BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780695|ref|YP_003065108.1| flagellar MS-ring protein
[Candidatus Liberibacter asiaticus str. psy62]
         (563 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780695|ref|YP_003065108.1| flagellar MS-ring protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040372|gb|ACT57168.1| flagellar MS-ring protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 563

 Score = 1140 bits (2950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/563 (100%), Positives = 563/563 (100%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV
Sbjct: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF
Sbjct: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI
Sbjct: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHE 240
           NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHE
Sbjct: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHE 240

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS
Sbjct: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA
Sbjct: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360

Query: 361 VVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN 420
           VVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN
Sbjct: 361 VVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN 420

Query: 421 SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL 480
           SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL
Sbjct: 421 SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL 480

Query: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540
           SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE
Sbjct: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540

Query: 541 RFAKILRKWARSEIEDRYTQHIS 563
           RFAKILRKWARSEIEDRYTQHIS
Sbjct: 541 RFAKILRKWARSEIEDRYTQHIS 563


>gi|315121860|ref|YP_004062349.1| flagellar MS-ring protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495262|gb|ADR51861.1| flagellar MS-ring protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 560

 Score =  858 bits (2218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/560 (75%), Positives = 480/560 (85%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           MAI+DQLLQFFKS  SLGR R+ I+ +V+   I L +AA FF++SP YD+LYVKLE SDV
Sbjct: 1   MAIIDQLLQFFKSAMSLGRMRLFIVGAVMFASIALLLAASFFMSSPIYDSLYVKLEASDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           N+ISVALSEA+IDFRI+ NGSSI VPS ++ KAR+ LA QGLP+SS+NSGYELFDKVNSF
Sbjct: 61  NKISVALSEASIDFRIAGNGSSILVPSHLLSKARLRLAEQGLPNSSNNSGYELFDKVNSF 120

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQEITRVRALEGEI+RTIQ ISGIVAARVHIVMPDMGSFR+IGA+PTASVM+R +
Sbjct: 121 GLTSFMQEITRVRALEGEISRTIQDISGIVAARVHIVMPDMGSFRRIGAKPTASVMVRVV 180

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHE 240
           NPSVYKSAEAIRHLVAAAVP LD+ DVTVLDSTGKLL ANE+ERNI GKSL IVQA+QHE
Sbjct: 181 NPSVYKSAEAIRHLVAAAVPGLDISDVTVLDSTGKLLVANEIERNIFGKSLGIVQAVQHE 240

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           IEMNINKALA FLG+DNFRSAV+AELN D QQI+EIVYDPDS+VERS+RLSKD QRSE+ 
Sbjct: 241 IEMNINKALAPFLGIDNFRSAVIAELNTDIQQIKEIVYDPDSRVERSVRLSKDVQRSESH 300

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           Q ESAVTVEQNMPHVS++    PR+LENTDKKEEQSNYEINTKSI+TTH+NYKLERLSIA
Sbjct: 301 QQESAVTVEQNMPHVSEKNATSPRALENTDKKEEQSNYEINTKSISTTHNNYKLERLSIA 360

Query: 361 VVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN 420
           VVVNKGRL E+LG S +Q K+DSYLAEIN+IVSAATGINS RGD ITITSMDFL++QL N
Sbjct: 361 VVVNKGRLMEMLGPSMEQSKVDSYLAEINRIVSAATGINSIRGDNITITSMDFLDDQLLN 420

Query: 421 SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL 480
           S TVQVSFMDILSR+F+ +INAL FL   LL+   G+H LR  +NID  K+ E+  KS L
Sbjct: 421 SSTVQVSFMDILSRNFSIIINALFFLTLVLLMALFGVHVLRGFNNIDLIKRKEMEAKSAL 480

Query: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540
           S P I+S   T LM +D++A DS  QDI S + N QS IN+YV++QSD RLL MIEINEE
Sbjct: 481 STPSIASTAETTLMSSDDMASDSFRQDILSRNNNFQSDINNYVAEQSDRRLLRMIEINEE 540

Query: 541 RFAKILRKWARSEIEDRYTQ 560
           RF+KI+RKW RSEIE RYTQ
Sbjct: 541 RFSKIIRKWVRSEIESRYTQ 560


>gi|241203091|ref|YP_002974187.1| flagellar MS-ring protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240856981|gb|ACS54648.1| flagellar M-ring protein FliF [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 563

 Score =  562 bits (1449), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 303/565 (53%), Positives = 400/565 (70%), Gaps = 16/565 (2%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M +L+QL+Q FK+  SLGRTR++IL  V  V I + +AA  FVN P  + LYV L+  D+
Sbjct: 1   MNLLNQLVQIFKNFGSLGRTRLMILGGVGAVSIAIVLAAALFVNKPAQETLYVGLDSPDL 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           N+IS+AL+EANI+F++  +G+SISVP+ M GKAR+ LA +GLP+S+ N+GYELFD V S 
Sbjct: 61  NQISMALAEANINFQVGTDGTSISVPAGMTGKARLMLAERGLPNSA-NAGYELFDNVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQSISGI AARVHIVMP++G+FRK   +PTASVMIRA 
Sbjct: 120 GLTSFMQEVTRVRALEGEIARTIQSISGITAARVHIVMPEVGNFRKAEQKPTASVMIRAS 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQH 239
             +   +A +IRHLVA+AVP LD+ DVT+LDS G+LL + +E   + L +SL+IVQ +Q 
Sbjct: 180 ATTGRSAATSIRHLVASAVPGLDVDDVTILDSAGQLLASGDEASNSSLNRSLNIVQNVQQ 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           E+E NI+KALA FLG+DNFRS+V A+LN D QQI+E  YDP+SKVERS+R +K+AQ+S+ 
Sbjct: 240 EVESNIDKALAPFLGMDNFRSSVTADLNTDAQQIQETTYDPESKVERSVRSTKEAQQSQQ 299

