Query         gi|254780695|ref|YP_003065108.1| flagellar MS-ring protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 563
No_of_seqs    144 out of 1037
Neff          8.2 
Searched_HMMs 23785
Date          Tue May 31 16:55:42 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780695.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1yj7_A ESCJ; mixed alpha/beta, 100.0 4.5E-44       0  310.8  16.1  160   49-215     3-167 (171)
  2 2hfv_A Hypothetical protein RP  96.3   0.012   5E-07   35.3   7.0   62   44-105    19-92  (97)
  3 1zhv_A Hypothetical protein AT  60.4     6.9 0.00029   16.9   4.4   43   60-102    79-123 (134)
  4 1mww_A Hypothetical protein HI  57.6     7.7 0.00033   16.6  10.5   85  127-211    14-101 (128)
  5 3fwt_A Macrophage migration in  53.5       9 0.00038   16.1   7.5   79  133-212    38-121 (133)
  6 1lxj_A YBL001C, hypothetical 1  52.2     9.4  0.0004   16.0   4.9   49   57-105    23-75  (104)
  7 3mb2_A 4-oxalocrotonate tautom  49.4      10 0.00044   15.7   4.7   35  175-210     4-42  (72)
  8 1lxn_A Hypothetical protein MT  48.1      11 0.00046   15.6   4.4   50   57-106    19-73  (99)
  9 2puj_A 2-hydroxy-6-OXO-6-pheny  46.1      11 0.00044   15.7   2.5   19  534-552   267-285 (286)
 10 2epi_A UPF0045 protein MJ1052;  45.3      12  0.0005   15.3   4.4   37   57-93     23-59  (100)
 11 2opa_A Probable tautomerase YW  43.5      13 0.00054   15.1   4.5   36  175-210     3-41  (61)
 12 1otf_A 4-oxalocrotonate tautom  43.2      13 0.00054   15.1   4.4   36  175-210     3-41  (62)
 13 1vk8_A Hypothetical protein TM  41.8      14 0.00057   15.0   5.0   47   58-104    33-82  (106)
 14 3bf7_A Esterase YBFF; thioeste  40.3      14  0.0006   14.8   2.5   19  534-552   236-254 (255)
 15 1y37_A Fluoroacetate dehalogen  39.0      15 0.00063   14.7   3.1   27  534-560   273-299 (304)
 16 2xcz_A Possible ATLS1-like lig  38.8      15 0.00063   14.7   7.3   76  134-210    18-98  (115)
 17 2hfk_A Pikromycin, type I poly  38.8      15 0.00063   14.7   2.8   19  534-552   292-310 (319)
 18 1yqh_A DUF77, IG hypothetical   37.8      16 0.00065   14.6   5.2   49   57-105    24-76  (109)
 19 3fob_A Bromoperoxidase; struct  36.5      16 0.00068   14.4   2.5   19  534-552   263-281 (281)
 20 2aj0_A Probable cadmium-transp  36.3      10 0.00043   15.8   1.2   22  137-158    19-40  (71)
 21 2xmw_A PACS-N, cation-transpor  36.1      17 0.00069   14.4   3.9   38  137-188    19-56  (71)
 22 2joi_A Hypothetical protein TA  32.5      19 0.00079   14.0   2.8   56  347-405    57-114 (118)
 23 2psd_A Renilla-luciferin 2-mon  32.4      19 0.00079   14.0   2.4   23  535-557   287-309 (318)
 24 2wkb_A Macrophage migration in  32.3      19  0.0008   14.0   6.4   76  134-210    18-98  (125)
 25 2ibo_A Hypothetical protein SP  32.3      19  0.0008   14.0   5.1   47   59-105    21-70  (104)
 26 2x4k_A 4-oxalocrotonate tautom  32.0      19 0.00081   14.0   4.3   36  175-210     6-44  (63)
 27 1iup_A META-cleavage product h  31.7      19 0.00081   13.9   2.4   20  535-554   255-274 (282)
 28 1r3d_A Conserved hypothetical   31.2      20 0.00083   13.9   2.5   19  534-552   243-261 (264)
 29 2os5_A Acemif; macrophage migr  31.1      20 0.00083   13.8   7.5   73  136-210    20-98  (119)
 30 1cpz_A Protein (COPZ); copper   31.0      18 0.00077   14.1   1.7   20  137-156    16-35  (68)
 31 2kkh_A Putative heavy metal tr  29.5      20 0.00084   13.8   1.7   20  137-156    32-51  (95)
 32 1mj5_A 1,3,4,6-tetrachloro-1,4  29.5      21 0.00089   13.7   2.3   19  534-552   274-292 (302)
 33 3kda_A CFTR inhibitory factor   28.9      22 0.00091   13.6   2.7   19  534-552   275-293 (301)
 34 1hkh_A Gamma lactamase; hydrol  28.8      22 0.00091   13.6   2.8   19  534-552   261-279 (279)
 35 2g9o_A Copper-transporting ATP  27.8      21 0.00087   13.7   1.6   20  137-156    19-38  (90)
 36 2cjp_A Epoxide hydrolase; HET:  27.6      23 0.00095   13.5   2.7   19  534-552   309-327 (328)
 37 3brc_A Conserved protein of un  26.5      24   0.001   13.3   2.1   42  206-252   111-152 (156)
 38 2j8s_A ACRB, acriflavine resis  26.3      24   0.001   13.3   8.3   18  135-152   158-175 (1055)
 39 2kog_A Vesicle-associated memb  26.3      24   0.001   13.3   4.2   31  381-411    38-68  (119)
 40 1uiz_A MIF, macrophage migrati  26.3      24   0.001   13.3   6.6   76  134-210    18-98  (115)
 41 2qif_A Copper chaperone COPZ;   26.1      24   0.001   13.3   1.7   20  137-156    18-37  (69)
 42 3nwo_A PIP, proline iminopepti  25.4      25   0.001   13.2   2.5   22  535-556   304-325 (330)
 43 1kez_A Erythronolide synthase;  25.0      13 0.00053   15.2   0.0   19  534-552   262-280 (300)
 44 2k2q_B Surfactin synthetase th  24.7      24   0.001   13.2   1.5   19  534-552   218-236 (242)
 45 1opz_A Potential copper-transp  24.3      26  0.0011   13.1   1.8   20  137-156    22-41  (76)
 46 3ej9_A Alpha-subunit of trans-  24.3      26  0.0011   13.1   4.4   36  175-210     4-42  (76)
 47 2d1s_A Luciferase, luciferin 4  24.1      26  0.0011   13.1   6.9   13  526-538   532-544 (548)
 48 3dxs_X Copper-transporting ATP  24.0      26  0.0011   13.0   1.8   43  137-193    18-62  (74)
 49 2qvb_A Haloalkane dehalogenase  23.9      26  0.0011   13.0   2.3   19  534-552   273-291 (297)
 50 1pg4_A Acetyl-COA synthetase;   23.8      27  0.0011   13.0   7.7   13  199-211   292-304 (652)
 51 3fwu_A Macrophage migration in  23.7      27  0.0011   13.0   8.4   79  133-212    38-121 (133)
 52 2wue_A 2-hydroxy-6-OXO-6-pheny  23.2      27  0.0011   12.9   1.8   19  534-552   271-289 (291)
 53 1mwy_A ZNTA; open-faced beta-s  23.1      27  0.0011   12.9   1.8   21  137-157    19-39  (73)
 54 1hfo_A Migration inhibitory fa  22.6      28  0.0012   12.9   6.7   73  138-210    21-97  (113)
 55 3i28_A Epoxide hydrolase 2; ar  22.5      28  0.0012   12.8   3.1   21  534-554   526-546 (555)
 56 1qlw_A Esterase; anisotropic r  22.5      28  0.0012   12.8   1.8   22  534-555   301-322 (328)
 57 3etc_A AMP-binding protein; ad  22.4      28  0.0012   12.8   7.9   57   43-102    67-136 (580)
 58 1kvi_A Copper-transporting ATP  21.7      29  0.0012   12.7   1.7   20  137-156    24-43  (79)
 59 3b64_A Macrophage migration in  21.5      29  0.0012   12.7   8.1   78  132-210    16-98  (112)
 60 2roe_A Heavy metal binding pro  21.5      28  0.0012   12.9   1.2   21  137-157    16-36  (66)
 61 2k2p_A Uncharacterized protein  21.4      30  0.0012   12.7   1.5   22  135-156    36-57  (85)
 62 1fvq_A Copper-transporting ATP  21.3      30  0.0012   12.7   2.5   20  137-156    18-37  (72)
 63 3m21_A Probable tautomerase HP  20.7      31  0.0013   12.6   4.8   30  181-210    12-44  (67)
 64 1q8l_A Copper-transporting ATP  20.5      31  0.0013   12.6   1.3   19  138-156    26-44  (84)
 65 3lcr_A Tautomycetin biosynthet  20.5      31  0.0013   12.6   2.2   22  534-555   283-304 (319)
 66 2i87_A D-alanine-D-alanine lig  20.1      32  0.0013   12.5   1.4   40   47-86      5-53  (364)

No 1  
>1yj7_A ESCJ; mixed alpha/beta, extended linker, protein transport; 1.80A {Escherichia coli}
Probab=100.00  E-value=4.5e-44  Score=310.82  Aligned_cols=160  Identities=18%  Similarity=0.276  Sum_probs=146.0

Q ss_pred             EEECCCCCHHHHHHHHHHHHHCCCCEEECCC---CCEEEECHHHHHHHHHHHHHCCCCCCCCCCHHH-HHCCCCCCCCCH
Q ss_conf             4503899989999999999977992999189---977995189999999999976998877663256-530588842599
Q gi|254780695|r   49 DNLYVKLEVSDVNRISVALSEANIDFRISDN---GSSISVPSSMVGKARIHLAAQGLPSSSSNSGYE-LFDKVNSFGLTS  124 (563)
Q Consensus        49 ~~L~~~l~~~d~~~i~~~L~~~gI~y~~~~~---g~~I~Vp~~~~~~~r~~La~~glp~~~~~~g~e-l~d~~~~~g~T~  124 (563)
                      ++||+||+++|+++|++.|+++||+|++..+   |.+|+||+++++++|+.||.+|||+.+. .||+ +|++ ++||+|+
T Consensus         3 ~~Ly~~L~~~da~~i~~~L~~~gI~y~~~~~~~gg~~I~V~~~~~~~a~~~La~~glP~~~~-~~~~~lf~~-~~~~~T~   80 (171)
T 1yj7_A            3 EQLYTGLTEKEANQMQALLLSNDVNVSKEMDKSGNMTLSVAAADFVRAITILNNNGFPKKKF-ADIEVIFPP-SQLVASP   80 (171)
T ss_dssp             EEEEEEECHHHHHHHHHHHHHTTCCCEEEECTTSCEEEEEEGGGHHHHHHHHHHTTCSCCCC-CCHHHHCC-------CH
T ss_pred             CHHHCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCEEEEECHHHHHHHHHHHHHCCCCCCCC-CCHHHHCCC-CCCCCCH
T ss_conf             61106999999999999999879985975179984799976888999999999728998888-889998158-9876799


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCCCCCCEEEEEECCCCCC-HHHHHHHHHHHHHHHHCCC
Q ss_conf             999999999999999999960576314899998336665555555871599970687789-8899999999986540188
Q gi|254780695|r  125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV-YKSAEAIRHLVAAAVPNLD  203 (563)
Q Consensus       125 ~~~~~~~~ralegeL~rtI~~~~~V~~ArV~l~~p~~~~f~~~~~~~sASV~l~~~~~l~-~~qv~~I~~lVa~sV~gL~  203 (563)
                      |+++++|+|||||||+|||++|++|++|||||++|++     ++.++||||+|+++++.. ..||.+|++|||+|||||+
T Consensus        81 ~~~~~~~~~ale~eL~~tI~~i~gV~~ArV~l~~P~~-----~~~~~tASV~l~~~~~~~l~~qv~~I~~LVa~sV~gL~  155 (171)
T 1yj7_A           81 SQENAKINYLKEQDIERLLSKIPGVIDCSVSLNVNNN-----ESQPSSAAVLVISSPEVNLAPSVIQIKNLVKNSVDDLK  155 (171)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTSTTEEEEEEEEEC------------CEEEEEEEECTTCCCGGGHHHHHHHHHHHSTTCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEECCCC-----CCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             9999999999999999999816570157999957988-----88985179999718998769999999999997269989


