HHsearch alignment for GI: 254780695 and conserved domain: PRK06007

>PRK06007 fliF flagellar MS-ring protein; Reviewed.
Probab=94.14  E-value=0.45  Score=26.23  Aligned_cols=73  Identities=14%  Similarity=0.260  Sum_probs=49.4

Q ss_pred             CHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHH-------HH----------------CCCCCEEECCC----
Q ss_conf             6789999999986406987889999999999999999999-------84----------------69982450389----
Q gi|254780695|r    2 AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARF-------FV----------------NSPHYDNLYVK----   54 (563)
Q Consensus         2 ~~~~~l~~~~~~~~~l~~~~ki~~~~~~~~~i~~~~~~~~-------~~----------------~~p~y~~L~~~----   54 (563)
T Consensus         7 ~~~~~~~~~~~~l~~~qki~l~~~~~~~i~~~~~l~~~~~~p~y~~L~~~l~~~da~~I~~~L~~~gI~Y~l~~~G~~I~   86 (540)
T PRK06007          7 ELMEKLLEFLKKLSKLRKIALIGAAAAVIAAIVALVLWASRPDYRVLYSNLSDQDAGQIVAALDQAGIPYKVSSDGGTIL   86 (540)
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEEECCCCCEEE
T ss_conf             99999999997069888999999999999999999984169972770289998999999999998799759769997799


Q ss_pred             CCHHHHHHHHHHHHHCCCCE
Q ss_conf             99899999999999779929
Q gi|254780695|r   55 LEVSDVNRISVALSEANIDF   74 (563)
Q Consensus        55 l~~~d~~~i~~~L~~~gI~y   74 (563)
T Consensus        87 Vp~~~v~~~Rl~LA~~Glp~  106 (540)
T PRK06007         87 VPEDKVDELRLKLASEGLPK  106 (540)
T ss_pred             ECHHHHHHHHHHHHHCCCCC
T ss_conf             76778999999999769999