BLAST/PSIBLAST alignment of GI: 254780695 and GI: 209547913 at iteration 1
>gi|209547913|ref|YP_002279830.1| flagellar MS-ring protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 563
>gi|209533669|gb|ACI53604.1| flagellar M-ring protein FliF [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 563
 Score =  548 bits (1412), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 300/566 (53%), Positives = 402/566 (71%), Gaps = 18/566 (3%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M +L+QL+Q FK+  SLGRTR++IL  V  V I + +AA  FVN P  + LYV L+  D+
Sbjct: 1   MNLLNQLVQIFKNFGSLGRTRLMILGGVGAVSIAIVLAAALFVNKPAQETLYVGLDSPDL 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           N+IS+AL+EAN+DF++  +G+SISVP+ M GKAR+ LA +GLP+S+ N+GYELFD V S 
Sbjct: 61  NQISMALAEANVDFQVGTDGTSISVPAGMTGKARLLLAERGLPNSA-NAGYELFDNVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQSISGI AARVHIVMP++G+FRK   +PTASVMIRA 
Sbjct: 120 GLTSFMQEVTRVRALEGEIARTIQSISGITAARVHIVMPEVGNFRKAEQKPTASVMIRAS 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQH 239
             +   +A +IRHLVA+AVP LD+ DVT+LDS G+LL + +E   + L +SL+IVQ +Q 
Sbjct: 180 ATTGRSAATSIRHLVASAVPGLDVDDVTILDSAGQLLASGDEASNSSLNRSLNIVQNVQQ 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           E+E NI+KALA FLG+DNFRS+V A+LN D QQI+E  YDP+SKVERS+R +K+AQ+S+ 
Sbjct: 240 EVESNIDKALAPFLGMDNFRSSVTADLNTDAQQIQETTYDPESKVERSVRSTKEAQQSQQ 299

Query: 300 SQPESAVTVEQNMPHVSDRK--VPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
            Q +SA TVEQN+P  +        P S + +DK+EEQ+NYEIN+++ ATT ++YK+E+L
Sbjct: 300 KQSDSATTVEQNIPQAAPEAGGSAGPESQDKSDKREEQTNYEINSRTTATTRNSYKVEKL 359

Query: 358 SIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           SIAVVVNKGR+ +++G  ADQ KID+YLAE+ KIV++A+GI+++RGD +T+T+MDFLENQ
Sbjct: 360 SIAVVVNKGRIAKMVGEPADQAKIDAYLAEMQKIVASASGIDAKRGDVVTVTAMDFLENQ 419

Query: 418 LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRR-------LHNIDDAK 470
           L    T  V  MD+LSR+ A +IN+L F+    +V ++GL  L R          + DA 
Sbjct: 420 LLEDATGGVRVMDMLSRNLAGIINSLAFVAVAFVVVWMGLRPLVRSVSGNGSSSVLGDAT 479

Query: 471 KGEVGGKSILSPPPISSAVTTGLMPNDNIALD---SSNQDIFSHSRNLQSRINSYVSKQS 527
             E  G  +    P + A    LM  D    D    S +D+ S   +     N  V +  
Sbjct: 480 P-EAAGLELPDFAPAAGASGGALM--DGFGSDFGFDSTEDLLSLGDD-DGNFNRRVKEGP 535

Query: 528 DLRLLHMIEINEERFAKILRKWARSE 553
           + +L  M+EINEER AKILRKWA  E
Sbjct: 536 ERKLSRMVEINEERAAKILRKWAIDE 561