Q ss_pred             CCCEEEEECCCC
Q ss_conf             352699828983
Q gi|254780695|r  204 MGDVTVLDSTGK  215 (563)
Q Consensus       204 ~e~VtVvD~~G~  215 (563)
                      ++||||+|+.+.
T Consensus       156 ~e~VtVv~q~~~  167 (171)
T 1yj7_A          156 LENISVVIKSSS  167 (171)
T ss_dssp             GGGEEEEEEECC
T ss_pred             CCCEEEEECCCC
T ss_conf             113699974687


No 2  
>2hfv_A Hypothetical protein RPA1041; NESG, GFT-alpha+beta, structural genomics, PSI-2, protein structure initiative; NMR {Pseudomonas aeruginosa} SCOP: d.58.5.5
Probab=96.31  E-value=0.012  Score=35.31  Aligned_cols=62  Identities=19%  Similarity=0.206  Sum_probs=54.7

Q ss_pred             CCCCCEEECCCCCHHHHHHHHHHHHHCCCCEEECCC------------CCEEEECHHHHHHHHHHHHHCCCCCC
Q ss_conf             699824503899989999999999977992999189------------97799518999999999997699887
Q gi|254780695|r   44 NSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDN------------GSSISVPSSMVGKARIHLAAQGLPSS  105 (563)
Q Consensus        44 ~~p~y~~L~~~l~~~d~~~i~~~L~~~gI~y~~~~~------------g~~I~Vp~~~~~~~r~~La~~glp~~  105 (563)
                      +...|+.||..-++-.++-+.+.|+.+||++-+.+.            +..|+|+++|+.+||-.|..+|+|..
T Consensus        19 ~~~~MkeL~rTnD~V~is~~~aLL~~aGI~~~V~De~mS~leG~ig~~PrRimV~deD~~~Ar~IL~dag~~~~   92 (97)
T 2hfv_A           19 FQGHLRELLRTNDAVLLSAVGALLDGADIGHLVLDQNMSILEGSLGVIPRRVLVHEDDLAGARRLLTDAGLAHE   92 (97)
T ss_dssp             CCCSEEEEEEECCHHHHHHHHHHHHHTTCCEECCSCCCCSSSCCSSSSCEEEEEEGGGHHHHHHHHHHTTCCSS
T ss_pred             EEEEEEEEEECCCHHHHHHHHHHHHHCCCCEEEECCCHHHHCCCCCCCCEEEEECHHHHHHHHHHHHHCCCHHH
T ss_conf             35213555452899999999999976899879805400332345776647999836789999999997698042


No 3  
>1zhv_A Hypothetical protein ATU0741; NESG, ATR8, structural genomics, PSI, protein structure initiative; 1.50A {Agrobacterium tumefaciens str} SCOP: d.58.18.8 d.58.18.8
Probab=60.39  E-value=6.9  Score=16.88  Aligned_cols=43  Identities=26%  Similarity=0.258  Sum_probs=29.8

Q ss_pred             HHHHHHHHHHCCCCEEECC--CCCEEEECHHHHHHHHHHHHHCCC
Q ss_conf             9999999997799299918--997799518999999999997699
Q gi|254780695|r   60 VNRISVALSEANIDFRISD--NGSSISVPSSMVGKARIHLAAQGL  102 (563)
Q Consensus        60 ~~~i~~~L~~~gI~y~~~~--~g~~I~Vp~~~~~~~r~~La~~gl  102 (563)
                      .++|...|.++||+--.-.  +..-|+||+++..+|...|...|.
T Consensus        79 la~is~~LA~agIsif~iSty~tD~ilV~~~~~~~A~~~L~~~G~  123 (134)
T 1zhv_A           79 VLSVISPLSTNGIGIFVVSTFDGDHLLVRSNDLEKTADLLANAGH  123 (134)
T ss_dssp             HHHHHHHHHTTTCCCEEEECSSCEEEEEEGGGHHHHHHHHHHTTC
T ss_pred             HHHHHHHHHHCCCCEEEEEEECCCEEEEEHHHHHHHHHHHHHCCC
T ss_conf             999989998779965998754174799887899999999998899


No 4  
>1mww_A Hypothetical protein HI1388.1; structural genomics, structure 2 function project, S2F, unknown function; HET: GLU; 2.08A {Haemophilus influenzae} SCOP: d.80.1.4
Probab=57.59  E-value=7.7  Score=16.57  Aligned_cols=85  Identities=7%  Similarity=0.014  Sum_probs=50.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHH---HCCC
Q ss_conf             9999999999999999960576314899998336665555555871599970687789889999999998654---0188
Q gi|254780695|r  127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAV---PNLD  203 (563)
Q Consensus       127 ~~~~~~ralegeL~rtI~~~~~V~~ArV~l~~p~~~~f~~~~~~~sASV~l~~~~~l~~~qv~~I~~lVa~sV---~gL~  203 (563)
                      ++.....++..-|..++..=+.-..-+++=.-|++-.|..++...-+-|-++..+|++.+|-+.+..-++.++   -|..
T Consensus        14 ~k~~l~~~i~~al~~~l~~P~~d~~~i~~~~~~~~~~~~~~r~~~~~~I~I~~~~Grs~eqK~~L~~~it~~l~~~lgi~   93 (128)
T 1mww_A           14 RREKLAEVIYNSLHLGLDIPKGKHAIRFLCLEKEDFYYPFDRSDDYTVIEINLMAGRMEGTKKRLIKMLFSELEYKLGIR   93 (128)
T ss_dssp             HHHHHHHHHHHHHHHHHCCCTTSSCEEEEEECGGGEECCTTSCTTCEEEEEEEETTCCHHHHHHHHHHHHHHHHHHHCCC
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCEEECCCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99999999999999998849550799999717735876687779779999997689999999999999999999985949


Q ss_pred             CCCEEEEE
Q ss_conf             35269982
Q gi|254780695|r  204 MGDVTVLD  211 (563)
Q Consensus       204 ~e~VtVvD  211 (563)
                      +++|.|+=
T Consensus        94 ~~~v~I~i  101 (128)
T 1mww_A           94 AHDVEITI  101 (128)
T ss_dssp             GGGEEEEE
T ss_pred             CCEEEEEE
T ss_conf             48299999


No 5  
>3fwt_A Macrophage migration inhibitory factor-like protein; homotrimer, tautomerase, cytokine; 1.90A {Leishmania major}
Probab=53.54  E-value=9  Score=16.15  Aligned_cols=79  Identities=10%  Similarity=0.011  Sum_probs=51.2

Q ss_pred             HHHHHHHHHHHHHCCCCCEEEEEEEE-CCCCCCCCCCCCCCEEEEEECCCCCCHHH----HHHHHHHHHHHHHCCCCCCE
Q ss_conf             99999999999605763148999983-36665555555871599970687789889----99999999865401883526
Q gi|254780695|r  133 RALEGEIARTIQSISGIVAARVHIVM-PDMGSFRKIGARPTASVMIRAINPSVYKS----AEAIRHLVAAAVPNLDMGDV  207 (563)
Q Consensus       133 ralegeL~rtI~~~~~V~~ArV~l~~-p~~~~f~~~~~~~sASV~l~~~~~l~~~q----v~~I~~lVa~sV~gL~~e~V  207 (563)
                      ..|..+|.+.|..+-|-....|.+.+ |....++.....|.|-|.|+..+++++++    ...|..++..-. |+.+++|
T Consensus        38 ~~l~~~ls~~ia~~lgKpe~~imV~i~~~~~m~fgGs~eP~a~v~v~siG~~~~e~n~~~s~~i~~~l~~~L-gIp~~Ri  116 (133)
T 3fwt_A           38 ANLSAAYGMICREELGKPEDFVMTAFSDKTPISFQGSTAPAAYVRVESWGEYAPSKPKMMTPRIAAAITKEC-GIPAERI  116 (133)
T ss_dssp             HHHHHHHHHHHHHHHSCTTCCCEEEEECSCCCCBTTBCSSCEEEEEEEEECCCTHHHHHHHHHHHHHHHHHH-CCCGGGE
T ss_pred             HHHHHHHHHHHHHHHCCCHHHEEEEEECCCEEEECCCCCCEEEEEEEEECCCCHHHHHHHHHHHHHHHHHHC-CCCCCEE
T ss_conf             999999999999877989470999983795079658899759999999658997889999999999999973-9896849


Q ss_pred             EEEEC
Q ss_conf             99828
Q gi|254780695|r  208 TVLDS  212 (563)
Q Consensus       208 tVvD~  212 (563)
                      -|.-.
T Consensus       117 YI~f~  121 (133)
T 3fwt_A          117 YVFYY  121 (133)
T ss_dssp             EEEEE
T ss_pred             EEEEE
T ss_conf             99998


No 6  
>1lxj_A YBL001C, hypothetical 11.5KDA protein in HTB2-NTH2 intergenic region; hypothetical protein, structural genomics, PSI; 1.80A {Saccharomyces cerevisiae} SCOP: d.58.48.1
Probab=52.23  E-value=9.4  Score=16.01  Aligned_cols=49  Identities=16%  Similarity=0.093  Sum_probs=37.8

Q ss_pred             HHHHHHHHHHHHHCCCCEEECCCCCEEEECHHHHHH----HHHHHHHCCCCCC
Q ss_conf             899999999999779929991899779951899999----9999997699887
Q gi|254780695|r   57 VSDVNRISVALSEANIDFRISDNGSSISVPSSMVGK----ARIHLAAQGLPSS  105 (563)
Q Consensus        57 ~~d~~~i~~~L~~~gI~y~~~~~g~~I~Vp~~~~~~----~r~~La~~glp~~  105 (563)
                      ..-.++++..|++.|++|++.+-|++|--+-+++..    +.-.+...|.+.-
T Consensus        23 s~yVa~~i~~i~~sGl~y~~~pmgT~IEGe~dev~~~v~~~~e~~~~~G~~RV   75 (104)
T 1lxj_A           23 SDFVALIEKKIRESPLKSTLHSAGTTIEGPWDDVMGLIGEIHEYGHEKGYVRV   75 (104)
T ss_dssp             HHHHHHHHHHHHTSSSEEEEETTEEEEEEEHHHHHHHHHHHHHHHHHTTCCEE
T ss_pred             HHHHHHHHHHHHHCCCCEEECCCCCEEECCHHHHHHHHHHHHHHHHHCCCCEE
T ss_conf             99999999999975997676698357977899999999999999997699859


No 7  
>3mb2_A 4-oxalocrotonate tautomerase family enzyme - ALPH; trans-3-chloroacrylic acid dehalogenase, CAAD, dehalogenase, hydrolase; 2.41A {Chloroflexus aurantiacus j-10-fl}
Probab=49.37  E-value=10  Score=15.72  Aligned_cols=35  Identities=20%  Similarity=0.324  Sum_probs=20.3

Q ss_pred             EEEECCCCCCHHH----HHHHHHHHHHHHHCCCCCCEEEE
Q ss_conf             9970687789889----99999999865401883526998
Q gi|254780695|r  175 VMIRAINPSVYKS----AEAIRHLVAAAVPNLDMGDVTVL  210 (563)
Q Consensus       175 V~l~~~~~l~~~q----v~~I~~lVa~sV~gL~~e~VtVv  210 (563)
                      |.+++..|+|.+|    +++|...++... |.++++|.|+
T Consensus         4 I~I~~~~Grs~EqK~~Li~~iT~a~~~~~-g~~~e~V~V~   42 (72)
T 3mb2_A            4 LRITMLEGRSTEQKAELARALSAAAAAAF-DVPLAEVRLI   42 (72)
T ss_dssp             EEEEEESCCCHHHHHHHHHHHHHHHHHHH-TCCGGGEEEE
T ss_pred             EEEEEECCCCHHHHHHHHHHHHHHHHCCC-CCCHHHEEEE
T ss_conf             99998379999999999999874300224-9994587999


