D
Sbjct: 20  ADPERFFALMRRTFNISHLLYL---EAESLPDGLRICRLHHTFGAYAAEIYAARGLYRID 76

Query: 75  DFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLP-FAGIAFPVRLGFHKNGYVI 133
             L     G+ P+ W + +         +        +     G+A P+     +   + 
Sbjct: 77  PILKLALGGVRPVEWATARRR---FPECEPLFEAAEEIGLSTEGVALPLPSPAGRMALLA 133

Query: 134 FTSEFLMLANEV-----IIEAHGACYQVITDFLELFKKRSSAARN---LTERETSCLQLA 185
             +    +         + +   A        LE      +       LT RET  L  +
Sbjct: 134 IGANMSPVEWSAYRRCHLRDFQLAANLFHASMLEHSAMAGALDERDLRLTGRETEVLTWS 193

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             G +  EIA  LG+S  TV  ++ +A  KL+ V+  QA+A A+R   I
Sbjct: 194 AAGKSYWEIATILGISERTVRFFMTNARRKLNVVSNTQAVAHAVRHALI 242


>gi|16519697|ref|NP_443817.1| LuxR-type activtator protein TraR for conjugal transfer of pNGR234a
           [Sinorhizobium fredii NGR234]
 gi|2495425|sp|P55407|TRAR_RHISN RecName: Full=Probable transcriptional activator protein traR
 gi|7465594|pir||T02771 probable transcription activator traR - Rhizobium sp. plasmid
           pNGR234a
 gi|158429605|pdb|2Q0O|A Chain A, Crystal Structure Of An Anti-Activation Complex In
           Bacterial Quorum Sensing
 gi|158429606|pdb|2Q0O|B Chain B, Crystal Structure Of An Anti-Activation Complex In
           Bacterial Quorum Sensing
 gi|2182351|gb|AAB91637.1| LuxR-type activtator protein TraR for conjugal transfer of pNGR234a
           [Sinorhizobium fredii NGR234]
          Length = 236

 Score =  120 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 41/219 (18%), Positives = 66/219 (30%), Gaps = 12/219 (5%)

Query: 20  RLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFH 79
            L    +      FA    +           +   H+Y      I         D  L  
Sbjct: 26  ALRSFAHSCGYDRFAYLQKDGTQ--------VRTFHSYPGPWESIYLGSDYFNIDPVLAE 77

Query: 80  FNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFL 139
                    W +        S  +             G+  PV   +     + F S   
Sbjct: 78  AKRRRDVFFWTADAWPARGSSPLRRFRDEAISHGIRCGVTIPVEGSYGSAMMLTFASPER 137

Query: 140 MLANEVIIEAHGACYQVITDFLEL----FKKRSSAARNLTERETSCLQLAGDGYTSEEIA 195
            +    +++   A   ++    +L     K   +  + L+ RE  CL  A  G T+   A
Sbjct: 138 KVDISGVLDPKKAVQLLMMVHYQLKIIAAKTVLNPKQMLSPREMLCLVWASKGKTASVTA 197

Query: 196 EKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
              G++  TV  YL  A  KLDA +  Q +A A   G +
Sbjct: 198 NLTGINARTVQHYLDKARAKLDAESVPQLVAIAKDRGLV 236


>gi|260462698|ref|ZP_05810904.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
 gi|319782267|ref|YP_004141743.1| Autoinducer-binding domain protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|259031604|gb|EEW32874.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
 gi|317168155|gb|ADV11693.1| Autoinducer-binding domain protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 240

 Score =  120 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 40/218 (18%), Positives = 67/218 (30%), Gaps = 2/218 (0%)

Query: 19  PRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLF 78
           P L  +   ++   F    ++      ++   + EL+ +                D    
Sbjct: 21  PLLDDVLLTVRNLGFEHLILSGVPLGGQKLAPMVELNGWPEGWFKRYVEAEHAAVDGVCI 80

Query: 79  HFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEF 138
           +    L P +W  +  +       +            +G A P+    H    + F S  
Sbjct: 81  YSAKTLKPFLWADVPAKWSDTKGSRRVAGEATEFGISSGFAVPMLSVHHWQSVLSFASSA 140

Query: 139 --LMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAE 196
               L+    ++              L          LTERE   L  A  G TS E ++
Sbjct: 141 KVCALSPREEVQLVTMAVYAGMAIQALSHGDEVEEGLLTEREKEVLLWAAAGKTSSETSQ 200

Query: 197 KLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            LGL+  TV  +   A          QAI +A+R   I
Sbjct: 201 ILGLAERTVKWHATRAREAFGVATTTQAIVEAVRRRMI 238


>gi|242237587|ref|YP_002985768.1| LuxR family transcriptional regulator [Dickeya dadantii Ech703]
 gi|242129644|gb|ACS83946.1| transcriptional regulator, LuxR family [Dickeya dadantii Ech703]
          Length = 236