Query: 300 SQPESAVTVEQNMPHVSDRK--VPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
            Q +SA TVEQN+P  +        P S + +DK+EEQ+NYEIN+K+ ATT  +YK+E+L
Sbjct: 300 KQSDSATTVEQNIPQAAPEAGGSAGPESQDKSDKREEQTNYEINSKTTATTRSSYKVEKL 359

Query: 358 SIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           SIAVVVNKGR+ +++G  ADQ K+D+YLAE+ KIV++A GI+++RGD +T+T+MDFLENQ
Sbjct: 360 SIAVVVNKGRIAKMVGEPADQTKVDAYLAEMQKIVASAAGIDAKRGDVVTVTAMDFLENQ 419

Query: 418 LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRR--LHNIDDAKKG--- 472
           L    T  V  MD+LSR+ A +IN+L F+    LV ++GL  L R    N   A  G   
Sbjct: 420 LLEDATGGVRVMDMLSRNLAGIINSLAFVAVAFLVVWMGLRPLVRSVSGNGSSAAFGDAT 479

Query: 473 -EVGGKSILSPPPISSAVTTGLMPNDNIALD---SSNQDIFSHSRNLQSRINSYVSKQSD 528
            E  G  +    P S A    LM  D    D    S +D+ S   +     N  V +  +
Sbjct: 480 PEAAGLELPDFAPASGAPGGALM--DGFGSDFGFDSTEDLLSLGDD-DGNFNRRVKEGPE 536

Query: 529 LRLLHMIEINEERFAKILRKWARSE 553
            +L  M+EINEER AKILRKWA  E
Sbjct: 537 RKLSRMVEINEERAAKILRKWAIDE 561


>gi|327193018|gb|EGE59930.1| flagellar M-ring protein [Rhizobium etli CNPAF512]
          Length = 563

 Score =  562 bits (1448), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 297/562 (52%), Positives = 399/562 (70%), Gaps = 16/562 (2%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M +L+QL+Q FK+  +LGRTR++IL  V  + I + +AA  FVN P  + LYV L+  D+
Sbjct: 1   MNLLNQLVQIFKNFGALGRTRLMILGGVGALSIAIILAAALFVNKPAQETLYVGLDAPDL 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           N+IS+AL+EANI+F++  +G+SISVP+ M GKAR+ LA +GLP+S+ N+GYELFD V S 
Sbjct: 61  NQISMALAEANINFQVGTDGASISVPAGMTGKARLMLAERGLPNSA-NAGYELFDNVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQSISGI AARVHIVMP++G+FRK   +PTASVMIRA 
Sbjct: 120 GLTSFMQEVTRVRALEGEIARTIQSISGITAARVHIVMPEVGNFRKAEQKPTASVMIRAS 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQH 239
             +   +A +IRHLVA+AVP LD+ DVT+LDS G+LL + +E   + L +SL+IVQ +Q 
Sbjct: 180 AATGRSAATSIRHLVASAVPGLDVDDVTILDSAGQLLASGDEASNSSLNRSLNIVQNVQQ 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           E+E NI+KALA FLG+DNFRS+V A+LN D QQI+E  YDP+SKVERS+R +K+AQ+S+ 
Sbjct: 240 EVESNIDKALAPFLGMDNFRSSVTADLNTDAQQIQETTYDPESKVERSVRSTKEAQQSQQ 299

Query: 300 SQPESAVTVEQNMPHVSDRK--VPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
            Q ++A TVEQN+P  +        P S + +DK+EEQ+NYEIN+K+ ATT ++YK+E+L
Sbjct: 300 KQSDNATTVEQNIPQAAPDAGGASGPESQDKSDKREEQTNYEINSKTTATTRNSYKVEKL 359

Query: 358 SIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           SIAVVVNKGR+ +++G  ADQ K+D+YLAE+ KIV++A GI+++RGD +T+T+MDFLENQ
Sbjct: 360 SIAVVVNKGRIAKMVGEPADQAKVDAYLAEMQKIVASAAGIDAKRGDVVTVTAMDFLENQ 419

Query: 418 LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRR--LHNIDDAKKG--- 472
           L    T  V  MD+LSR+ A +IN+L F+    +V ++GL  L R    N   A  G   
Sbjct: 420 LLEDATGGVRVMDMLSRNLAGIINSLAFVAVAFVVVWMGLRPLVRSVTGNGASAVLGDAT 479