No 8  
>1lxn_A Hypothetical protein MTH1187; hypothetical structure, structural genomics, PSI, protein structure initiative; 2.30A {Methanothermobacterthermautotrophicus} SCOP: d.58.48.1
Probab=48.08  E-value=11  Score=15.59  Aligned_cols=50  Identities=20%  Similarity=0.167  Sum_probs=38.5

Q ss_pred             HHHHHHHHHHHHHCCCCEEECCCCCEEEEC-HHHHHH----HHHHHHHCCCCCCC
Q ss_conf             899999999999779929991899779951-899999----99999976998877
Q gi|254780695|r   57 VSDVNRISVALSEANIDFRISDNGSSISVP-SSMVGK----ARIHLAAQGLPSSS  106 (563)
Q Consensus        57 ~~d~~~i~~~L~~~gI~y~~~~~g~~I~Vp-~~~~~~----~r~~La~~glp~~~  106 (563)
                      ....++++..|++.|++|++.+-|++|--+ =+++..    +.-.+...|.+.-.
T Consensus        19 s~yVa~~i~~i~~sgl~y~~~pmgT~IEge~~dev~~~ik~~~e~~~~~G~~RV~   73 (99)
T 1lxn_A           19 SSYVAAAVEALKKLNVRYEISGMGTLLEAEDLDELMEAVKAAHEAVLQAGSDRVY   73 (99)
T ss_dssp             HHHHHHHHHHHTTSSCEEEEETTEEEEEESSHHHHHHHHHHHHHHHHHTTCSEEE
T ss_pred             HHHHHHHHHHHHHCCCCEEECCCCCEEECCCHHHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             9999999999997599837468841797797999999999999999976998699


No 9  
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase; C-C bond hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans LB400} PDB: 2pu7_A* 2puh_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A
Probab=46.08  E-value=11  Score=15.67  Aligned_cols=19  Identities=11%  Similarity=0.242  Sum_probs=16.2

Q ss_pred             HHHHCHHHHHHHHHHHHHH
Q ss_conf             9886999899999999863
Q gi|254780695|r  534 MIEINEERFAKILRKWARS  552 (563)
Q Consensus       534 lv~e~Pe~vA~vLR~WL~e  552 (563)
                      +--++|++++++|+.||++
T Consensus       267 ~~~e~p~~~~~~i~~FLk~  285 (286)
T 2puj_A          267 AQWEHADEFNRLVIDFLRH  285 (286)
T ss_dssp             HHHHTHHHHHHHHHHHHHH
T ss_pred             HHHHCHHHHHHHHHHHHHC
T ss_conf             6886999999999999857


No 10 
>2epi_A UPF0045 protein MJ1052; NPPSFA, national project on protein structural and functional analyses; 1.70A {Methanocaldococcus jannaschii DSM2661} PDB: 2eky_A
Probab=45.31  E-value=12  Score=15.31  Aligned_cols=37  Identities=11%  Similarity=0.097  Sum_probs=30.5

Q ss_pred             HHHHHHHHHHHHHCCCCEEECCCCCEEEECHHHHHHH
Q ss_conf             8999999999997799299918997799518999999
Q gi|254780695|r   57 VSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKA   93 (563)
Q Consensus        57 ~~d~~~i~~~L~~~gI~y~~~~~g~~I~Vp~~~~~~~   93 (563)
                      ....++++..|++.|++|++.+-|++|.-+-+++-++
T Consensus        23 s~yVa~~i~~i~~sGl~y~~~pmgT~IEG~~dev~~~   59 (100)
T 2epi_A           23 SKYVKKAIEVFKKYDLKVETNAMGTVLEGDLDEILKA   59 (100)
T ss_dssp             HHHHHHHHHHHTTSSCEEEEETTEEEEEEEHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCCEECCCCCCEEECCHHHHHHH
T ss_conf             9999999999997599727079815786689999999


No 11 
>2opa_A Probable tautomerase YWHB; homohexamer, 4-oxalocrotonate tautomerase, inhibitor, 2- fluoro-P-hydroxycinnamate, isomerase; HET: FHC; 2.40A {Bacillus subtilis} PDB: 2op8_A*
Probab=43.50  E-value=13  Score=15.13  Aligned_cols=36  Identities=14%  Similarity=0.215  Sum_probs=20.1

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHH---HCCCCCCEEEE
Q ss_conf             9970687789889999999998654---01883526998
Q gi|254780695|r  175 VMIRAINPSVYKSAEAIRHLVAAAV---PNLDMGDVTVL  210 (563)
Q Consensus       175 V~l~~~~~l~~~qv~~I~~lVa~sV---~gL~~e~VtVv  210 (563)
                      |.+++.+|+|.+|-+.+..-++.++   -|..+++|.|+
T Consensus         3 I~i~~~~Grs~EqK~~L~~~it~~~~~~~g~~~e~v~V~   41 (61)
T 2opa_A            3 VTVKMLEGRTDEQKRNLVEKVTEAVKETTGASEEKIVVF   41 (61)
T ss_dssp             EEEEEESCCCHHHHHHHHHHHHHHHHHHHCCCGGGCEEE
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEE
T ss_conf             999982899999999999999999999849591339999


No 12 
>1otf_A 4-oxalocrotonate tautomerase; isomerase; 1.90A {Pseudomonas SP} SCOP: d.80.1.1 PDB: 4otc_A 4ota_A 4otb_A 1bjp_A 2fm7_A
Probab=43.17  E-value=13  Score=15.10  Aligned_cols=36  Identities=19%  Similarity=0.215  Sum_probs=18.5

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHH---HCCCCCCEEEE
Q ss_conf             9970687789889999999998654---01883526998
Q gi|254780695|r  175 VMIRAINPSVYKSAEAIRHLVAAAV---PNLDMGDVTVL  210 (563)
Q Consensus       175 V~l~~~~~l~~~qv~~I~~lVa~sV---~gL~~e~VtVv  210 (563)
                      |.+++.+|+|.+|-+.+..-++.++   -|..+++|.|+
T Consensus         3 I~I~l~~Grs~eqK~~L~~~it~~~~~~lg~~~e~v~V~   41 (62)
T 1otf_A            3 AQLYIIEGRTDEQKETLIRQVSEAMANSLDAPLERVRVL   41 (62)
T ss_dssp             EEEEEESCCCHHHHHHHHHHHHHHHHHHHTCCGGGCEEE
T ss_pred             EEEEEECCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEE
T ss_conf             999980899999999999999999999849593069999


No 13 
>1vk8_A Hypothetical protein TM0486; protein with possible role in cell WALL biogenesis, structural genomics, JCSG, PSI, protein structure initiative; HET: UNL; 1.80A {Thermotoga maritima} SCOP: d.58.48.1
Probab=41.83  E-value=14  Score=14.96  Aligned_cols=47  Identities=6%  Similarity=0.038  Sum_probs=32.8

Q ss_pred             HHHHHHHHHHHHCCCCEEECCCCCEEEECHHHHHHHHHH---HHHCCCCC
Q ss_conf             999999999997799299918997799518999999999---99769988
Q gi|254780695|r   58 SDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIH---LAAQGLPS  104 (563)
Q Consensus        58 ~d~~~i~~~L~~~gI~y~~~~~g~~I~Vp~~~~~~~r~~---La~~glp~  104 (563)
                      .-...++..|++.|++|++.+-|++|.-+-+++-.+--.   +...|.+.
T Consensus        33 ~~V~~ai~vI~~sGl~y~v~pmgT~IEGe~dev~~~vk~~~e~~~~g~~R   82 (106)
T 1vk8_A           33 EVIDRAIEKISSWGMKYEVGPSNTTVEGEFEEIMDRVKELARYLEQFAKR   82 (106)
T ss_dssp             HHHHHHHHHHHTTCSCEEECSSCEEEEECHHHHHHHHHHHHHHHTTTCSE
T ss_pred             HHHHHHHHHHHHCCCCEEECCCCCEEECCHHHHHHHHHHHHHHHHCCCCE
T ss_conf             99999999999749974866980289778999999999999999869987


No 14 
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A
Probab=40.31  E-value=14  Score=14.81  Aligned_cols=19  Identities=5%  Similarity=0.244  Sum_probs=16.3

Q ss_pred             HHHHCHHHHHHHHHHHHHH
Q ss_conf             9886999899999999863
Q gi|254780695|r  534 MIEINEERFAKILRKWARS  552 (563)
Q Consensus       534 lv~e~Pe~vA~vLR~WL~e  552 (563)
                      +-.|+|++++++|+.||++
T Consensus       236 ~~~e~p~~~~~~i~~FL~~  254 (255)
T 3bf7_A          236 VHAEKPDAVLRAIRRYLND  254 (255)
T ss_dssp             HHHHCHHHHHHHHHHHHHT
T ss_pred             HHHHCHHHHHHHHHHHHHH
T ss_conf             1896999999999999972


No 15 
>1y37_A Fluoroacetate dehalogenase; hydrolase; 1.50A {Burkholderia SP}
Probab=39.02  E-value=15  Score=14.68  Aligned_cols=27  Identities=15%  Similarity=0.207  Sum_probs=21.6

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             988699989999999986378635421
Q gi|254780695|r  534 MIEINEERFAKILRKWARSEIEDRYTQ  560 (563)
Q Consensus       534 lv~e~Pe~vA~vLR~WL~ee~~~~~~~  560 (563)
                      +..|+|++++++|+.||++-....+..
T Consensus       273 ~~~e~P~~~~~~i~~FL~~~~~~~~~~  299 (304)
T 1y37_A          273 FVDRFPDDTARILREFLSDARSGIHQT  299 (304)
T ss_dssp             HHHHCHHHHHHHHHHHHHHHHC-----
T ss_pred             HHHHCHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             488699999999999998622557987


No 16 
>2xcz_A Possible ATLS1-like light-inducible protein; cytokine, tautomerase, immune system, cyanobacterium; 1.64A {Prochlorococcus marinus}
Probab=38.79  E-value=15  Score=14.66  Aligned_cols=76  Identities=12%  Similarity=0.102  Sum_probs=49.5

Q ss_pred             HHHHHHHHHHHHCCCCCEEEEEEEE-CCCCCCCCCCCCCCEEEEEECCCCCCHHH----HHHHHHHHHHHHHCCCCCCEE
Q ss_conf             9999999999605763148999983-36665555555871599970687789889----999999998654018835269
Q gi|254780695|r  134 ALEGEIARTIQSISGIVAARVHIVM-PDMGSFRKIGARPTASVMIRAINPSVYKS----AEAIRHLVAAAVPNLDMGDVT  208 (563)
Q Consensus       134 alegeL~rtI~~~~~V~~ArV~l~~-p~~~~f~~~~~~~sASV~l~~~~~l~~~q----v~~I~~lVa~sV~gL~~e~Vt  208 (563)
                      .+..+|.+.+..+-+-...+|.+.+ +.....+....+|.|-+.++.-+++++++    .++|..++..-. |+.++++-
T Consensus        18 ~~~~~~s~~~a~~lgKp~~~i~V~v~~~~~m~~ggs~~p~a~~~v~sig~~~~e~n~~~~~~i~~~l~~~L-gi~~~riy   96 (115)
T 2xcz_A           18 SLLQELSSKLAELLGKPEKYVMTSLQCGVPMTFSGNTEPTCYVEVKSIGALDGSRTQEVSELVCGHIEQNL-GIPADRIY   96 (115)
T ss_dssp             HHHHHHHHHHHHHHTCCGGGCEEEEECSCCCCBTTBCSSCEEEEEEESSCCCTTHHHHHHHHHHHHHHHHH-CCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCCHHHEEEEEECCCCEEEECCCCCEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHH-CCCCCEEE
T ss_conf             99999999999987969899999984598458717899369999999748890568999999999999984-95957699