 Score =  120 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 37/228 (16%), Positives = 70/228 (30%), Gaps = 13/228 (5%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
              +   L           +A   +N           +  + NY  +  +          
Sbjct: 12  RAAIQNHLARNLQCYSGLKYAYLIMNKRFPTD-----MVIISNYPSEWVNTYKKRNYNSI 66

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVI 133
           D  +    + + P  W             QL            G  F +    +    + 
Sbjct: 67  DPVILTAVNKVSPFSWNDNMVRNSRLKLPQLF-EHARQYDICNGYTFVLHDQNNHMATLS 125

Query: 134 FTSEFLML-----ANEVIIEAHGACYQVITDFLELFKKRSSAARNL--TERETSCLQLAG 186
             ++ +         ++ +       + ++ + EL + R   + ++  +ERE   L  A 
Sbjct: 126 LAADNIENMIHGNQEKLQMLLIATHEKTLSLYRELAESRQHRSNDMLFSERENDILYWAS 185

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            G T +EIA  LG+   TV  ++G+   KL   N   AI   I    I
Sbjct: 186 MGKTYQEIALILGIKTSTVKFHIGNVVRKLGVTNAKHAIRMGIEMNLI 233


>gi|85708570|ref|ZP_01039636.1| two-component transcriptional regulator, LuxR family protein
           [Erythrobacter sp. NAP1]
 gi|85690104|gb|EAQ30107.1| two-component transcriptional regulator, LuxR family protein
           [Erythrobacter sp. NAP1]
          Length = 236

 Score =  120 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 42/227 (18%), Positives = 72/227 (31%), Gaps = 7/227 (3%)

Query: 13  SLQELSPRLHLIQNRI---KARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
           +L E+S  L  ++++     A   + + +  A D    +      H +  +   +     
Sbjct: 10  TLVEISDVLTYVRDQAIKAGAARMSYH-VTPAFDQQTSRTAAVYAHGFSDEWMALYAKEE 68

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
               D            + WQ            +             G   P+     ++
Sbjct: 69  FRLTDPIPGRVMQFGSLMTWQDAMSWQHNTPDQEAYFAKMKEYDLIHGFGIPLYGRNARD 128

Query: 130 GYVIFT--SEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGD 187
            Y  F        +A E I              + L + +   A  L+ERE   L  A  
Sbjct: 129 AYASFDFLKHVDDVAPESIGMIRSLSQVAHQRVVILVEHKLD-APALSEREVEVLTWAAR 187

Query: 188 GYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           G +   IA  L +S  T   Y      KLD  +R+ A+ KA+R G +
Sbjct: 188 GKSLSAIATILDISPDTAKTYSKRIYAKLDVSDRVGAVVKALRMGLV 234


>gi|325917294|ref|ZP_08179515.1| response regulator containing a CheY-like receiver domain and an
           HTH DNA-binding domain [Xanthomonas vesicatoria ATCC
           35937]
 gi|325536514|gb|EGD08289.1| response regulator containing a CheY-like receiver domain and an
           HTH DNA-binding domain [Xanthomonas vesicatoria ATCC
           35937]
          Length = 254

 Score =  120 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 38/214 (17%), Positives = 68/214 (31%), Gaps = 12/214 (5%)

Query: 33  FALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSI 92
           +    +  +++       +    N   D   +         D           P +W   
Sbjct: 39  YDYAPVPLSMEGGLITPTVFMQRNAPGDMQHVWCEHGYYQHDPVQQRATRRTTPFVWSYR 98

Query: 93  QEETVIE-----SSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLANEVII 147
            +          +  +   R         G+  P+ L       +    + +      + 
Sbjct: 99  TDGNRPGVEYVGAQHRQVTRYLCDSGMGNGVTVPLHLPGGAFATLSGAVDAVAAEAPRLA 158

Query: 148 EAHG-----ACYQVITDFLELFKKRSSAAR--NLTERETSCLQLAGDGYTSEEIAEKLGL 200
           EA         +       EL   +        LT RE  CLQ +  G T++ IA  L  
Sbjct: 159 EAQLSPFLLLAHAFQARAQELLDPQERRCHHIALTRRERECLQYSAKGLTAKSIAAALNR 218

Query: 201 SVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           S  TVN +L SA  KL A NR++A+ + + +  +
Sbjct: 219 STATVNLHLNSAARKLGARNRVEAVVRGMHYRLL 252


>gi|150396769|ref|YP_001327236.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
 gi|150028284|gb|ABR60401.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
          Length = 246

 Score =  120 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 44/229 (19%), Positives = 78/229 (34%), Gaps = 14/229 (6%)

Query: 15  QELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGD 74
            +      L++      +        A   P   ++    H +   + ++  +      D
Sbjct: 20  ADPERFFALMRRTFNIAHLLYL---EAESLPDGLRICRLHHTFGAYAAEVYAVRGLHRID 76