Query: 473 -EVGGKSILSPPPISSAVTTGLMPNDNIALD---SSNQDIFSHSRNLQSRINSYVSKQSD 528
            E  G  +    P   A    LM  D    D    S +D+ S   +     N  V +  +
Sbjct: 480 PEAAGLELPDFAPAVGAPGGALM--DGFGSDFGFDSTEDLLSLGDD-DGNFNRRVKEGPE 536

Query: 529 LRLLHMIEINEERFAKILRKWA 550
            +L  M+EINEER AKILRKWA
Sbjct: 537 RKLARMVEINEERAAKILRKWA 558


>gi|190890348|ref|YP_001976890.1| flagellar M-ring protein [Rhizobium etli CIAT 652]
 gi|190695627|gb|ACE89712.1| flagellar M-ring protein [Rhizobium etli CIAT 652]
          Length = 563

 Score =  561 bits (1446), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 295/562 (52%), Positives = 399/562 (70%), Gaps = 16/562 (2%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M +L+QL+Q FK+  +LGRTR++IL  V  + I + +AA  FVN P  + LYV L+  D+
Sbjct: 1   MNLLNQLVQIFKNFGALGRTRLMILGGVGALSIAIILAAALFVNKPAQETLYVGLDAPDL 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           N+IS+AL+EANI+F++  +G+SISVP+ M GKAR+ LA +GLP+S+ N+GYELFD V S 
Sbjct: 61  NQISMALAEANINFQVGTDGASISVPAGMTGKARLMLAERGLPNSA-NAGYELFDNVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQSISGI AARVHIVMP++G+FRK   +PTASVMIRA 
Sbjct: 120 GLTSFMQEVTRVRALEGEIARTIQSISGITAARVHIVMPEVGNFRKAEQKPTASVMIRAS 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQH 239
             +   +A +IRHLVA+AVP LD+ DVT+LDS G+LL + +E   + L +SL+IVQ +Q 
Sbjct: 180 AATGRSAATSIRHLVASAVPGLDVDDVTILDSAGQLLASGDEASNSSLNRSLNIVQNVQQ 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           E+E NI+KALA FLG+DNFRS+V A+LN D QQI+E  YDP+SKVERS+R +K+AQ+S+ 
Sbjct: 240 EVESNIDKALAPFLGMDNFRSSVTADLNTDAQQIQETTYDPESKVERSVRSTKEAQQSQQ 299

Query: 300 SQPESAVTVEQNMPHVSDRK--VPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
            Q ++A TVEQN+P  +        P S + +DK+EEQ+NYEIN+++ ATT ++YK+E+L
Sbjct: 300 KQSDNATTVEQNIPQAAPDAGGASGPESQDKSDKREEQTNYEINSRTTATTRNSYKVEKL 359

Query: 358 SIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           SIAVVVNKGR+ +++G  ADQ KID+YLAE+ KIV++A GI+++RGD +T+T+MDFLENQ
Sbjct: 360 SIAVVVNKGRIAKMVGEPADQAKIDAYLAEMQKIVASAAGIDAKRGDVVTVTAMDFLENQ 419

Query: 418 LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKK------ 471
           L    T  V  MD+LSR+ A +IN+L F+    +V ++GL  L R  + + A        
Sbjct: 420 LLEDATGGVRVMDMLSRNLAGIINSLAFVAVAFVVVWMGLRPLVRSVSGNGASAVLGDAT 479

Query: 472 GEVGGKSILSPPPISSAVTTGLMPNDNIALD---SSNQDIFSHSRNLQSRINSYVSKQSD 528
            E  G  +    P   A    LM  D    D    S +D+ S   +     N  V +  +
Sbjct: 480 PEAAGLELPDFAPAVGAPGGALM--DGFGSDFGFDSTEDLLSLGDD-DGNFNRRVKEGPE 536

Query: 529 LRLLHMIEINEERFAKILRKWA 550
            +L  M+EINEER AKILRKWA
Sbjct: 537 RKLARMVEINEERAAKILRKWA 558


>gi|116250467|ref|YP_766305.1| flagellar MS-ring protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255115|emb|CAK06189.1| putative flagellar M-ring protein [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 561

 Score =  558 bits (1439), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 302/563 (53%), Positives = 400/563 (71%), Gaps = 14/563 (2%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M +L+QL+Q FK+  SLGRTR++IL  V  + I + +AA  FVN P  + LYV L+  D+
Sbjct: 1   MNLLNQLVQIFKNFGSLGRTRLMILGGVGALSIAIILAAALFVNKPAQETLYVGLDSPDL 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           N+IS+AL+EANI+F++  +GSSISVP+ M GKAR+ LA +GLP+S+ N+GYELFD V S 
Sbjct: 61  NQISMALAEANINFQVGTDGSSISVPAGMTGKARLMLAERGLPNSA-NAGYELFDNVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQSISGI AARVHIVMP++G+FRK   +PTASVMIRA 
Sbjct: 120 GLTSFMQEVTRVRALEGEIARTIQSISGITAARVHIVMPEVGNFRKAEQKPTASVMIRAS 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQH 239
             +   +A +IRHLVA+AVP LD+ DVT+LDS G+LL + +E   + L +SL+IVQ +Q 
Sbjct: 180 ATTGRSAATSIRHLVASAVPGLDVDDVTILDSAGQLLASGDEASNSSLNRSLNIVQNVQQ 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           E+E NI+KALA FLG+DNFRS+V A+LN D QQI+E  YDP+SKVERS+R +K+AQ+S+ 
Sbjct: 240 EVESNIDKALAPFLGMDNFRSSVTADLNTDAQQIQETTYDPESKVERSVRSTKEAQQSQQ 299