Q ss_pred             EE
Q ss_conf             98
Q gi|254780695|r  209 VL  210 (563)
Q Consensus       209 Vv  210 (563)
                      |.
T Consensus        97 i~   98 (115)
T 2xcz_A           97 IG   98 (115)
T ss_dssp             EE
T ss_pred             EE
T ss_conf             99


No 17 
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A
Probab=38.78  E-value=15  Score=14.66  Aligned_cols=19  Identities=16%  Similarity=0.351  Sum_probs=16.9

Q ss_pred             HHHHCHHHHHHHHHHHHHH
Q ss_conf             9886999899999999863
Q gi|254780695|r  534 MIEINEERFAKILRKWARS  552 (563)
Q Consensus       534 lv~e~Pe~vA~vLR~WL~e  552 (563)
                      |.+++++.+|.+|+.||..
T Consensus       292 ml~e~~~~~A~~v~~wL~~  310 (319)
T 2hfk_A          292 MMRDHAPAVAEAVLSWLDA  310 (319)
T ss_dssp             HHHTCHHHHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHHHH
T ss_conf             2013899999999999984


No 18 
>1yqh_A DUF77, IG hypothetical 16092; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.70A {Bacillus cereus atcc 14579} SCOP: d.58.48.1
Probab=37.83  E-value=16  Score=14.56  Aligned_cols=49  Identities=6%  Similarity=0.118  Sum_probs=37.0

Q ss_pred             HHHHHHHHHHHHHCCCCEEECCCCCEEEECHHHHHHH----HHHHHHCCCCCC
Q ss_conf             8999999999997799299918997799518999999----999997699887
Q gi|254780695|r   57 VSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKA----RIHLAAQGLPSS  105 (563)
Q Consensus        57 ~~d~~~i~~~L~~~gI~y~~~~~g~~I~Vp~~~~~~~----r~~La~~glp~~  105 (563)
                      ..-..+++..|++.|++|++.+-|++|.=+-+++-++    .-.+...|.+.-
T Consensus        24 s~~V~~aI~~i~~sGl~y~v~pmgT~IEGe~dev~~~v~~~~e~~~~~G~~RV   76 (109)
T 1yqh_A           24 YSVVDKAIEVVQQSGVRYEVGAMETTLEGELDVLLDVVKRAQQACVDAGAEEV   76 (109)
T ss_dssp             HHHHHHHHHHHHHSCSEEEECSSCEEEEECHHHHHHHHHHHHHHHHHTTCSEE
T ss_pred             HHHHHHHHHHHHHCCCCEEECCCCCEEECCHHHHHHHHHHHHHHHHHCCCCEE
T ss_conf             99999999999974997486588037976899999999999999997699869


No 19 
>3fob_A Bromoperoxidase; structural genomics, IDP00046, oxidoreductase, center for structural genomics of infectious diseases, csgid; 1.74A {Bacillus anthracis str}
Probab=36.47  E-value=16  Score=14.42  Aligned_cols=19  Identities=11%  Similarity=0.258  Sum_probs=16.3

Q ss_pred             HHHHCHHHHHHHHHHHHHH
Q ss_conf             9886999899999999863
Q gi|254780695|r  534 MIEINEERFAKILRKWARS  552 (563)
Q Consensus       534 lv~e~Pe~vA~vLR~WL~e  552 (563)
                      +-.++|+++++.|+.||+|
T Consensus       263 ~~~e~p~~~~~~i~~FL~e  281 (281)
T 3fob_A          263 LNATHAKEFNEALLLFLKD  281 (281)
T ss_dssp             HHHHTHHHHHHHHHHHHCC
T ss_pred             HHHHCHHHHHHHHHHHHCC
T ss_conf             3886999999999998585


No 20 
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A
Probab=36.33  E-value=10  Score=15.77  Aligned_cols=22  Identities=23%  Similarity=0.428  Sum_probs=16.9

Q ss_pred             HHHHHHHHHCCCCCEEEEEEEE
Q ss_conf             9999999605763148999983
Q gi|254780695|r  137 GEIARTIQSISGIVAARVHIVM  158 (563)
Q Consensus       137 geL~rtI~~~~~V~~ArV~l~~  158 (563)
                      .-+++.|..++||.+++|++.-
T Consensus        19 ~~Ie~~l~~~~GV~~v~V~~~~   40 (71)
T 2aj0_A           19 AKFERNVKEIEGVTEAIVNFGA   40 (71)
T ss_dssp             HHHHHHHHHSTTEEEEEECCSS
T ss_pred             HHHHHHHHCCCCCEEEEEECCC
T ss_conf             9999998269994599998989


No 21 
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A
Probab=36.09  E-value=17  Score=14.38  Aligned_cols=38  Identities=13%  Similarity=0.267  Sum_probs=23.9

Q ss_pred             HHHHHHHHHCCCCCEEEEEEEECCCCCCCCCCCCCCEEEEEECCCCCCHHHH
Q ss_conf             9999999605763148999983366655555558715999706877898899
Q gi|254780695|r  137 GEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSA  188 (563)
Q Consensus       137 geL~rtI~~~~~V~~ArV~l~~p~~~~f~~~~~~~sASV~l~~~~~l~~~qv  188 (563)
                      .-+++.|..++||.+++|.+.              +-.+.++..+..+.+++
T Consensus        19 ~~i~~~l~~~~gV~~v~v~~~--------------~~~~~v~~~~~~~~~~i   56 (71)
T 2xmw_A           19 SSIERAIAKVPGVQSCQVNFA--------------LEQAVVSYHGETTPQIL   56 (71)
T ss_dssp             HHHHHHHHTSTTEEEEEEETT--------------TTEEEEEEC---CHHHH
T ss_pred             HHHHHHHHCCCCCEEEEEECC--------------CCEEEEEECCCCCHHHH
T ss_conf             999999871899169999887--------------99999999999999999


No 22 
>2joi_A Hypothetical protein TA0095; structural genomics, COG4004 orthologous group, structural genomics consortium, SGC, unknown function; NMR {Thermoplasma acidophilum}
Probab=32.52  E-value=19  Score=14.01  Aligned_cols=56  Identities=14%  Similarity=0.166  Sum_probs=30.8

Q ss_pred             EEECCCCCCCCEEEEECCCCC-CCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCC-CCCCE
Q ss_conf             970785100102565305432-456665555334698999999998643125661-13876
Q gi|254780695|r  347 TTHDNYKLERLSIAVVVNKGR-LTEVLGRSADQGKIDSYLAEINKIVSAATGINS-RRGDT  405 (563)
Q Consensus       347 ~~~~~G~I~rlSVAV~Vn~~~-~~~~~g~~~~~~~~~eel~~I~~lV~~AiG~d~-~RGD~  405 (563)
                      ..-.-|.+++|.|-+  +++. ..+.... .......+-+..+++..-.|.||++ +|+|.
T Consensus        57 f~~SyGal~~Ie~~~--e~kkL~Vdt~sd-~~~~d~l~t~Kr~~~FLe~aTGYtAKER~kk  114 (118)
T 2joi_A           57 IIASIPGISRIEIKP--DKRKILVNTGDY-DSDADKLAVVRTYNDFIEKLTGYSAKERKKM  114 (118)
T ss_dssp             EEEECTTBSCEEEEE--CSSCEEEEECCB-CTTSCHHHHHHHHHHHHHHHHCCCGGGHHHH
T ss_pred             EEEEECCEEEEEEEE--CCCEEEEEEECC-CCCCCHHHHHHHHHHHHHHHHCCCHHHHHHH
T ss_conf             999734647999998--894799995447-8854509999999999998728788998877


No 23 
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A
Probab=32.43  E-value=19  Score=14.00  Aligned_cols=23  Identities=9%  Similarity=0.277  Sum_probs=18.3

Q ss_pred             HHHCHHHHHHHHHHHHHHHHHHH
Q ss_conf             88699989999999986378635
Q gi|254780695|r  535 IEINEERFAKILRKWARSEIEDR  557 (563)
Q Consensus       535 v~e~Pe~vA~vLR~WL~ee~~~~  557 (563)
                      -.|+|+++++.|++||+.-.++-
T Consensus       287 ~~e~Pe~~~~~I~~FL~~~~~~~  309 (318)
T 2psd_A          287 QEDAPDEMGKYIKSFVERVLKNE  309 (318)
T ss_dssp             GGTCHHHHHHHHHHHHHHHHC--
T ss_pred             HHHCHHHHHHHHHHHHHHHCCCC
T ss_conf             78699999999999998752767


No 24 
>2wkb_A Macrophage migration inhibitory factor; cytokine; HET: CME; 1.78A {Plasmodium berghei} PDB: 3gad_A 3gac_A 2wkf_A*
Probab=32.32  E-value=19  Score=13.99  Aligned_cols=76  Identities=14%  Similarity=0.026  Sum_probs=43.6

Q ss_pred             HHHHHHHHHHHHCCCCCEEEEEEEE-CCCCCCCCCCCCCCEEEEEECCCCCCHHH----HHHHHHHHHHHHHCCCCCCEE
Q ss_conf             9999999999605763148999983-36665555555871599970687789889----999999998654018835269
Q gi|254780695|r  134 ALEGEIARTIQSISGIVAARVHIVM-PDMGSFRKIGARPTASVMIRAINPSVYKS----AEAIRHLVAAAVPNLDMGDVT  208 (563)
Q Consensus       134 alegeL~rtI~~~~~V~~ArV~l~~-p~~~~f~~~~~~~sASV~l~~~~~l~~~q----v~~I~~lVa~sV~gL~~e~Vt  208 (563)
                      .+..++.+.+..+-|--..+|.+.+ |....+......|.|-|.|+.-+++++++    ...|..++.. .=|+.+++|-
T Consensus        18 ~~~~~~s~~la~~lgKpe~~vmV~i~~~~~m~fgGs~~P~a~v~i~sig~l~~~~n~~~s~~i~~~l~~-~LgI~~~Riy   96 (125)
T 2wkb_A           18 NTLSEIEDAISNILGKPVAYIMSNYDYQKNLRFSGSNEGYCFVRLTSIGGINRSNNSLLADKITKILSN-HLSVKPRRVY   96 (125)
T ss_dssp             HHHHHHHHHHHHHHCSCCTTCEEEEEECTTCEETTBCSSCEEEEEECC-----CTHHHHHHHHHHHHHH-HHCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCCHHHEEEEEECCCCEEECCCCCCEEEEEEEEECCCCHHHHHHHHHHHHHHHHH-HCCCCCCCEE
T ss_conf             999999999999979497999999956854897488997699999994188846789999999999999-7198902289


Q ss_pred             EE
Q ss_conf             98
Q gi|254780695|r  209 VL  210 (563)
Q Consensus       209 Vv  210 (563)
                      |.
T Consensus        97 I~   98 (125)
T 2wkb_A           97 IE   98 (125)
T ss_dssp             EE
T ss_pred             EE
T ss_conf             99


No 25 
>2ibo_A Hypothetical protein SP2199; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.80A {Streptococcus pneumoniae TIGR4} SCOP: d.58.48.1
Probab=32.25  E-value=19  Score=13.98  Aligned_cols=47  Identities=6%  Similarity=0.051  Sum_probs=33.3