Query: 75  DFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
             L     G+ P+ W +            L V  E   L   G+A P+     +   +  
Sbjct: 77  PILKLALGGVRPVEWATA--RRRFPECEPLFVAAEEIGLSTEGVALPLPSPAGRMALLAI 134

Query: 135 TSEFLMLANEV-----IIEAHGACYQVITDFLELFKKRSSAAR----NLTERETSCLQLA 185
           ++    +         + +   A        LE      +        LT RET  L  +
Sbjct: 135 SANMSPVEWSAYRRCHLRDFQLAANLFHASMLEHSAMAGAMEDERDLRLTGRETEVLTWS 194

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             G +  EIA  LG+S  TV  ++ +A  KL+ V+  QA+A A+R   I
Sbjct: 195 AAGKSYWEIATILGISERTVRFFMTNARRKLNVVSNTQAVAHAVRHALI 243


>gi|330940036|gb|EGH43227.1| regulatory protein, LuxR [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 240

 Score =  120 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 41/228 (17%), Positives = 72/228 (31%), Gaps = 9/228 (3%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
           T  +      +   L  ++    +     +     +       L     N D   GD   
Sbjct: 21  TISELDGQTAIENALEWLRRECNSERAMFFQFKGPV------LLTFITSNVDEAWGDAYR 74

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                  D  +  + + L  + WQ    +  + +       L         I++      
Sbjct: 75  QHDLITQDPVIRCYRNQLGFLNWQEAFRQYPVSA---FYDELVDACELLPAISYGYTNHC 131

Query: 127 HKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAG 186
                V        +   +  E       ++     + +     +R LT RE   LQ A 
Sbjct: 132 RGADSVTSVCTLGEVERPISAEQKYLMSSLMPVLHSVARGLKFCSRGLTHRELEVLQWAR 191

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           DG T+ EI+    +S  TV  +L +   KL   NR QA+ +A+  G I
Sbjct: 192 DGKTAWEISMIRDVSESTVKYHLKTIYSKLGVANRAQAVGEALCRGLI 239


>gi|9297035|sp|O54452|RAIR_RHIET RecName: Full=Transcriptional activator protein raiR
 gi|2897879|gb|AAC38173.1| RaiR [Rhizobium etli]
          Length = 242

 Score =  120 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 32/196 (16%), Positives = 63/196 (32%), Gaps = 10/196 (5%)

Query: 34  ALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQ 93
           A  +            L+     Y  +             D  +     G LP+ W +  
Sbjct: 42  AYGSPCDLAGATDSNPLLML--TYPPEWVKQYRDRDYFSIDPVVRLGRRGFLPVEWSASG 99

Query: 94  EETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLAN-----EVIIE 148
            ++    +           +   G+  PVR    +      TS            + + +
Sbjct: 100 WDS--GRAYGFFKEAMAFGVGRQGVTLPVRGPQGERSLFTVTSNHPDAYWRQFRMDSMRD 157

Query: 149 AHGACYQVITDFLELFK-KRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNA 207
                + +    + L   ++ +    L+ RE  CL++  +G  +++I  +L +SV  V  
Sbjct: 158 LQFLAHHLHDRAMVLSGMRKVADLPRLSRRELQCLEMTANGLLAKQICARLSISVSAVQL 217

Query: 208 YLGSATVKLDAVNRIQ 223
           YL SA  KL      +
Sbjct: 218 YLASARRKLTVATTSE 233


>gi|103488066|ref|YP_617627.1| LuxR family transcriptional regulator [Sphingopyxis alaskensis
           RB2256]
 gi|98978143|gb|ABF54294.1| transcriptional regulator, LuxR family [Sphingopyxis alaskensis
           RB2256]
          Length = 250

 Score =  120 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 76/226 (33%), Gaps = 5/226 (2%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           +SS+  L   L      +    FA   ++  +           +H+Y     D+      
Sbjct: 16  ASSIDHLHEALTRATRDMGFDRFA---LSLEIGCGADSSTSLLIHDYPASWADVYIGFNL 72

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
              D         +L   W++I +   +    + +           G   P  L     G
Sbjct: 73  AASDPVRRAAERSVLGFGWRNILDLVPMTEIEKTTFETGRRHGLADGFTVPRHLPGDVTG 132

Query: 131 YVIF-TSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARN-LTERETSCLQLAGDG 188
              F T     + + ++I A       I    +L    S + +  LT+R+  C+  A  G
Sbjct: 133 SCSFVTGLGKSIPHAMLIVAEMLGAMAIASARQLSGWTSRSVQPRLTDRQRDCVLWAARG 192

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            T  EI+  L +S  TV  +L  A  + +   R   I  A+  G I
Sbjct: 193 KTDWEISRILDISHETVIQHLKDARERYETHKRASLILYALYDGLI 238