Query: 300 SQPESAVTVEQNMPHVSDRK--VPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
            Q +SA TVEQN+P  +        P S + +DK+EEQ+NYEIN+K+ ATT  +YK+E+L
Sbjct: 300 KQSDSATTVEQNIPQAAPEAGGSAGPESQDKSDKREEQTNYEINSKTTATTRSSYKVEKL 359

Query: 358 SIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           SIAVVVNKGR+ +++G  ADQ K+D+YLAE+ KIV++A GI+++RGD +T+T+MDFLENQ
Sbjct: 360 SIAVVVNKGRIAKMVGEPADQAKVDAYLAEMQKIVASAAGIDAKRGDVVTVTAMDFLENQ 419

Query: 418 LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKG----E 473
           L    T  V  MD+LSR+ A +IN+L F+    +V ++GL  L R  N   A  G    E
Sbjct: 420 LLEDATGGVRVMDMLSRNLAGIINSLAFVAVAFVVVWMGLRPLVRSINGTSAAFGDATPE 479

Query: 474 VGGKSILSPPPISSAVTTGLMPNDNIALD---SSNQDIFSHSRNLQSRINSYVSKQSDLR 530
             G  +    P S A    LM  D    D    S +D+ S   +     N  V +  + +
Sbjct: 480 AAGLELPDFAPASGAPGGALM--DGFGSDFGFDSTEDLLSLGDD-DGNFNRRVKEGPERK 536

Query: 531 LLHMIEINEERFAKILRKWARSE 553
           L  M+EINEER AKILRKWA  E
Sbjct: 537 LSRMVEINEERAAKILRKWAIDE 559


>gi|86356297|ref|YP_468189.1| flagellar MS-ring protein [Rhizobium etli CFN 42]
 gi|86280399|gb|ABC89462.1| flagellar M-ring protein [Rhizobium etli CFN 42]
          Length = 563

 Score =  556 bits (1433), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 298/563 (52%), Positives = 402/563 (71%), Gaps = 18/563 (3%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M +L+QL+Q FK+  +LGRTR++IL  V  V I + +AA  FVN P  + LYV L+  D+
Sbjct: 1   MNLLNQLVQIFKNFGALGRTRLMILGGVGSVSIAIILAAALFVNKPAQETLYVGLDAPDL 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           N+IS+AL+EANI+F++  +GSSI+VP+ M GKAR+ LA +GLP+S+ N+GYELFD V S 
Sbjct: 61  NQISMALAEANINFQVGTDGSSITVPAGMTGKARLMLAERGLPNSA-NAGYELFDNVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQSISGI AARVHIVMP++G+FRK   +PTASVMIRA 
Sbjct: 120 GLTSFMQEVTRVRALEGEIARTIQSISGITAARVHIVMPEVGNFRKAEQKPTASVMIRAS 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQH 239
             +   +A +IRHLVA+AVP LD+ DVT+LDS G+LL + +E   + L +SL+IVQ +Q 
Sbjct: 180 AATGRSAATSIRHLVASAVPGLDVDDVTILDSAGQLLASGDEASNSSLNRSLNIVQNVQQ 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           E+E NI+KALA FLG+DNFRS+V A+LN D QQI+E VYDP+SKVERS+R +K+AQ+S+ 
Sbjct: 240 EVESNIDKALAPFLGMDNFRSSVTADLNTDAQQIQETVYDPESKVERSVRSTKEAQQSQQ 299

Query: 300 SQPESAVTVEQNMPHVSDRK--VPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
            Q ++A TVEQN+P  +        P S + +DK+EEQ+NYEIN+K+ ATT ++Y++E+L
Sbjct: 300 RQSDNATTVEQNIPQAAPDAGGSGGPESQDKSDKREEQTNYEINSKTTATTRNSYQVEKL 359

Query: 358 SIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           SIAVVVNKGR+ +++G  ADQ KID+YLAE++KIV++A GI+++RGD +T+T+MDFLENQ
Sbjct: 360 SIAVVVNKGRIAKMVGEPADQAKIDAYLAEMHKIVASAAGIDAKRGDVVTVTAMDFLENQ 419

Query: 418 LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRR-------LHNIDDAK 470
           L    T  V  MD+LSR+ A +IN+L F+    +V ++GL  L R          + DA 
Sbjct: 420 LLEDATGGVRVMDMLSRNLAGIINSLAFVAVAFVVVWMGLRPLVRSVSGNGSSSVLGDAT 479

Query: 471 KGEVGGKSILSPPPISSAVTTGLMPNDNIALD---SSNQDIFSHSRNLQSRINSYVSKQS 527
             E  G  +    P + A    LM  D    D    S +D+ S   +     N  V +  
Sbjct: 480 P-EAAGLELPDFAPAAGAAGGALM--DGFGSDFGFDSTEDLLSLGDD-DGNFNRRVKEGP 535

