BLAST/PSIBLAST alignment of GI: 254780695 and GI: 190890348 at iteration 1
>gi|190890348|ref|YP_001976890.1| flagellar M-ring protein [Rhizobium etli CIAT 652] Length = 563
>gi|190695627|gb|ACE89712.1| flagellar M-ring protein [Rhizobium etli CIAT 652] Length = 563
 Score =  561 bits (1446), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 295/562 (52%), Positives = 399/562 (70%), Gaps = 16/562 (2%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M +L+QL+Q FK+  +LGRTR++IL  V  + I + +AA  FVN P  + LYV L+  D+
Sbjct: 1   MNLLNQLVQIFKNFGALGRTRLMILGGVGALSIAIILAAALFVNKPAQETLYVGLDAPDL 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           N+IS+AL+EANI+F++  +G+SISVP+ M GKAR+ LA +GLP+S+ N+GYELFD V S 
Sbjct: 61  NQISMALAEANINFQVGTDGASISVPAGMTGKARLMLAERGLPNSA-NAGYELFDNVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQSISGI AARVHIVMP++G+FRK   +PTASVMIRA 
Sbjct: 120 GLTSFMQEVTRVRALEGEIARTIQSISGITAARVHIVMPEVGNFRKAEQKPTASVMIRAS 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQH 239
             +   +A +IRHLVA+AVP LD+ DVT+LDS G+LL + +E   + L +SL+IVQ +Q 
Sbjct: 180 AATGRSAATSIRHLVASAVPGLDVDDVTILDSAGQLLASGDEASNSSLNRSLNIVQNVQQ 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           E+E NI+KALA FLG+DNFRS+V A+LN D QQI+E  YDP+SKVERS+R +K+AQ+S+ 
Sbjct: 240 EVESNIDKALAPFLGMDNFRSSVTADLNTDAQQIQETTYDPESKVERSVRSTKEAQQSQQ 299

Query: 300 SQPESAVTVEQNMPHVSDRK--VPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
            Q ++A TVEQN+P  +        P S + +DK+EEQ+NYEIN+++ ATT ++YK+E+L
Sbjct: 300 KQSDNATTVEQNIPQAAPDAGGASGPESQDKSDKREEQTNYEINSRTTATTRNSYKVEKL 359

Query: 358 SIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           SIAVVVNKGR+ +++G  ADQ KID+YLAE+ KIV++A GI+++RGD +T+T+MDFLENQ
Sbjct: 360 SIAVVVNKGRIAKMVGEPADQAKIDAYLAEMQKIVASAAGIDAKRGDVVTVTAMDFLENQ 419

Query: 418 LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKK------ 471
           L    T  V  MD+LSR+ A +IN+L F+    +V ++GL  L R  + + A        
Sbjct: 420 LLEDATGGVRVMDMLSRNLAGIINSLAFVAVAFVVVWMGLRPLVRSVSGNGASAVLGDAT 479

Query: 472 GEVGGKSILSPPPISSAVTTGLMPNDNIALD---SSNQDIFSHSRNLQSRINSYVSKQSD 528
            E  G  +    P   A    LM  D    D    S +D+ S   +     N  V +  +
Sbjct: 480 PEAAGLELPDFAPAVGAPGGALM--DGFGSDFGFDSTEDLLSLGDD-DGNFNRRVKEGPE 536

Query: 529 LRLLHMIEINEERFAKILRKWA 550
            +L  M+EINEER AKILRKWA
Sbjct: 537 RKLARMVEINEERAAKILRKWA 558