>gi|302185070|ref|ZP_07261743.1| regulatory protein, LuxR [Pseudomonas syringae pv. syringae 642]
          Length = 240

 Score =  120 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 41/228 (17%), Positives = 74/228 (32%), Gaps = 9/228 (3%)

Query: 7   TGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPN 66
           T  +      +   L  ++    +     +     +       L     N D   G+   
Sbjct: 21  TITELDGQTAIENALEWLRRECNSERAMFFQFKGPV------LLTFITSNVDHAWGEAYR 74

Query: 67  ILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGF 126
                  D  +  + + L  + WQ    +  + +       L         I++      
Sbjct: 75  QHDLITQDPVIRCYRNQLGFLNWQDAFRQYPVSA---FYDELVDACELLPAISYGYTNHC 131

Query: 127 HKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAG 186
                V        +A  +  E       ++     + +    ++R LT RE   LQ A 
Sbjct: 132 RGADSVTSVCTLGEVARTISAEQKYLMSSLMPVLHSVARGLKFSSRGLTHRELEVLQWAR 191

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           DG T+ EI+    +S  TV  +L +   KL   NR QA+ +A+  G I
Sbjct: 192 DGKTAWEISMIRDVSESTVKYHLKTIYSKLGVANRAQAVGEALCRGLI 239


>gi|166711196|ref|ZP_02242403.1| transcriptional regulator AhyR/AsaR family protein [Xanthomonas
           oryzae pv. oryzicola BLS256]
          Length = 254

 Score =  120 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 42/233 (18%), Positives = 74/233 (31%), Gaps = 14/233 (6%)

Query: 14  LQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYG 73
           L  +   +  +    ++  +    +  +++       +    N   D   +         
Sbjct: 22  LDRVFRDVCALG--FQSLVYDYAPVPLSMEGALITPTVFMQRNAPGDMQHVWCEHGYYQH 79

Query: 74  DDFLFHFNSGLLPIIWQSIQEETVIES-----SGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
           D           P +W    +             +   R         G+  P+ L    
Sbjct: 80  DPVQQRAARRTTPFVWSYRTDGDCAGVEYVGGQHRQVTRYLCDSGMGTGVTVPLHLPGGA 139

Query: 129 NGYVI-----FTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAAR--NLTERETSC 181
                       +E L LA   ++      +       EL   +        LT RE  C
Sbjct: 140 FATFSGAIDAVAAEALRLAESQLLPFLLLAHAFQARAQELLDPQERRCHYIALTRREREC 199

Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           LQ +  G TS+ IA  L  S  TVN +L SA  KL A NR++A+ + + +  +
Sbjct: 200 LQYSAKGLTSKRIAAALNRSTATVNLHLNSAARKLGARNRVEAVVRGMHYRLL 252


>gi|313106105|ref|ZP_07792362.1| putative transcriptional regulator [Pseudomonas aeruginosa 39016]
 gi|310878864|gb|EFQ37458.1| putative transcriptional regulator [Pseudomonas aeruginosa 39016]
          Length = 243

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 48/234 (20%), Positives = 80/234 (34%), Gaps = 4/234 (1%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFP-RRQQLICELHNYDL 59
           + ++    +K+++ + +   +     R+      + ++           +L     ++  
Sbjct: 8   LFDSVARLRKAATTEAVCREMVEFAARLGFDRVIVCSLFPRPGEDELIDELFFVHGDWAE 67

Query: 60  DSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIA 119
                              H      P  W     E   E      VR    L    G+ 
Sbjct: 68  GRSAQERD-AYLLHCPVTRHILELDEPFFWSKSPSEDP-ERMTYRIVRGVRDLGQVNGMQ 125

Query: 120 FPVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSS-AARNLTERE 178
            PV       G V F  E L L     + A   C  +      L    S+  A+ L+ERE
Sbjct: 126 VPVFGRNGLEGAVSFAGERLDLNAGCKLAAQAFCPILFFALKRLRGPVSAGDAQALSERE 185

Query: 179 TSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFG 232
              LQ    G    E+A  L +S  TV  +L +A  +L A +  QA+A+A+R G
Sbjct: 186 REVLQWIALGKQQAEVAAILMISERTVENHLRAARRRLGAASTAQAVARALRLG 239


>gi|27802473|gb|AAO21111.1| BisR [Rhizobium leguminosarum bv. viciae]
          Length = 246

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 47/219 (21%), Positives = 72/219 (32%), Gaps = 10/219 (4%)

Query: 20  RLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFH 79
            L   Q          +    A               Y         +      D  +  
Sbjct: 26  ALDEFQQHYPVDFVTFH---LARTIVDSVDAPFVRTTYPDSWVSRYLLNDYINVDPIIRE 82