Query: 528 DLRLLHMIEINEERFAKILRKWA 550
           + +L  M+EINEER AKILRKWA
Sbjct: 536 ERKLARMVEINEERAAKILRKWA 558


>gi|209547913|ref|YP_002279830.1| flagellar MS-ring protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209533669|gb|ACI53604.1| flagellar M-ring protein FliF [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 563

 Score =  548 bits (1412), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 300/566 (53%), Positives = 402/566 (71%), Gaps = 18/566 (3%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M +L+QL+Q FK+  SLGRTR++IL  V  V I + +AA  FVN P  + LYV L+  D+
Sbjct: 1   MNLLNQLVQIFKNFGSLGRTRLMILGGVGAVSIAIVLAAALFVNKPAQETLYVGLDSPDL 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           N+IS+AL+EAN+DF++  +G+SISVP+ M GKAR+ LA +GLP+S+ N+GYELFD V S 
Sbjct: 61  NQISMALAEANVDFQVGTDGTSISVPAGMTGKARLLLAERGLPNSA-NAGYELFDNVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQSISGI AARVHIVMP++G+FRK   +PTASVMIRA 
Sbjct: 120 GLTSFMQEVTRVRALEGEIARTIQSISGITAARVHIVMPEVGNFRKAEQKPTASVMIRAS 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQH 239
             +   +A +IRHLVA+AVP LD+ DVT+LDS G+LL + +E   + L +SL+IVQ +Q 
Sbjct: 180 ATTGRSAATSIRHLVASAVPGLDVDDVTILDSAGQLLASGDEASNSSLNRSLNIVQNVQQ 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           E+E NI+KALA FLG+DNFRS+V A+LN D QQI+E  YDP+SKVERS+R +K+AQ+S+ 
Sbjct: 240 EVESNIDKALAPFLGMDNFRSSVTADLNTDAQQIQETTYDPESKVERSVRSTKEAQQSQQ 299

Query: 300 SQPESAVTVEQNMPHVSDRK--VPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
            Q +SA TVEQN+P  +        P S + +DK+EEQ+NYEIN+++ ATT ++YK+E+L
Sbjct: 300 KQSDSATTVEQNIPQAAPEAGGSAGPESQDKSDKREEQTNYEINSRTTATTRNSYKVEKL 359

Query: 358 SIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           SIAVVVNKGR+ +++G  ADQ KID+YLAE+ KIV++A+GI+++RGD +T+T+MDFLENQ
Sbjct: 360 SIAVVVNKGRIAKMVGEPADQAKIDAYLAEMQKIVASASGIDAKRGDVVTVTAMDFLENQ 419

Query: 418 LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRR-------LHNIDDAK 470
           L    T  V  MD+LSR+ A +IN+L F+    +V ++GL  L R          + DA 
Sbjct: 420 LLEDATGGVRVMDMLSRNLAGIINSLAFVAVAFVVVWMGLRPLVRSVSGNGSSSVLGDAT 479

Query: 471 KGEVGGKSILSPPPISSAVTTGLMPNDNIALD---SSNQDIFSHSRNLQSRINSYVSKQS 527
             E  G  +    P + A    LM  D    D    S +D+ S   +     N  V +  
Sbjct: 480 P-EAAGLELPDFAPAAGASGGALM--DGFGSDFGFDSTEDLLSLGDD-DGNFNRRVKEGP 535

Query: 528 DLRLLHMIEINEERFAKILRKWARSE 553
           + +L  M+EINEER AKILRKWA  E
Sbjct: 536 ERKLSRMVEINEERAAKILRKWAIDE 561


>gi|222149996|ref|YP_002550953.1| flagellar MS-ring protein [Agrobacterium vitis S4]
 gi|221736978|gb|ACM37941.1| flagellar M-ring protein [Agrobacterium vitis S4]
          Length = 568

 Score =  547 bits (1409), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 281/559 (50%), Positives = 384/559 (68%), Gaps = 11/559 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M + +QLLQ FK+ +SLG T++  LA V +V + L + A FF+N P ++ LYV LE +DV
Sbjct: 7   MNLFNQLLQVFKNLSSLGPTKLWTLAGVGVVSVALVIGAAFFINKPAFETLYVGLEATDV 66

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           N+IS+AL+EA + F+   +G SI V + M GKAR+ LA +GLP+S+ N+GYELFD V S 
Sbjct: 67  NQISIALAEAGVGFQTGADGKSIQVQAGMTGKARLLLAERGLPNST-NAGYELFDNVGSL 125

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQ I+GI AARVHIVMPD+G+FR+   +PTASVMIRA 
Sbjct: 126 GLTSFMQEVTRVRALEGEIARTIQQINGIAAARVHIVMPDVGNFRRGAQKPTASVMIRAG 185

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHE 240
           + +  KSA +IRHLVA+AVP L++ DVT+LDSTG+LL + +       ++L + Q++Q E
Sbjct: 186 SDAGRKSAASIRHLVASAVPGLEIDDVTILDSTGQLLASGDETGGAANRNLGVAQSVQQE 245

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           IE NI+KALA FLG+DNFRS+V A+LN D QQI+E VYDP+SKVERS R +K+AQ+S+  
Sbjct: 246 IESNIDKALAPFLGMDNFRSSVTAQLNTDQQQIQETVYDPESKVERSTRTTKEAQKSQQR 305