Q ss_pred             HHHHHHHHHHHCCCCEEECCCCCEEEECHHHHHHHHHH---HHHCCCCCC
Q ss_conf             99999999997799299918997799518999999999---997699887
Q gi|254780695|r   59 DVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIH---LAAQGLPSS  105 (563)
Q Consensus        59 d~~~i~~~L~~~gI~y~~~~~g~~I~Vp~~~~~~~r~~---La~~glp~~  105 (563)
                      -..++++.|++.|+.|++.+-|++|.-+-+++-++--.   .+.+|-+.-
T Consensus        21 ~V~~~I~~i~~sGl~~~~~pm~T~IEGe~d~vm~~vk~~~e~~~~g~~RV   70 (104)
T 2ibo_A           21 VIDQVIAYLQTQEVTMVVTPFETVLEGEFDELMRILKEALEVAGQEADNV   70 (104)
T ss_dssp             HHHHHHHHHHHSSSEEEECSSCEEEEEEHHHHHHHHHHHHHHHHTSCSCE
T ss_pred             HHHHHHHHHHHCCCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEE
T ss_conf             99999999997499679768865032789999999999999997799879


No 26 
>2x4k_A 4-oxalocrotonate tautomerase; isomerase; 1.10A {Staphylococcus aureus}
Probab=31.99  E-value=19  Score=13.95  Aligned_cols=36  Identities=14%  Similarity=0.176  Sum_probs=19.7

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHH---HCCCCCCEEEE
Q ss_conf             9970687789889999999998654---01883526998
Q gi|254780695|r  175 VMIRAINPSVYKSAEAIRHLVAAAV---PNLDMGDVTVL  210 (563)
Q Consensus       175 V~l~~~~~l~~~qv~~I~~lVa~sV---~gL~~e~VtVv  210 (563)
                      |.+++.+|+|.+|-+.+..-|..++   -|..+++|.|+
T Consensus         6 I~I~~~~Grs~eqK~~l~~~it~~~~~~lg~p~e~v~V~   44 (63)
T 2x4k_A            6 VNVKLLEGRSDEQLKNLVSEVTDAVEKTTGANRQAIHVV   44 (63)
T ss_dssp             EEEEEESCCCHHHHHHHHHHHHHHHHHHHCCCGGGCEEE
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEE
T ss_conf             999985899999999999999999999849490529999


No 27 
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A
Probab=31.71  E-value=19  Score=13.92  Aligned_cols=20  Identities=10%  Similarity=0.217  Sum_probs=16.8

Q ss_pred             HHHCHHHHHHHHHHHHHHHH
Q ss_conf             88699989999999986378
Q gi|254780695|r  535 IEINEERFAKILRKWARSEI  554 (563)
Q Consensus       535 v~e~Pe~vA~vLR~WL~ee~  554 (563)
                      --++|+++++.|+.||++-.
T Consensus       255 ~~e~p~~~~~~i~~FL~~~~  274 (282)
T 1iup_A          255 QIEQTDRFNRLVVEFFNEAN  274 (282)
T ss_dssp             HHHSHHHHHHHHHHHHHTC-
T ss_pred             HHHCHHHHHHHHHHHHHCCC
T ss_conf             89699999999999970058


No 28 
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35
Probab=31.21  E-value=20  Score=13.87  Aligned_cols=19  Identities=26%  Similarity=0.333  Sum_probs=16.7

Q ss_pred             HHHHCHHHHHHHHHHHHHH
Q ss_conf             9886999899999999863
Q gi|254780695|r  534 MIEINEERFAKILRKWARS  552 (563)
Q Consensus       534 lv~e~Pe~vA~vLR~WL~e  552 (563)
                      .--|+|+++++.|+.||++
T Consensus       243 ~~~e~P~~~~~~i~~fl~~  261 (264)
T 1r3d_A          243 VHHEQPQAFAKIVQAMIHS  261 (264)
T ss_dssp             HHHHCHHHHHHHHHHHHHH
T ss_pred             HHHHCHHHHHHHHHHHHHH
T ss_conf             3897999999999999986


No 29 
>2os5_A Acemif; macrophage migration inhibitory factor, cytokine, nematode, hookworm; 1.60A {Ancylostoma ceylanicum}
Probab=31.05  E-value=20  Score=13.85  Aligned_cols=73  Identities=10%  Similarity=0.150  Sum_probs=43.8

Q ss_pred             HHHHHHHHHHCC--CCCEEEEEEEECCCCCCCCCCCCCCEEEEEECCCCCCHHH----HHHHHHHHHHHHHCCCCCCEEE
Q ss_conf             999999996057--6314899998336665555555871599970687789889----9999999986540188352699
Q gi|254780695|r  136 EGEIARTIQSIS--GIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKS----AEAIRHLVAAAVPNLDMGDVTV  209 (563)
Q Consensus       136 egeL~rtI~~~~--~V~~ArV~l~~p~~~~f~~~~~~~sASV~l~~~~~l~~~q----v~~I~~lVa~sV~gL~~e~VtV  209 (563)
                      ..+|.+.+..+-  ..+..-||+. |....+.-....|.|-+.|+.-+++++++    ...|..++.... |+.+++|-|
T Consensus        20 ~~~ls~~~a~~lgKpe~~v~V~i~-~~~~m~fggs~~p~a~~~i~sig~~~~~~n~~~s~~i~~~l~~~L-gi~~~riyI   97 (119)
T 2os5_A           20 EERLTDLLAESMNKPRNRIAIEVL-AGQRITHGASRNPVAVIKVESIGALSADDNIRHTQKITQFCQDTL-KLPKDKVII   97 (119)
T ss_dssp             HHHHHHHHHHHHTCCGGGCEEEEE-CSCCCCBTTBCSSCEEEEEEESSCCCHHHHHHHHHHHHHHHHHHH-CCCGGGEEE
T ss_pred             HHHHHHHHHHHHCCCHHHEEEEEE-CCCCEEECCCCCCEEEEEEEEECCCCHHHHHHHHHHHHHHHHHHH-CCCCCEEEE
T ss_conf             999999999987969899799984-895179448999879999999538997898999999999999973-979575999


Q ss_pred             E
Q ss_conf             8
Q gi|254780695|r  210 L  210 (563)
Q Consensus       210 v  210 (563)
                      .
T Consensus        98 ~   98 (119)
T 2os5_A           98 T   98 (119)
T ss_dssp             E
T ss_pred             E
T ss_conf             9


No 30 
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1
Probab=30.97  E-value=18  Score=14.09  Aligned_cols=20  Identities=25%  Similarity=0.531  Sum_probs=15.9

Q ss_pred             HHHHHHHHHCCCCCEEEEEE
Q ss_conf             99999996057631489999
Q gi|254780695|r  137 GEIARTIQSISGIVAARVHI  156 (563)
Q Consensus       137 geL~rtI~~~~~V~~ArV~l  156 (563)
                      .-+++.|+.++||.+++|++
T Consensus        16 ~~Ie~~l~~~~GV~~v~v~~   35 (68)
T 1cpz_A           16 ARIEEAVGRISGVKKVKVQL   35 (68)
T ss_dssp             HHHHHHHHTSTTEEEEEEET
T ss_pred             HHHHHHHHCCCCCEEEEEEC
T ss_conf             99999997299946999999


No 31 
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana}
Probab=29.54  E-value=20  Score=13.82  Aligned_cols=20  Identities=20%  Similarity=0.320  Sum_probs=13.8

Q ss_pred             HHHHHHHHHCCCCCEEEEEE
Q ss_conf             99999996057631489999
Q gi|254780695|r  137 GEIARTIQSISGIVAARVHI  156 (563)
Q Consensus       137 geL~rtI~~~~~V~~ArV~l  156 (563)
                      .-+++.|..++||.+++|.|
T Consensus        32 ~~Ie~~L~~~~GV~~v~Vnl   51 (95)
T 2kkh_A           32 PIIENILKSLDGVKEYSVIV   51 (95)
T ss_dssp             HHHHHHHHHSSSEEEEEEET
T ss_pred             HHHHHHHHCCCCCEEEEEEC
T ss_conf             99999985699963889987


No 32 
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A
Probab=29.46  E-value=21  Score=13.67  Aligned_cols=19  Identities=11%  Similarity=0.251  Sum_probs=16.2

Q ss_pred             HHHHCHHHHHHHHHHHHHH
Q ss_conf             9886999899999999863
Q gi|254780695|r  534 MIEINEERFAKILRKWARS  552 (563)
Q Consensus       534 lv~e~Pe~vA~vLR~WL~e  552 (563)
                      +-.|+|++++++|+.||+.
T Consensus       274 ~~~e~P~~~~~~i~~Fl~~  292 (302)
T 1mj5_A          274 IQEDSPDEIGAAIAAFVRR  292 (302)
T ss_dssp             GGGTCHHHHHHHHHHHHHH
T ss_pred             HHHHCHHHHHHHHHHHHHC
T ss_conf             1897999999999999850


No 33 
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A
Probab=28.94  E-value=22  Score=13.62  Aligned_cols=19  Identities=5%  Similarity=0.127  Sum_probs=16.2

Q ss_pred             HHHHCHHHHHHHHHHHHHH
Q ss_conf             9886999899999999863
Q gi|254780695|r  534 MIEINEERFAKILRKWARS  552 (563)
Q Consensus       534 lv~e~Pe~vA~vLR~WL~e  552 (563)
                      +-.|+|++++++|++||+.
T Consensus       275 ~~~e~P~~~~~~i~~FL~~  293 (301)
T 3kda_A          275 LPEECAAPMNRLVIDFLSR  293 (301)
T ss_dssp             HHHHTHHHHHHHHHHHHTT
T ss_pred             HHHHCHHHHHHHHHHHHHC
T ss_conf             6997999999999999966


No 34 
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A*
Probab=28.78  E-value=22  Score=13.60  Aligned_cols=19  Identities=5%  Similarity=0.218  Sum_probs=16.0

Q ss_pred             HHHHCHHHHHHHHHHHHHH
Q ss_conf             9886999899999999863
Q gi|254780695|r  534 MIEINEERFAKILRKWARS  552 (563)
Q Consensus       534 lv~e~Pe~vA~vLR~WL~e  552 (563)
                      +.-++|+++++.|+.||++
T Consensus       261 ~~~e~p~~v~~~i~~FL~k  279 (279)
T 1hkh_A          261 LLWTHADEVNAALKTFLAK  279 (279)
T ss_dssp             HHHHTHHHHHHHHHHHHHC
T ss_pred             HHHHCHHHHHHHHHHHHCC
T ss_conf             5886999999999999784


No 35 
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A
Probab=27.83  E-value=21  Score=13.72  Aligned_cols=20  Identities=15%  Similarity=0.287  Sum_probs=16.0

Q ss_pred             HHHHHHHHHCCCCCEEEEEE
Q ss_conf             99999996057631489999
Q gi|254780695|r  137 GEIARTIQSISGIVAARVHI  156 (563)
Q Consensus       137 geL~rtI~~~~~V~~ArV~l  156 (563)
                      .-+++.|..++||.+++|.|
T Consensus        19 ~~Ie~~L~~~~GV~~v~V~l   38 (90)
T 2g9o_A           19 SNIESTLSALQYVSSIVVSL   38 (90)
T ss_dssp             HHHHHHHTTCTTEEEEEEET
T ss_pred             HHHHHHHHCCCCCEEEEEEC
T ss_conf             99999985589946999998


No 36 
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A*
Probab=27.65  E-value=23  Score=13.47  Aligned_cols=19  Identities=5%  Similarity=0.149  Sum_probs=16.2

Q ss_pred             HHHHCHHHHHHHHHHHHHH
Q ss_conf             9886999899999999863
Q gi|254780695|r  534 MIEINEERFAKILRKWARS  552 (563)
Q Consensus       534 lv~e~Pe~vA~vLR~WL~e  552 (563)
                      +..|+||++++.|+.||++
T Consensus       309 ~~~e~Pe~v~~~i~~FL~~  327 (328)
T 2cjp_A          309 VSQERPHEISKHIYDFIQK  327 (328)
T ss_dssp             HHHHSHHHHHHHHHHHHTT
T ss_pred             HHHHCHHHHHHHHHHHHHC
T ss_conf             2886999999999999843


No 37 
>3brc_A Conserved protein of unknown function; methanobacterium thermoautotrophicum, structural genomics, MCSG, PSI-2; 1.60A {Methanothermobacterthermautotrophicus str}
Probab=26.46  E-value=24  Score=13.33  Aligned_cols=42  Identities=19%  Similarity=0.387  Sum_probs=21.1