Query: 80  FNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTS--- 136
             S  LP  W+ I    + +S+ Q  V  E   +   G++ P+     ++   I +    
Sbjct: 83  GFSRQLPFDWREID---IPDSAHQFMVDAEMHGIGGNGVSIPIVDKSRRSLLSINSQMSD 139

Query: 137 -EFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIA 195
            E+  +  + + E     + +    +      +     L  RE  CL  A  G  S++IA
Sbjct: 140 EEWTAIERQFLPEWTELGFLLHRKAVFELHGENDPVPALGTREVECLHWASRGKDSKDIA 199

Query: 196 EKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           E LGLS HT   YL SA  KL       AIA A+    I
Sbjct: 200 EILGLSEHTARGYLKSARYKLGCPTLSAAIAHAVHLNLI 238


>gi|209550397|ref|YP_002282314.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536153|gb|ACI56088.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 241

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 49/224 (21%), Positives = 77/224 (34%), Gaps = 3/224 (1%)

Query: 11  SSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIE 70
           + +    +  L  +       +  L    S  D   +   +    +         +    
Sbjct: 20  ARTRSLFAQALGRVSAAFGLSHATLMHAPSPEDLLLKP--LLIESSLPAAYIKEFDRAHM 77

Query: 71  TYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNG 130
             G  F        +P  W  + +    ++       L       AG+A P      +  
Sbjct: 78  MRGCPFGLRLRESAVPPAWH-LNDAANGQAFPAELRALMLRHAIPAGVAMPTIAANGQRL 136

Query: 131 YVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYT 190
              F  E   L    + E        +  +  + +    A   L+ RE   ++    G T
Sbjct: 137 VFWFCGERAALGQSEVNELAMIILHALDAYNAVKRNEECAHNALSTRELEVVRWTAQGKT 196

Query: 191 SEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           S EI + L LS HTVNAY+ +A  KLD VNR Q +AKAIR   I
Sbjct: 197 SIEIGQILALSDHTVNAYMTNAIKKLDCVNRTQLVAKAIRLKLI 240


>gi|218892898|ref|YP_002441767.1| putative transcriptional regulator [Pseudomonas aeruginosa LESB58]
 gi|218773126|emb|CAW28938.1| probable transcriptional regulator [Pseudomonas aeruginosa LESB58]
          Length = 243

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 48/234 (20%), Positives = 80/234 (34%), Gaps = 4/234 (1%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFP-RRQQLICELHNYDL 59
           + ++    +K+++ + +   +     R+      + ++           +L     ++  
Sbjct: 8   LFDSVARLRKAATTEAVCREMVEFAARLGFDRVIVCSLFPRPGEDELIDELFFVHGDWAE 67

Query: 60  DSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIA 119
                              H      P  W     E   E      VR    L    G+ 
Sbjct: 68  GRSAQ-QRDAYLLHCPVTRHILELDEPFFWSKSPSEDP-ERMTYRIVRGVRDLGQVNGMQ 125

Query: 120 FPVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSS-AARNLTERE 178
            PV       G V F  E L L     + A   C  +      L    S+  A+ L+ERE
Sbjct: 126 VPVFGRNGLEGAVSFAGERLDLNAGCKLAAQAFCPILFFALKRLRGPVSAGDAQALSERE 185

Query: 179 TSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFG 232
              LQ    G    E+A  L +S  TV  +L +A  +L A +  QA+A+A+R G
Sbjct: 186 REVLQWIALGKQQAEVAAILMISERTVENHLRAARRRLGAASTAQAVARALRLG 239


>gi|218515768|ref|ZP_03512608.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli 8C-3]
          Length = 234

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 51/226 (22%), Positives = 86/226 (38%), Gaps = 8/226 (3%)

Query: 9   KKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNIL 68
            ++ +  +    L          NFAL  I+ A   P  ++ +   +  +   G     L
Sbjct: 16  SRAINRTDFFRLLKAAAQHYHFDNFALARISEA-SAPFGERDVVITNVPERRVGLFIATL 74

Query: 69  IETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHK 128
            E  G+           P+       E     S +L      G+  F     P+     +
Sbjct: 75  REALGNVRAKSAQFLATPV--HGRSAEPAAYPSDRLFNEFRSGVFLF----IPLFTPEGR 128

Query: 129 NGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDG 188
              ++ +          I +      ++     E        +  LT+RE   ++   +G
Sbjct: 129 RYCLVLSGVREEPDQGEIADMLLDAMRIFDKLYE-EILTHEMSGRLTQREADIVKWTSEG 187

Query: 189 YTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            TS EIA  LGLS HTVN+++ +A  KLDAVNR+  +A A+R G +
Sbjct: 188 KTSAEIAIILGLSEHTVNSHITAAARKLDAVNRVHMVAIALRNGLV 233