Query: 301 QPESAVTVEQNMPHVSDRKVPL-PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
           Q ++A TVEQN+P  + +     P S +  DKKEEQ+NYEIN+K+IAT  + Y L++LS+
Sbjct: 306 QSDTAATVEQNIPQAAPQAGGAGPESSDQQDKKEEQTNYEINSKTIATVKNGYTLDKLSV 365

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AVVVNK R+  ++G   DQ KID+YLAE+ KIV +A G++ +RGD +T+T+MDFLENQL 
Sbjct: 366 AVVVNKQRIATMVGEPVDQAKIDAYLAEMQKIVKSAAGLDDKRGDVVTLTAMDFLENQLL 425

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
           +        M+ILSR+ A +IN+L FL    LV ++G+  + R          E G  ++
Sbjct: 426 SEAPTGPGVMEILSRNMAGIINSLAFLAVAFLVVWMGIRPMVRSMGGGGTAALEGGSDAV 485

Query: 480 --LSPPPISSAVTTGLMP------NDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRL 531
             L  P  S  +  G           +   DS++ D+ +   +     N  V +  + RL
Sbjct: 486 AGLELPDFSPGLDAGAGGGLMDGFGSDFGFDSAD-DVLALDNDPNGGFNRRVKEGPERRL 544

Query: 532 LHMIEINEERFAKILRKWA 550
             M+EI+EER AKILRKWA
Sbjct: 545 ARMVEISEERAAKILRKWA 563


>gi|325291912|ref|YP_004277776.1| flagellar MS-ring protein [Agrobacterium sp. H13-3]
 gi|325059765|gb|ADY63456.1| flagellar MS-ring protein [Agrobacterium sp. H13-3]
          Length = 560

 Score =  535 bits (1377), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 272/558 (48%), Positives = 393/558 (70%), Gaps = 11/558 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M +L+Q+ Q  K+  +LG+TR+L+L  V ++ + + +AA  +VN P Y+ LYV LE SD+
Sbjct: 1   MNLLNQIPQVLKNFAALGQTRLLMLGGVGILSMAIILAAALYVNRPAYETLYVGLEKSDL 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           N+IS+AL+EA +DF++  +G+S+ VP  +  KAR+ LA +GLP S+ N+GYELFD V S 
Sbjct: 61  NKISIALAEAGLDFQVGTDGASLQVPVGLTSKARLLLAERGLPDSA-NAGYELFDNVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEI+R+IQ I GI AARVHIVMPD+G+FR+   +PTASVMIRA 
Sbjct: 120 GLTSFMQEVTRVRALEGEISRSIQQIDGIAAARVHIVMPDVGNFRRGEQKPTASVMIRAN 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQH 239
             +  K++ +IRHLVA+AVP L++ DVT+LDSTG+LL + +++    + +SL++ Q +Q 
Sbjct: 180 ATAGRKASASIRHLVASAVPGLEVDDVTLLDSTGQLLASGDDVTNAAMNRSLTLAQNVQQ 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           EI  NI+KALA FLG+DNFRS+V A+LN D++QI+E VYDP+S+VERS+R  K+ Q+S+ 
Sbjct: 240 EITTNIDKALAPFLGMDNFRSSVTAQLNTDSRQIQETVYDPESRVERSVRTVKEDQKSQE 299

Query: 300 SQPESAVTVEQNMPHVSDR-KVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLS 358
           +QP++A TVEQN+P  + +     P+S + + KKEEQ+NYEIN+K++AT  + Y +E++S
Sbjct: 300 TQPDTAATVEQNVPQAAPQGGAGGPQSSDQSAKKEEQTNYEINSKTVATVKNGYTVEKIS 359

Query: 359 IAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQL 418
           +AVVVNKGR+ +++G   DQ KID+YLAE+ KIV++A G++S RGD +T+T+MDFLE QL
Sbjct: 360 VAVVVNKGRIAKMVGEPVDQAKIDAYLAEMQKIVTSAAGVSSDRGDIVTLTAMDFLETQL 419

Query: 419 FNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKG----EV 474
            +        M++LSR+ A +IN+L F+    LV +LG+  L R    + A  G    E 
Sbjct: 420 LDEAASGPGIMEVLSRNSAGIINSLAFVAVAFLVVWLGVRPLVRTVTGNGAAAGQISQET 479

Query: 475 GGKSILSPPPISSAVTTGLMP--NDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLL 532
            G  +    P   A   GLM     +   DS++ D+ +   + +   N  V +  + RL 
Sbjct: 480 AGLELPDFSPGMDAGAGGLMEGFGADFGFDSTD-DLLAGG-DSEGTFNRRVREGPERRLS 537

Query: 533 HMIEINEERFAKILRKWA 550
            M+EI+EER AKILRKWA
Sbjct: 538 RMVEISEERAAKILRKWA 555


>gi|222084850|ref|YP_002543379.1| flagellar M-ring protein [Agrobacterium radiobacter K84]
 gi|221722298|gb|ACM25454.1| flagellar M-ring protein [Agrobacterium radiobacter K84]
          Length = 559