Q ss_pred             CEEEEECCCCEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             26998289835003676533324799999999999999999887754
Q gi|254780695|r  206 DVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAF  252 (563)
Q Consensus       206 ~VtVvD~~G~~L~~~~~~~~~~~~~~~~~~~~E~~~~~kI~~~L~~i  252 (563)
                      =-.++|..|++|+..-+.+..-.     ++.+|...+......|..+
T Consensus       111 mLvimD~kgRiLTaslSPs~viH-----k~~ie~~v~~E~~eAL~Ri  152 (156)
T 3brc_A          111 LLVIMDSRGRLLSAAMSPPHVIH-----SMEVREAVRSEMTHALERI  152 (156)
T ss_dssp             EEEEEETTSCEEEEEEECCTTTS-----CCCHHHHHHHHHHHHHHTT
T ss_pred             EEEEECCCCCEEEECCCCHHHHH-----HCCHHHHHHHHHHHHHHHH
T ss_conf             79998388767751379306542-----1448999999999999983


No 38 
>2j8s_A ACRB, acriflavine resistance protein B; membrane protein/complex, designed ankyrin repeat protein, multidrug resistance protein; HET: LMT LMU; 2.54A {Escherichia coli} PDB: 2dhh_A 1iwg_A 2dr6_A* 2drd_A* 2hqf_A 2hqg_A 2hqd_A 2hqc_A 2i6w_A 1oy6_A* 1oy9_A* 1oyd_A* 1oy8_A* 1oye_A 2rdd_A* 2w1b_A* 3d9b_A 1t9x_A* 1t9t_A* 1t9v_A* ...
Probab=26.35  E-value=24  Score=13.32  Aligned_cols=18  Identities=17%  Similarity=0.324  Sum_probs=8.6

Q ss_pred             HHHHHHHHHHHCCCCCEE
Q ss_conf             999999999605763148
Q gi|254780695|r  135 LEGEIARTIQSISGIVAA  152 (563)
Q Consensus       135 legeL~rtI~~~~~V~~A  152 (563)
                      ...+|.+-|++++||.++
T Consensus       158 ~~~~l~~~l~~i~gV~~v  175 (1055)
T 2j8s_A          158 VAANMKDAISRTSGVGDV  175 (1055)
T ss_dssp             HHHHTHHHHHTSTTEEEE
T ss_pred             HHHHHHHHHHCCCCEEEE
T ss_conf             999999997179994799


No 39 
>2kog_A Vesicle-associated membrane protein 2; synaptobrevin, VAMP2, DPC micelle, snare, coiled coil, membrane fusion, transmembrane; NMR {Rattus norvegicus}
Probab=26.32  E-value=24  Score=13.31  Aligned_cols=31  Identities=10%  Similarity=0.100  Sum_probs=17.5

Q ss_pred             CHHHHHHHHHHHHHHCCCCCCCCCEEEEEEC
Q ss_conf             9899999999864312566113876899850
Q gi|254780695|r  381 IDSYLAEINKIVSAATGINSRRGDTITITSM  411 (563)
Q Consensus       381 ~~eel~~I~~lV~~AiG~d~~RGD~VtV~~~  411 (563)
                      ..+++++++++...-+.-=-+||+.+.....
T Consensus        38 i~~qv~ev~~iM~~Ni~kvleRgekLe~L~~   68 (119)
T 2kog_A           38 TQAQVDEVVDIMRVNVDKVLERDQKLSELDD   68 (119)
T ss_dssp             SSHHHHHHHHHHHHHHHHHHCCCCSSCCCCS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999999980137999999


No 40 
>1uiz_A MIF, macrophage migration inhibitory factor; cytokine, tautomerase; 2.50A {Xenopus laevis} SCOP: d.80.1.3
Probab=26.30  E-value=24  Score=13.31  Aligned_cols=76  Identities=14%  Similarity=0.167  Sum_probs=45.6

Q ss_pred             HHHHHHHHHHHHCCCCCEEEEEEEE-CCCCCCCCCCCCCCEEEEEECCCCCCHHH----HHHHHHHHHHHHHCCCCCCEE
Q ss_conf             9999999999605763148999983-36665555555871599970687789889----999999998654018835269
Q gi|254780695|r  134 ALEGEIARTIQSISGIVAARVHIVM-PDMGSFRKIGARPTASVMIRAINPSVYKS----AEAIRHLVAAAVPNLDMGDVT  208 (563)
Q Consensus       134 alegeL~rtI~~~~~V~~ArV~l~~-p~~~~f~~~~~~~sASV~l~~~~~l~~~q----v~~I~~lVa~sV~gL~~e~Vt  208 (563)
                      .+..+|.+.|..+-|=....|.+.+ |....+......|.|-|.|+.-+++++++    ...|..++..-. |+.+++|-
T Consensus        18 ~~~~~ls~~ia~~lgKpe~~vmV~v~~~~~m~fggs~~P~a~~~v~sig~~~~e~n~~~s~~i~~~l~~~L-gI~~~Riy   96 (115)
T 1uiz_A           18 TLLSDLTKQLAKATGKPAEYIAIHIVPDQIMSFGDSTDPCAVCSLCSIGKIGGPQNKSYTKLLCDILTKQL-NIPANRVY   96 (115)
T ss_dssp             THHHHHHHHHHHHHTCCGGGCEEEEECSCEEEETTBCSSCEEEEEEESSCCSHHHHHHHHHHHHHHHHHHH-CCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCCHHHEEEEECCCCEEEECCCCCCEEEEEEEEECCCCHHHHHHHHHHHHHHHHHHC-CCCCCEEE
T ss_conf             99999999999986999799899973894289658899679999999768896777999999999999970-98936499


Q ss_pred             EE
Q ss_conf             98
Q gi|254780695|r  209 VL  210 (563)
Q Consensus       209 Vv  210 (563)
                      |.
T Consensus        97 i~   98 (115)
T 1uiz_A           97 IN   98 (115)
T ss_dssp             EE
T ss_pred             EE
T ss_conf             99


No 41 
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A
Probab=26.06  E-value=24  Score=13.28  Aligned_cols=20  Identities=15%  Similarity=0.469  Sum_probs=15.9

Q ss_pred             HHHHHHHHHCCCCCEEEEEE
Q ss_conf             99999996057631489999
Q gi|254780695|r  137 GEIARTIQSISGIVAARVHI  156 (563)
Q Consensus       137 geL~rtI~~~~~V~~ArV~l  156 (563)
                      .-+++.|..++||.+++|.+
T Consensus        18 ~~Ie~~l~~~~gV~~v~v~~   37 (69)
T 2qif_A           18 KAVETSVGELDGVSAVHVNL   37 (69)
T ss_dssp             HHHHHHHHTSTTEEEEEEET
T ss_pred             HHHHHHHHHCCCCEEEEEEC
T ss_conf             99999998099946999988


No 42 
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis}
Probab=25.37  E-value=25  Score=13.20  Aligned_cols=22  Identities=9%  Similarity=0.080  Sum_probs=17.7

Q ss_pred             HHHCHHHHHHHHHHHHHHHHHH
Q ss_conf             8869998999999998637863
Q gi|254780695|r  535 IEINEERFAKILRKWARSEIED  556 (563)
Q Consensus       535 v~e~Pe~vA~vLR~WL~ee~~~  556 (563)
                      .-|+|+++++.|+.||.+-...
T Consensus       304 ~~e~p~~~~~~i~~fL~~~d~~  325 (330)
T 3nwo_A          304 HLEKPEEFRAVVAQFLHQHDLA  325 (330)
T ss_dssp             HHHSHHHHHHHHHHHHHHHHHH
T ss_pred             HHHCHHHHHHHHHHHHHHCCCC
T ss_conf             8869999999999998645875


No 43 
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A
Probab=24.96  E-value=13  Score=15.16  Aligned_cols=19  Identities=16%  Similarity=0.494  Sum_probs=16.5

Q ss_pred             HHHHCHHHHHHHHHHHHHH
Q ss_conf             9886999899999999863
Q gi|254780695|r  534 MIEINEERFAKILRKWARS  552 (563)
Q Consensus       534 lv~e~Pe~vA~vLR~WL~e  552 (563)
                      |++++|+.+|.+|+.||..
T Consensus       262 ml~e~~~~~A~~v~~wL~~  280 (300)
T 1kez_A          262 MVQEHADAIARHIDAWLGG  280 (300)
T ss_dssp             SSSSCSHHHHHHHHHHHTC
T ss_pred             HHCCCHHHHHHHHHHHHCC
T ss_conf             3105999999999999708


No 44 
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A
Probab=24.66  E-value=24  Score=13.25  Aligned_cols=19  Identities=11%  Similarity=0.045  Sum_probs=16.0

Q ss_pred             HHHHCHHHHHHHHHHHHHH
Q ss_conf             9886999899999999863
Q gi|254780695|r  534 MIEINEERFAKILRKWARS  552 (563)
Q Consensus       534 lv~e~Pe~vA~vLR~WL~e  552 (563)
                      +..++|+++|+.|+.||++
T Consensus       218 ~~~e~p~~v~~~I~~fL~~  236 (242)
T 2k2q_B          218 FLLSQTEEVAERIFAILNQ  236 (242)
T ss_dssp             HHHHHCHHHHHHHHHHHHT
T ss_pred             CHHHCHHHHHHHHHHHHHH
T ss_conf             8556999999999999965


No 45 
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A
Probab=24.32  E-value=26  Score=13.07  Aligned_cols=20  Identities=20%  Similarity=0.551  Sum_probs=15.8

Q ss_pred             HHHHHHHHHCCCCCEEEEEE
Q ss_conf             99999996057631489999
Q gi|254780695|r  137 GEIARTIQSISGIVAARVHI  156 (563)
Q Consensus       137 geL~rtI~~~~~V~~ArV~l  156 (563)
                      .-+++.+..++||.+++|.+
T Consensus        22 ~~Ie~~l~~~~gV~~v~v~~   41 (76)
T 1opz_A           22 ARIEKGLKRMPGVTDANVNL   41 (76)
T ss_dssp             HHHHHHHHTSTTEEEEEEEG
T ss_pred             HHHHHHHHCCCCCEEEEEEC
T ss_conf             99999997199937999988


No 46 
>3ej9_A Alpha-subunit of trans-3-chloroacrylic acid dehalogenase; CAAD, isomerase, hydrolase; 1.50A {Pseudomonas pavonaceae} PDB: 3ej3_A 1s0y_A 3ej7_A
Probab=24.29  E-value=26  Score=13.07  Aligned_cols=36  Identities=3%  Similarity=-0.070  Sum_probs=18.2

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHH---HHCCCCCCEEEE
Q ss_conf             997068778988999999999865---401883526998
Q gi|254780695|r  175 VMIRAINPSVYKSAEAIRHLVAAA---VPNLDMGDVTVL  210 (563)
Q Consensus       175 V~l~~~~~l~~~qv~~I~~lVa~s---V~gL~~e~VtVv  210 (563)
                      |.+++.+|++.+|-+.+..-+..+   +-|..+++|.|+
T Consensus         4 I~i~l~~Grs~eqK~~L~~~lt~~~~~~lg~p~e~v~V~   42 (76)
T 3ej9_A            4 ISCDMRYGRTDEQKRALSAGLLRVISEATGEPRENIFFV   42 (76)
T ss_dssp             EEEEEETTCCHHHHHHHHHHHHHHHHHHHCCCGGGCEEE
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEE
T ss_conf             999983899999999999999999999839292519999


No 47 
>2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A*
Probab=24.15  E-value=26  Score=13.05  Aligned_cols=13  Identities=0%  Similarity=0.013  Sum_probs=8.4