>gi|294012984|ref|YP_003546444.1| LuxR-family transcriptional regulator [Sphingobium japonicum UT26S]
 gi|292676314|dbj|BAI97832.1| LuxR-family transcriptional regulator [Sphingobium japonicum UT26S]
          Length = 248

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 35/219 (15%), Positives = 72/219 (32%), Gaps = 6/219 (2%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
           +  +  ++   + +I  ++    F  + +   +D       +  +HNY     D      
Sbjct: 9   QVRTRDDMGSVMRVIAEQL---GFQYFALTQHVDVVAAGSGVIHIHNYPDRWADFYAANA 65

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
               D      +       W  +     + S     +          G   P  +G    
Sbjct: 66  LGITDPVHRACHMTSWGFRWTQMPTLIPLTSGDHRHLARGRQAGIGDGFTIPSNIGGQPP 125

Query: 130 GYVIFTSE-FLMLANEVIIEAHGACYQVITDFLEL--FKKRSSAARNLTERETSCLQLAG 186
           G   F +E    L  + ++ A             L    +R+  A  +T+R+  C+Q A 
Sbjct: 126 GSCTFANEGDRPLREDRLLLAQLLGNYAFDAARRLWSMPRRAMTAPLITDRQRDCVQWAA 185

Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAI 225
            G +  E ++ L +S  TV +++  A  +     RI  +
Sbjct: 186 RGKSDWETSQILDISRETVTSHIKDACARYQVNKRILLV 224


>gi|271498689|ref|YP_003331714.1| LuxR family transcriptional regulator [Dickeya dadantii Ech586]
 gi|270342244|gb|ACZ75009.1| transcriptional regulator, LuxR family [Dickeya dadantii Ech586]
          Length = 250

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 41/232 (17%), Positives = 74/232 (31%), Gaps = 20/232 (8%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDF 76
           +   L+          +A   +N           +  + NY  +  +I       + D  
Sbjct: 15  IQNYLNRKLKSYGDLKYAYLIMNKKKPTD-----VVIISNYPSEWVEIYRNNNYQHIDPV 69

Query: 77  LFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTS 136
           +    + + P  W      +      ++   L        G  F +    +    + F  
Sbjct: 70  ILTAINRISPFSWDDDLVISSKLKFSRIFN-LSKEYDIVNGYTFVLHDPANNLATLSFMF 128

Query: 137 EF-LMLANEVIIE-----AHGACYQVITDFLELFKKRS-------SAARNL-TERETSCL 182
           E       E I++                   L+++ S       S   NL ++RE   L
Sbjct: 129 EENRSGELEEIVQNNKEKLQMLLISAHEKLTSLYREMSKNRNNSKSQEPNLFSQRENEIL 188

Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
             A  G T +EIA  LG++  TV  ++G+   KL  +N   AI   +    I
Sbjct: 189 YWASMGKTYQEIALILGITTSTVKFHIGNVVKKLGVLNAKHAIRLGVEMNLI 240


>gi|222080291|ref|YP_002540155.1| transcriptional regulator [Agrobacterium vitis S4]
 gi|221738936|gb|ACM39715.1| transcriptional regulator [Agrobacterium vitis S4]
          Length = 230

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 40/222 (18%), Positives = 70/222 (31%), Gaps = 12/222 (5%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDF 76
           L   L  I +      +A   I          + I  + NY  +   +         D  
Sbjct: 17  LKTGLADIADHFGFTGYAYLHIQH--------RHITAVTNYHPEWQSVYFDKKFDALDPV 68

Query: 77  LFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTS 136
           +    S      W    E   +    +            +GI  P++            S
Sbjct: 69  VKRARSRKHIFTWSGEHERPTLSKDERAFYAHAADFGIRSGITIPIKTANGSMSMFTLAS 128

Query: 137 EFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARN----LTERETSCLQLAGDGYTSE 192
           E  ++  +  I+A  A   +      +   R++        L  +E + L+    G T E
Sbjct: 129 EKPVIDLDREIDAVAAAGTIGQIHARISFLRTTPTAEDAAWLDPKEATYLRWIAVGKTME 188

Query: 193 EIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           EIA+  G+  ++V   L  A  + D  ++    A AIR   I
Sbjct: 189 EIADVEGVKYNSVRVKLREAMKRFDVRSKAHLTALAIRRRLI 230


>gi|10955045|ref|NP_059701.1| hypothetical protein pTi_029 [Agrobacterium tumefaciens]
 gi|6094514|sp|P33905|TRAR_AGRTU RecName: Full=Transcriptional activator protein traR
 gi|3377775|gb|AAC28121.1| traR [Agrobacterium tumefaciens]
 gi|81176493|gb|ABB59515.1| TraR [Agrobacterium tumefaciens]
          Length = 234

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 39/222 (17%), Positives = 68/222 (30%), Gaps = 12/222 (5%)