 Score =  522 bits (1345), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 276/567 (48%), Positives = 395/567 (69%), Gaps = 30/567 (5%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M +L+QL+  F++  +LGRTR+L LA V ++ + L + A  +VN P  + LYV L+ +D+
Sbjct: 1   MNLLNQLVPLFRNLQNLGRTRLLTLAGVGILSVALVLFAALYVNKPAQETLYVGLDATDL 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           N+IS+AL+EA I+F++  +G+S++VP+ M GKAR  LA +GLP+S+ N+GYELFD V S 
Sbjct: 61  NQISIALAEAKINFQVGADGTSLTVPTGMTGKARALLAERGLPNST-NAGYELFDNVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEI RTI SISGI AARVHIVM D+G+FRK   +PTASVMIRA 
Sbjct: 120 GLTSFMQEVTRVRALEGEIGRTITSISGISAARVHIVMQDVGNFRKADQKPTASVMIRAN 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQH 239
             +  K+A+AIRHLVA+AVP L++ DVT+LDSTG+LL + + + N  L ++L IVQ +Q 
Sbjct: 180 AEAARKAAQAIRHLVASAVPGLEVDDVTILDSTGQLLASGDDQSNGALNRNLGIVQNVQG 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           EI  NI+KALA FLG+DNFRS+V A+LN D+QQ++E  YDP+SKVERS+R +K+AQ+S+ 
Sbjct: 240 EIASNIDKALAPFLGMDNFRSSVTAQLNTDSQQVQETTYDPESKVERSVRTTKEAQKSQQ 299

Query: 300 SQPESAVTVEQNMPHVSDRKVP-LPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLS 358
            Q ++A TVEQN+P  + +     P S + TDK+EEQ+NYEIN+K+ AT  ++Y++E+LS
Sbjct: 300 RQSDTAATVEQNIPQAAPQAGGNGPTSNDQTDKREEQTNYEINSKTTATVRNSYRIEKLS 359

Query: 359 IAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQL 418
           +AVVVN+GR+ +++G+ AD  K+D+Y+AE+ KIV+ A G++  RGD +T+ +MDFL+ QL
Sbjct: 360 VAVVVNRGRIAQMVGQPADPAKVDAYIAEMQKIVATAAGLDPSRGDVVTVNAMDFLDTQL 419

Query: 419 FNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHAL-RRLHN------------ 465
            +     ++ MD+LSR+ A +IN+L F+   +L+ +LG   L R L              
Sbjct: 420 LDDNASGLNIMDVLSRNIAGIINSLAFVAVAVLIIWLGFRPLIRSLGGGANGTALPDAAG 479

Query: 466 --IDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYV 523
             + D   G VGG          +A+  G     +   DS++ D+ +   +  S  N  V
Sbjct: 480 LELPDFAPGAVGGP--------GAALMDGF--GSDFGFDSTD-DLLTMGED-NSTFNRRV 527

Query: 524 SKQSDLRLLHMIEINEERFAKILRKWA 550
            +  + RL  M+EI+EER AKILRKWA
Sbjct: 528 KEGPERRLSRMVEISEERAAKILRKWA 554


>gi|15964399|ref|NP_384752.1| flagellar MS-ring protein [Sinorhizobium meliloti 1021]
 gi|307311541|ref|ZP_07591182.1| flagellar M-ring protein FliF [Sinorhizobium meliloti BL225C]
 gi|307318896|ref|ZP_07598327.1| flagellar M-ring protein FliF [Sinorhizobium meliloti AK83]
 gi|17380368|sp|O54239|FLIF_RHIME RecName: Full=Flagellar M-ring protein
 gi|15073576|emb|CAC45218.1| Flagellar M-ring transmembrane protein [Sinorhizobium meliloti
           1021]
 gi|306895310|gb|EFN26065.1| flagellar M-ring protein FliF [Sinorhizobium meliloti AK83]
 gi|306899558|gb|EFN30187.1| flagellar M-ring protein FliF [Sinorhizobium meliloti BL225C]
          Length = 557

 Score =  522 bits (1345), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 277/556 (49%), Positives = 372/556 (66%), Gaps = 10/556 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M + DQ   F K+ ++LG+ +++ LA   +V I   + A  +VN P ++ LYV LE SDV
Sbjct: 1   MNLFDQFSTFTKNLSNLGQGKLIALAVAGVVAIGFVLGAGIYVNRPSFETLYVGLERSDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
            +IS+AL+EAN+DF +  +G SI VP  M GKAR+ LA +GLPSS+ N+GYELFD V S 
Sbjct: 61  TQISIALAEANVDFEVGTDGGSIQVPVGMTGKARLLLAERGLPSSA-NAGYELFDNVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQ ISGI AARVHIVMP+ GSFRK    PTASVMIRA 
Sbjct: 120 GLTSFMQEVTRVRALEGEIARTIQQISGIAAARVHIVMPERGSFRKAEQTPTASVMIRAS 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQH 239
                 +A +IRHLVA++VP LD+ DVTVLDSTG+LL + +   N  L +SL +VQ +Q 
Sbjct: 180 ATVGRSAASSIRHLVASSVPGLDVDDVTVLDSTGQLLASGDDPSNSALNQSLGVVQNVQS 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           ++E  I+ ALA FLG+DNFR++V A LN D QQI+E V+DP+S+VERS R+ K+ Q+S  
Sbjct: 240 DLEKKIDNALAPFLGMDNFRTSVTARLNTDAQQIQETVFDPESRVERSTRVIKEEQKSSQ 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
            QP++A TV+QN+P  + R     +S +  +KKEEQ+NYEIN+K+IAT  ++Y +ERLSI
Sbjct: 300 QQPDNAATVQQNVPQAAPRGGAGQQSSDEAEKKEEQTNYEINSKTIATVKNSYSIERLSI 359