Q ss_pred             HHHHHHHHHHHHC
Q ss_conf             8999999998869
Q gi|254780695|r  526 QSDLRLLHMIEIN  538 (563)
Q Consensus       526 ~~~~~i~~lv~e~  538 (563)
                      ..+.+++++++++
T Consensus       532 i~r~~lr~~~~~~  544 (548)
T 2d1s_A          532 IDGRAIREILKKP  544 (548)
T ss_dssp             BCHHHHHHHHHSC
T ss_pred             HHHHHHHHHHHHH
T ss_conf             5399999999999


No 48 
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana}
Probab=24.01  E-value=26  Score=13.03  Aligned_cols=43  Identities=12%  Similarity=0.179  Sum_probs=27.0

Q ss_pred             HHHHHHHHHCCCCCEEEEEEEECCCCCCCCCCCCCCEEEEEECCCC-CCHHHH-HHHHH
Q ss_conf             9999999605763148999983366655555558715999706877-898899-99999
Q gi|254780695|r  137 GEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP-SVYKSA-EAIRH  193 (563)
Q Consensus       137 geL~rtI~~~~~V~~ArV~l~~p~~~~f~~~~~~~sASV~l~~~~~-l~~~qv-~~I~~  193 (563)
                      .-+++.+..++||++++|++.              +-.|.++..+. .+.+++ ++|..
T Consensus        18 ~~Ie~~l~~~~gV~~v~v~~~--------------~~~v~v~~d~~~~~~~~i~~~i~~   62 (74)
T 3dxs_X           18 NSVEAALMNVNGVFKASVALL--------------QNRADVVFDPNLVKEEDIKEEIED   62 (74)
T ss_dssp             HHHHHHHHTSTTEEEEEEEGG--------------GTEEEEEECTTTCCHHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCEEEEEECC--------------CCEEEEEECCCCCCHHHHHHHHHH
T ss_conf             999999971999379999887--------------999999999998999999999996


No 49 
>2qvb_A Haloalkane dehalogenase 3; alpha-beta hydrolase protein, X-RAY crystallography, TB structural genomics consortium, TBSGC; 1.19A {Mycobacterium tuberculosis H37RV} PDB: 2o2i_A 2o2h_A
Probab=23.88  E-value=26  Score=13.02  Aligned_cols=19  Identities=16%  Similarity=0.284  Sum_probs=16.2

Q ss_pred             HHHHCHHHHHHHHHHHHHH
Q ss_conf             9886999899999999863
Q gi|254780695|r  534 MIEINEERFAKILRKWARS  552 (563)
Q Consensus       534 lv~e~Pe~vA~vLR~WL~e  552 (563)
                      +..|+|+++++.|+.||+.
T Consensus       273 ~~~e~P~~~~~~i~~fl~~  291 (297)
T 2qvb_A          273 VQEDSPEEIGAAIAQFVRR  291 (297)
T ss_dssp             GGGTCHHHHHHHHHHHHHH
T ss_pred             HHHHCHHHHHHHHHHHHHH
T ss_conf             0797999999999999974


No 50 
>1pg4_A Acetyl-COA synthetase; AMP-forming, adenylate-forming, thioester-forming, ligase; HET: COA PRX; 1.75A {Salmonella enterica} SCOP: e.23.1.1 PDB: 1pg3_A* 2p2f_A* 2p2b_A* 2p2q_A* 2p2j_A* 2p20_A* 2p2m_A*
Probab=23.83  E-value=27  Score=13.01  Aligned_cols=13  Identities=23%  Similarity=0.212  Sum_probs=7.4

Q ss_pred             HHCCCCCCEEEEE
Q ss_conf             4018835269982
Q gi|254780695|r  199 VPNLDMGDVTVLD  211 (563)
Q Consensus       199 V~gL~~e~VtVvD  211 (563)
                      ..++.+.++...-
T Consensus       292 ~~~~~~~d~~~~~  304 (652)
T 1pg4_A          292 VFDYHPGDIYWCT  304 (652)
T ss_dssp             HTTCCTTCEEEEC
T ss_pred             HHCCCCCCEEEEE
T ss_conf             6098988789992


No 51 
>3fwu_A Macrophage migration inhibitory factor-like protein; homotrimer, tautomerase, cytokine; 1.80A {Leishmania major}
Probab=23.67  E-value=27  Score=12.99  Aligned_cols=79  Identities=11%  Similarity=0.051  Sum_probs=50.8

Q ss_pred             HHHHHHHHHHHHHCCCCCEEEEEEEE-CCCCCCCCCCCCCCEEEEEECCCCCCHHH----HHHHHHHHHHHHHCCCCCCE
Q ss_conf             99999999999605763148999983-36665555555871599970687789889----99999999865401883526
Q gi|254780695|r  133 RALEGEIARTIQSISGIVAARVHIVM-PDMGSFRKIGARPTASVMIRAINPSVYKS----AEAIRHLVAAAVPNLDMGDV  207 (563)
Q Consensus       133 ralegeL~rtI~~~~~V~~ArV~l~~-p~~~~f~~~~~~~sASV~l~~~~~l~~~q----v~~I~~lVa~sV~gL~~e~V  207 (563)
                      .+|-.+|.+.|..+-|=...+|.+.+ |....++.....|.|-|.|+.-+++++++    ...|..++..-. |+.+++|
T Consensus        38 ~~L~~~ls~~ia~ilGKpe~~vmV~v~~~~~m~fgGs~~P~a~vev~siG~~~~~~n~~~s~~i~~~l~~~L-gIp~~Ri  116 (133)
T 3fwu_A           38 ENLAQVYRAVTRDVLGKPEDLVMMTFHDSTPMHFFGSTDPVACVRVEALGGYGPSEPEKVTSIVTAAITKEC-GIVADRI  116 (133)
T ss_dssp             HHHHHHHHHHHHHTSCSCGGGCEEEEECSCCCCBTTBCSSCEEEEEECTTCCCTTHHHHHHHHHHHHHHHHH-CCCGGGE
T ss_pred             HHHHHHHHHHHHHHHCCCHHHEEEEEECCCCEEECCCCCCCEEEEEEEECCCCHHHHHHHHHHHHHHHHHHC-CCCCCEE
T ss_conf             999999999999986999799899971794179678899618999999668897899999999999999973-9896739


Q ss_pred             EEEEC
Q ss_conf             99828
Q gi|254780695|r  208 TVLDS  212 (563)
Q Consensus       208 tVvD~  212 (563)
                      -|...
T Consensus       117 yI~f~  121 (133)
T 3fwu_A          117 FVLYF  121 (133)
T ss_dssp             EEEEE
T ss_pred             EEEEE
T ss_conf             99998


No 52 
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A
Probab=23.16  E-value=27  Score=12.93  Aligned_cols=19  Identities=11%  Similarity=0.127  Sum_probs=16.2

Q ss_pred             HHHHCHHHHHHHHHHHHHH
Q ss_conf             9886999899999999863
Q gi|254780695|r  534 MIEINEERFAKILRKWARS  552 (563)
Q Consensus       534 lv~e~Pe~vA~vLR~WL~e  552 (563)
                      +-.++|++++++|+.||+.
T Consensus       271 ~~~e~p~~~~~~i~~FL~~  289 (291)
T 2wue_A          271 VQVEKFDEFNKLTIEFLGG  289 (291)
T ss_dssp             HHHHTHHHHHHHHHHHTTC
T ss_pred             HHHHCHHHHHHHHHHHHCC
T ss_conf             4896999999999999727


No 53 
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A
Probab=23.13  E-value=27  Score=12.92  Aligned_cols=21  Identities=10%  Similarity=0.389  Sum_probs=16.2

Q ss_pred             HHHHHHHHHCCCCCEEEEEEE
Q ss_conf             999999960576314899998
Q gi|254780695|r  137 GEIARTIQSISGIVAARVHIV  157 (563)
Q Consensus       137 geL~rtI~~~~~V~~ArV~l~  157 (563)
                      .-+++.|..++||+++.|.|.
T Consensus        19 ~~Ie~~l~~~~GV~~~~v~~~   39 (73)
T 1mwy_A           19 RKVENAVRQLAGVNQVQVLFA   39 (73)
T ss_dssp             HHHHHHHHTSSSEEEEEEETT
T ss_pred             HHHHHHHHCCCCCEEEEEECC
T ss_conf             999999866999308999898


No 54 
>1hfo_A Migration inhibitory factor; tautomerase; 1.65A {Trichinella spiralis} SCOP: d.80.1.3
Probab=22.64  E-value=28  Score=12.86  Aligned_cols=73  Identities=8%  Similarity=-0.023  Sum_probs=40.5

Q ss_pred             HHHHHHHHCCCCCEEEEEEEE-CCCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHH---CCCCCCEEEE
Q ss_conf             999999605763148999983-366655555558715999706877898899999999986540---1883526998
Q gi|254780695|r  138 EIARTIQSISGIVAARVHIVM-PDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVP---NLDMGDVTVL  210 (563)
Q Consensus       138 eL~rtI~~~~~V~~ArV~l~~-p~~~~f~~~~~~~sASV~l~~~~~l~~~qv~~I~~lVa~sV~---gL~~e~VtVv  210 (563)
                      +|.+.|..+-+=-...|...+ +...++......|.|-|.|+.-+++++++-+.+...+..-+.   |+.+++|-|.
T Consensus        21 ~~s~~la~~lgKpe~~vmV~v~~~~~m~fgGs~~P~a~v~l~siG~l~~~~n~~~s~~l~~~l~~~LgI~~~RiyI~   97 (113)
T 1hfo_A           21 STSALVGNILSKPGSYVAVHINTDQQLSFGGSTNPAAFGTLMSIGGIEPSRNRDHSAKLFDHLNTKLGIPKNRMYIH   97 (113)
T ss_dssp             HHHHHHHHHHTCCGGGCEEEEECSCEEEETTBCSSCEEEEEEESSSCSHHHHHHHHHHHHHHHHHHHCCCGGGEEEE
T ss_pred             HHHHHHHHHHCCCHHHEEEEECCCCCEEECCCCCCEEEEEEEEECCCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             99999999979898998999808974797698997799999995589978869999999999999849791649999


No 55 
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, cytoplasm, detoxification, magnesium, metal-binding, peroxisome, polymorphism; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A*
Probab=22.54  E-value=28  Score=12.85  Aligned_cols=21  Identities=24%  Similarity=0.306  Sum_probs=17.8

Q ss_pred             HHHHCHHHHHHHHHHHHHHHH
Q ss_conf             988699989999999986378
Q gi|254780695|r  534 MIEINEERFAKILRKWARSEI  554 (563)
Q Consensus       534 lv~e~Pe~vA~vLR~WL~ee~  554 (563)
                      +..|+|++++..|+.||.++.
T Consensus       526 ~~~E~P~~v~~~i~~FL~~~~  546 (555)
T 3i28_A          526 TQMDKPTEVNQILIKWLDSDA  546 (555)
T ss_dssp             HHHHSHHHHHHHHHHHHHHHT
T ss_pred             HHHHCHHHHHHHHHHHHHCCC
T ss_conf             488599999999999985579


No 56 
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A*
Probab=22.52  E-value=28  Score=12.85  Aligned_cols=22  Identities=18%  Similarity=0.388  Sum_probs=17.7

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHH
Q ss_conf             9886999899999999863786
Q gi|254780695|r  534 MIEINEERFAKILRKWARSEIE  555 (563)
Q Consensus       534 lv~e~Pe~vA~vLR~WL~ee~~  555 (563)
                      |.+++.+++|.+|.+||.+...
T Consensus       301 ~~e~~~~~va~~i~~wL~~~~~  322 (328)
T 1qlw_A          301 MQDRNNLQVADLILDWIGRNTA  322 (328)
T ss_dssp             GGSTTHHHHHHHHHHHHHHTCC
T ss_pred             CCCCCHHHHHHHHHHHHHHHCC
T ss_conf             2681999999999999997466


No 57 
>3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans}
Probab=22.43  E-value=28  Score=12.83  Aligned_cols=57  Identities=12%  Similarity=0.106  Sum_probs=25.2