Query: 17  LSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDF 76
           L   L  I +      +A   I          + I  + NY                D  
Sbjct: 21  LKTGLADIADHFGFTGYAYLHIQH--------RHITAVTNYHRQWQSTYFDKKFEALDPV 72

Query: 77  LFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTS 136
           +    S      W    E   +    +            +GI  P++            S
Sbjct: 73  VKRARSRKHIFTWSGEHERPTLSKDERAFYDHASDFGIRSGITIPIKTANGFMSMFTMAS 132

Query: 137 EFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARN----LTERETSCLQLAGDGYTSE 192
           +  ++  +  I+A  A   +      +   R++        L  +E + L+    G T E
Sbjct: 133 DKPVIDLDREIDAVAAAATIGQIHARISFLRTTPTAEDAAWLDPKEATYLRWIAVGKTME 192

Query: 193 EIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           EIA+  G+  ++V   L  A  + D  ++    A AIR   I
Sbjct: 193 EIADVEGVKYNSVRVKLREAMKRFDVRSKAHLTALAIRRKLI 234


>gi|89068113|ref|ZP_01155530.1| autoinducer-binding transcriptional regulator LuxR [Oceanicola
           granulosus HTCC2516]
 gi|89046352|gb|EAR52409.1| autoinducer-binding transcriptional regulator LuxR [Oceanicola
           granulosus HTCC2516]
          Length = 228

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 39/217 (17%), Positives = 74/217 (34%), Gaps = 15/217 (6%)

Query: 24  IQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHFNSG 83
           +++R++ R+   + + +  +             Y        +       D  +      
Sbjct: 1   MRDRLRVRHCVYHWLRAEGEE-------YRCGTYSKHWRRRYDRRCYRRIDPVVIDGFRR 53

Query: 84  LLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLMLAN 143
             P+ W+ +        + +         +   G + P+R    +      T      A 
Sbjct: 54  FDPVDWKELDWSGKAARAYR--RDALDHGVGSQGFSIPLRGPNGQFALFSVTDTTSDAAW 111

Query: 144 EVI-----IEAHGACYQVITDFLELF-KKRSSAARNLTERETSCLQLAGDGYTSEEIAEK 197
                    +     + +    LEL      + +R+L+ RE   L     GY    +A+ 
Sbjct: 112 AEFTAARQPDLILVGHYLNRKALELAGPTLPAPSRSLSPREIEALTYLAQGYGRGRVADV 171

Query: 198 LGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           L +S HT+ AY+ SA  KL A N   A+A+A   G I
Sbjct: 172 LSISEHTLRAYIESARFKLGAANTTHAVARAAMEGLI 208


>gi|241518233|ref|YP_002978861.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240862646|gb|ACS60310.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 236

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 44/229 (19%), Positives = 76/229 (33%), Gaps = 12/229 (5%)

Query: 10  KSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILI 69
            +++   L   L  +        FA   +++A  F         +  Y  +   +     
Sbjct: 16  AAANEHSLKTALSDVARAHGFERFAYLNLHTAKSFA--------VSTYQKEWQSLYFSRS 67

Query: 70  ETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKN 129
               D  +           W +  E    +   +            +G++ P+  GF + 
Sbjct: 68  YMAIDPVVTAAKRLRRAFRWSADFERRRADDGIKEFYDTAAEFGIRSGLSIPIWTGFGQF 127

Query: 130 GYVIFTS-EFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARN---LTERETSCLQLA 185
             +   S   L  +    ++  GA          L    +   R     ++RE  CL+ A
Sbjct: 128 AILTLASARHLETSGPDDLDTVGAAGAAALIHARLQGTTTPTQRPDFIFSDREALCLRWA 187

Query: 186 GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
            +G     IA+  GL+ HTV   L     KL    + QA+A A RFG I
Sbjct: 188 AEGLPMHSIADVTGLTYHTVRWDLDRVKAKLGVYTQKQAVAVASRFGLI 236


>gi|190892823|ref|YP_001979365.1| transcriptional regulator protein, LuxR family [Rhizobium etli CIAT
           652]
 gi|190698102|gb|ACE92187.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli CIAT 652]
 gi|327189482|gb|EGE56638.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli CNPAF512]
          Length = 241

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 49/214 (22%), Positives = 77/214 (35%), Gaps = 2/214 (0%)

Query: 22  HLIQNRIKARNFALYTI-NSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHF 80
             +     A   A  T+ ++        + +    +         +      G  F    
Sbjct: 28  QALGRVATAFGLAHATLMHAPSPEDLLLKPLLIESSLPAAYVRDFDRANMMRGCPFGLRL 87

Query: 81  NSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLM 140
               +P+ W  + +    ++       L       AG+A P      +     F  E   
Sbjct: 88  RESAVPLAWH-LNDVVNGQAFPAELRALMLHHAIPAGVAMPTIAVDGRRLVFWFCGERAA 146