Q ss_pred             HCCCCCEEEC-C-------CCCHHH----HHHHHHHHHHCCCCEEECCCCCEEEECHH-HHHHHHHHHHHCCC
Q ss_conf             4699824503-8-------999899----99999999977992999189977995189-99999999997699
Q gi|254780695|r   43 VNSPHYDNLY-V-------KLEVSD----VNRISVALSEANIDFRISDNGSSISVPSS-MVGKARIHLAAQGL  102 (563)
Q Consensus        43 ~~~p~y~~L~-~-------~l~~~d----~~~i~~~L~~~gI~y~~~~~g~~I~Vp~~-~~~~~r~~La~~gl  102 (563)
                      ...|+-..|. .       .++-.+    +..+...|.+.||.   ..+--.|+.|.. +..-+-+.+...|.
T Consensus        67 ~~~Pd~~Al~~~d~~g~~~~lTY~eL~~~~~~lA~~L~~~Gv~---~Gd~V~i~~~ns~e~vv~~lA~~~~Ga  136 (580)
T 3etc_A           67 RDSPEKLAMIWCDDYGNEKIFTFKDLKYYSDKAANFFVKHGIG---KGDYVMLTLKSRYDFWYCMLGLHKLGA  136 (580)
T ss_dssp             HHCTTCEEEEEEESSSCEEEEEHHHHHHHHHHHHHHHHHTTCC---TTCEEEEECTTCTHHHHHHHHHHHHTC
T ss_pred             HHCCCCEEEEEECCCCCEEEEEHHHHHHHHHHHHHHHHHCCCC---CCCEEEEEECCCHHHHHHHHHHHHHCC
T ss_conf             7589986999874899867871999999999999999974969---979999990898999999999998594


No 58 
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A
Probab=21.68  E-value=29  Score=12.74  Aligned_cols=20  Identities=20%  Similarity=0.390  Sum_probs=15.7

Q ss_pred             HHHHHHHHHCCCCCEEEEEE
Q ss_conf             99999996057631489999
Q gi|254780695|r  137 GEIARTIQSISGIVAARVHI  156 (563)
Q Consensus       137 geL~rtI~~~~~V~~ArV~l  156 (563)
                      .-+++.|..++||.+++|.+
T Consensus        24 ~~Ie~~l~~~~gV~~v~v~~   43 (79)
T 1kvi_A           24 WTIEQQIGKVNGVHHIKVSL   43 (79)
T ss_dssp             HHHHHHHHHSSSCCCEEEEG
T ss_pred             HHHHHHHHHCCCCEEEEEEC
T ss_conf             99999986189956999999


No 59 
>3b64_A Macrophage migration inhibitory factor-like protein; cytokine, MIF, LM1740MIF, lmmif, unknown function; 1.03A {Leishmania major}
Probab=21.49  E-value=29  Score=12.71  Aligned_cols=78  Identities=12%  Similarity=0.052  Sum_probs=47.0

Q ss_pred             HHHHHHHHHHHHHHCCCCCEEEEEEEE-CCCCCCCCCCCCCCEEEEEECCCCCCHHHH----HHHHHHHHHHHHCCCCCC
Q ss_conf             999999999999605763148999983-366655555558715999706877898899----999999986540188352
Q gi|254780695|r  132 VRALEGEIARTIQSISGIVAARVHIVM-PDMGSFRKIGARPTASVMIRAINPSVYKSA----EAIRHLVAAAVPNLDMGD  206 (563)
Q Consensus       132 ~ralegeL~rtI~~~~~V~~ArV~l~~-p~~~~f~~~~~~~sASV~l~~~~~l~~~qv----~~I~~lVa~sV~gL~~e~  206 (563)
                      ..+|..++.+.|..+-|=...+|...+ |....+......|.|-+.|+.-+++++++-    +.|..++..- =|+.+++
T Consensus        16 ~~~l~~~~s~~ia~~lgKpe~~vmv~v~~~~~m~fgGs~~P~a~~~v~siG~l~~~~n~~~s~~i~~~l~~~-LgI~~~R   94 (112)
T 3b64_A           16 RENLAQVYRAVTRDVLGKPEDLVMMTFHDSTPMHFFGSTDPVACVRVEALGGYGPSEPEKVTSIVTAAITKE-CGIVADR   94 (112)
T ss_dssp             HHHHHHHHHHHHHHTSCSCGGGCEEEEECSCCCCBTTBCSSCEEEEEECTTCCCTTHHHHHHHHHHHHHHHH-HCCCGGG
T ss_pred             HHHHHHHHHHHHHHHHCCCHHHEEEEEECCCCEEECCCCCCEEEEEEEEECCCCHHHHHHHHHHHHHHHHHH-HCCCCCE
T ss_conf             899999999999988799879999998379438975899977999999943889788899999999999998-5979673


Q ss_pred             EEEE
Q ss_conf             6998
Q gi|254780695|r  207 VTVL  210 (563)
Q Consensus       207 VtVv  210 (563)
                      |-|.
T Consensus        95 iyI~   98 (112)
T 3b64_A           95 IFVL   98 (112)
T ss_dssp             EEEE
T ss_pred             EEEE
T ss_conf             9999


No 60 
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A
Probab=21.48  E-value=28  Score=12.88  Aligned_cols=21  Identities=10%  Similarity=0.373  Sum_probs=15.7

Q ss_pred             HHHHHHHHHCCCCCEEEEEEE
Q ss_conf             999999960576314899998
Q gi|254780695|r  137 GEIARTIQSISGIVAARVHIV  157 (563)
Q Consensus       137 geL~rtI~~~~~V~~ArV~l~  157 (563)
                      .-+++.|+.++||.+++|.+.
T Consensus        16 ~~Ie~~l~~~~GV~~v~v~~~   36 (66)
T 2roe_A           16 MAVTKALKKVPGVEKVEVSLE   36 (66)
T ss_dssp             HHHHHHHHTSTTCCCEEECSS
T ss_pred             HHHHHHHHCCCCEEEEEEECC
T ss_conf             999999965999079999858


No 61 
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for structural proteomics; NMR {Agrobacterium tumefaciens str}
Probab=21.36  E-value=30  Score=12.69  Aligned_cols=22  Identities=18%  Similarity=0.087  Sum_probs=16.5

Q ss_pred             HHHHHHHHHHHCCCCCEEEEEE
Q ss_conf             9999999996057631489999
Q gi|254780695|r  135 LEGEIARTIQSISGIVAARVHI  156 (563)
Q Consensus       135 legeL~rtI~~~~~V~~ArV~l  156 (563)
                      =..-+++.|..++||.+++|+|
T Consensus        36 C~~~Ie~aL~~l~GV~~v~v~l   57 (85)
T 2k2p_A           36 CAGVIKGAIEKTVPGAAVHADP   57 (85)
T ss_dssp             HHHHHHHHHHHHSTTCEEEEET
T ss_pred             HHHHHHHHHHCCCCCEEEEEEC
T ss_conf             9999999986689904999978


No 62 
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B
Probab=21.32  E-value=30  Score=12.69  Aligned_cols=20  Identities=10%  Similarity=0.456  Sum_probs=15.3

Q ss_pred             HHHHHHHHHCCCCCEEEEEE
Q ss_conf             99999996057631489999
Q gi|254780695|r  137 GEIARTIQSISGIVAARVHI  156 (563)
Q Consensus       137 geL~rtI~~~~~V~~ArV~l  156 (563)
                      .-+++.+..++||.+++|.+
T Consensus        18 ~~Ie~~l~~~~GV~~v~V~~   37 (72)
T 1fvq_A           18 NTINTQLRALKGVTKCDISL   37 (72)
T ss_dssp             HHHHHHHHTSSSEEEECCBT
T ss_pred             HHHHHHHHCCCCCEEEEEEC
T ss_conf             99999984589935999988


No 63 
>3m21_A Probable tautomerase HP_0924; 4-oxalocrotonate tautomerase, catalytic proline, hexamer, BE beta, isomerase; 1.90A {Helicobacter pylori} PDB: 2orm_A
Probab=20.67  E-value=31  Score=12.60  Aligned_cols=30  Identities=13%  Similarity=0.153  Sum_probs=15.6

Q ss_pred             CCCCHHHHHHHHHHHHHH---HHCCCCCCEEEE
Q ss_conf             778988999999999865---401883526998
Q gi|254780695|r  181 NPSVYKSAEAIRHLVAAA---VPNLDMGDVTVL  210 (563)
Q Consensus       181 ~~l~~~qv~~I~~lVa~s---V~gL~~e~VtVv  210 (563)
                      +++|.+|-+.+..-+..+   +-|..+++|.|+
T Consensus        12 ~grt~eqK~~l~~~iT~~~~~~lg~~~e~v~V~   44 (67)
T 3m21_A           12 GGPTNEQKQQLIEGVSDLMVKVLNKNKASIVVI   44 (67)
T ss_dssp             TBSCHHHHHHHHHHHHHHHHHHHCCCGGGCEEE
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEE
T ss_conf             999999999999999999999959592439999


No 64 
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A
Probab=20.53  E-value=31  Score=12.58  Aligned_cols=19  Identities=21%  Similarity=0.433  Sum_probs=13.7

Q ss_pred             HHHHHHHHCCCCCEEEEEE
Q ss_conf             9999996057631489999
Q gi|254780695|r  138 EIARTIQSISGIVAARVHI  156 (563)
Q Consensus       138 eL~rtI~~~~~V~~ArV~l  156 (563)
                      -+++.+..++||++++|.+
T Consensus        26 ~Ie~~l~~~~GV~~v~v~~   44 (84)
T 1q8l_A           26 TIEGKIGKLQGVQRIKVSL   44 (84)
T ss_dssp             HHHHHHHTCTTEEEEEECS
T ss_pred             HHHHHHHCCCCCEEEEEEC
T ss_conf             9999986379946999999


No 65 
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP}
Probab=20.51  E-value=31  Score=12.58  Aligned_cols=22  Identities=18%  Similarity=0.262  Sum_probs=17.5

Q ss_pred             HHHHCHHHHHHHHHHHHHHHHH
Q ss_conf             9886999899999999863786
Q gi|254780695|r  534 MIEINEERFAKILRKWARSEIE  555 (563)
Q Consensus       534 lv~e~Pe~vA~vLR~WL~ee~~  555 (563)
                      |-.++++++|..|+.||.+...
T Consensus       283 l~~~~~~~~A~~I~~wL~~~~A  304 (319)
T 3lcr_A          283 IEGEHVASTAHIVGDWLREAHA  304 (319)
T ss_dssp             GSTTTHHHHHHHHHHHHHHHHC
T ss_pred             CCCCCHHHHHHHHHHHHHHHCC
T ss_conf             3763899999999999862318


No 66 
>2i87_A D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus aureus subsp} PDB: 2i8c_A* 2i80_A*
Probab=20.06  E-value=32  Score=12.52  Aligned_cols=40  Identities=8%  Similarity=0.056  Sum_probs=24.5

Q ss_pred             CCEEECCCCCHH------HHHHHHHHHHHCCC---CEEECCCCCEEEEC
Q ss_conf             824503899989------99999999997799---29991899779951
Q gi|254780695|r   47 HYDNLYVKLEVS------DVNRISVALSEANI---DFRISDNGSSISVP   86 (563)
Q Consensus        47 ~y~~L~~~l~~~------d~~~i~~~L~~~gI---~y~~~~~g~~I~Vp   86 (563)
                      .=.+||+|.+.+      .+.+|...|+..|+   ++-++.+|.....+
T Consensus         5 ~I~vl~GG~S~E~~iSl~Sg~~v~~aL~~~g~~v~~i~i~~~~~~~~~~   53 (364)
T 2i87_A            5 NICIVFGGKSAEHEVSILTAQNVLNAIDKDKYHVDIIYITNDGDWRKQN   53 (364)
T ss_dssp             EEEEEEECSSSCHHHHHHHHHHHHHTSCTTTEEEEEEEECTTCCEEEEC
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCEEECC
T ss_conf             8999959187543999999999999877739979999984898755258


Done!