Query: 141 LANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGL 200
           L    + E        +  +  + +   SA   L+ RE   ++    G TS EI + L L
Sbjct: 147 LGQSEVNELAIIILHALDAYNTVRRNEESAHNALSARELEVVRWTAQGKTSIEIGQILTL 206

Query: 201 SVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           S HTVNAY+ +A  KLD VNR Q +AKAIR   I
Sbjct: 207 SDHTVNAYMTNAIKKLDCVNRTQLVAKAIRLKLI 240


>gi|86358681|ref|YP_470573.1| LuxR family transcriptional regulator [Rhizobium etli CFN 42]
 gi|86282783|gb|ABC91846.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli CFN 42]
          Length = 241

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 47/214 (21%), Positives = 77/214 (35%), Gaps = 2/214 (0%)

Query: 22  HLIQNRIKARNFALYTI-NSALDFPRRQQLICELHNYDLDSGDIPNILIETYGDDFLFHF 80
             +     A   +  T+ ++        + +    +         +      G  F    
Sbjct: 28  QGLGRVSAAFGLSYATLMHAPSPEDLLLKPLLIESSLPAAYVRDFDRANMMRGCPFGVRL 87

Query: 81  NSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIFTSEFLM 140
               +P+ W  + +    ++       L       AG+A P      +     F  E   
Sbjct: 88  RESAVPLAWH-LDDTVNGQAFPAELRALMLRHAIPAGVAMPTIAVDGRRLVFWFCGERAA 146

Query: 141 LANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGL 200
           L    + E        +  +  + +   +A   L+ RE   ++    G TS EI + L L
Sbjct: 147 LGQSEVNELAIVILHTLDAYNAVRRNEENAHSALSARELEVVRWTAQGKTSIEIGQILTL 206

Query: 201 SVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234
           S HTVNAY+ +A  KLD VNR Q +AKAIR   I
Sbjct: 207 SDHTVNAYMTNAIKKLDCVNRTQLVAKAIRLKLI 240


>gi|15596333|ref|NP_249827.1| transcriptional regulator [Pseudomonas aeruginosa PAO1]
 gi|107100589|ref|ZP_01364507.1| hypothetical protein PaerPA_01001614 [Pseudomonas aeruginosa PACS2]
 gi|254239506|ref|ZP_04932828.1| hypothetical protein PA2G_00120 [Pseudomonas aeruginosa 2192]
 gi|9947056|gb|AAG04525.1|AE004543_9 probable transcriptional regulator [Pseudomonas aeruginosa PAO1]
 gi|126192884|gb|EAZ56947.1| hypothetical protein PA2G_00120 [Pseudomonas aeruginosa 2192]
          Length = 243

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 49/234 (20%), Positives = 81/234 (34%), Gaps = 4/234 (1%)

Query: 1   MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFP-RRQQLICELHNYDL 59
           + ++    +K+++ + +   +     R+      + ++    D      +L     ++  
Sbjct: 8   LFDSVARLRKAATTEAVCREMVEFAARLGFDRVIVCSLFPRPDEDELIDELFFVHGDWAE 67

Query: 60  DSGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIA 119
                              H      P  W     E   E      VR    L    G+ 
Sbjct: 68  GRSAQERD-AYLLHCPVTRHILELDEPFFWSKSPSEDP-ERMTYRIVRGVRDLGQVNGMQ 125

Query: 120 FPVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSS-AARNLTERE 178
            PV       G V F  E L L     + A   C  +      L    S+  A+ L+ERE
Sbjct: 126 VPVFGRNGLEGAVSFAGERLDLNAGCKLAAQAFCPILFFALKRLRGPVSAGDAQALSERE 185

Query: 179 TSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFG 232
              LQ    G    E+A  L +S  TV  +L +A  +L A +  QA+A+A+R G
Sbjct: 186 REVLQWIALGKQQAEVAAILMISERTVENHLRAARRRLGAASTAQAVARALRLG 239


>gi|238786137|ref|ZP_04630091.1| Transcriptional activator protein echR [Yersinia bercovieri ATCC
           43970]
 gi|238712965|gb|EEQ05023.1| Transcriptional activator protein echR [Yersinia bercovieri ATCC
           43970]
          Length = 245

 Score =  119 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 38/236 (16%), Positives = 66/236 (27%), Gaps = 22/236 (9%)

Query: 15  QELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLDSGDIPNILIETYGD 74
           +++   +           ++   +N              + NY LD             D
Sbjct: 13  EDIKNYIQRRIKAYGDLRYSYLVMNKKTPL-----HPAIISNYPLDWIKEYKKNSYHLID 67

Query: 75  DFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAFPVRLGFHKNGYVIF 134
             +      + P  W         +S+      L        G  F +    H    +  
Sbjct: 68  PVILTAKDKVAPFAWDDNSV-INKKSTDSAVFNLAREYNIIN