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AVVVN+GRL  + G  ADQ KID+YL E+ KIVS+A GI+  RGD +T+ +MDF+E QL 
Sbjct: 360 AVVVNRGRLAAMAGEPADQAKIDAYLQEMQKIVSSAAGIDPGRGDVVTLNAMDFVETQLL 419

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHAL-RRLHNIDDAKK--GEVGG 476
           +        M++L+R+   +INAL F+    LV + G+  L R+L     A K  GE  G
Sbjct: 420 DQAVPGPGIMEMLTRNLGGIINALAFVAVAFLVVWFGMRPLARQLGFGGQAGKLEGEAAG 479

Query: 477 KSILSPPPISSAVTTGLMP--NDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHM 534
             +    P  +     LM     +   D  + D+ +     ++  N  V +  + RL  M
Sbjct: 480 LELPDFSPAGAGAGGALMEGFGSDFGFDGGD-DLLNLGD--EAGFNRRVKEGPERRLARM 536

Query: 535 IEINEERFAKILRKWA 550
           +EI+EER AKILRKWA
Sbjct: 537 VEISEERAAKILRKWA 552


>gi|15887871|ref|NP_353552.1| flagellar MS-ring protein [Agrobacterium tumefaciens str. C58]
 gi|15155457|gb|AAK86337.1| flagellar M-ring protein [Agrobacterium tumefaciens str. C58]
          Length = 566

 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 269/558 (48%), Positives = 391/558 (70%), Gaps = 11/558 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M +L+Q+ Q  K+  +LG+TR+L+L  V ++ + + +AA  +VN P Y+ LYV LE SD+
Sbjct: 7   MNLLNQIPQVLKNVAALGQTRLLMLGGVGVLSMAIILAAALYVNRPAYETLYVGLEKSDL 66

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           N+IS+AL+E+ +DF++  +GSS+ VP  +  KAR+ LA +GLP S+ N+GYELFD V S 
Sbjct: 67  NKISIALAESGLDFQVGTDGSSLQVPVGLTSKARLLLAERGLPDSA-NAGYELFDNVGSL 125

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEI R+IQ I G+ AARVHIV+PD+G+FR+   +PTASVMIRA 
Sbjct: 126 GLTSFMQEVTRVRALEGEIGRSIQQIDGVSAARVHIVLPDVGNFRRGEQKPTASVMIRAS 185

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQH 239
             +  K++ +IRHLVA+AVP L++ DVT+LDSTG+LL + +++    + +SL++ Q +Q 
Sbjct: 186 ASAGRKASASIRHLVASAVPGLEVDDVTLLDSTGQLLASGDDVTNAAMNRSLTLAQNVQQ 245

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           EI  NI+KALA FLG+DNFRS+V A++N D++Q++E VYDP+S+VERS+R  K+ Q+S+ 
Sbjct: 246 EITTNIDKALAPFLGIDNFRSSVTAQINTDSRQVQETVYDPESRVERSVRTVKEDQKSQE 305

Query: 300 SQPESAVTVEQNM-PHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLS 358
           +QP++A TVEQN+           P+S + + KKEEQ+NYEIN+K++AT  + Y LE++S
Sbjct: 306 TQPDTAATVEQNVPQAAPQGGGGGPQSSDQSAKKEEQTNYEINSKTVATVKNGYTLEKIS 365

Query: 359 IAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQL 418
           +AVVVNKGR+ +++G  ADQ KID+YLAE+ KIV++A GI+S RGD +T+T+MDFLE QL
Sbjct: 366 VAVVVNKGRIAKMVGEPADQAKIDAYLAEMQKIVTSAAGISSDRGDIVTLTAMDFLETQL 425

Query: 419 FNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKS 478
            +        M++LSR+ A +IN+L F+    LV +LG+  L R    + +   ++  +S
Sbjct: 426 LDEAASGPGVMEVLSRNSAGIINSLAFVAVAFLVVWLGVRPLVRTVTANGSAAAQLSQES 485

Query: 479 I-LSPP---PISSAVTTGLMP--NDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLL 532
             L  P   P   A   GLM     +   DS++ D+ +     +   N  V +  + RL 
Sbjct: 486 AGLELPDFSPGMEAGAGGLMEGFGADFGFDSTD-DLLAGGDG-EGTFNRRVREGPERRLS 543

Query: 533 HMIEINEERFAKILRKWA 550
            M+EI+EER AKILRKWA
Sbjct: 544 RMVEISEERAAKILRKWA 561


>gi|227820842|ref|YP_002824812.1| flagellar MS-ring protein [Sinorhizobium fredii NGR234]
 gi|227339841|gb|ACP24059.1| flagellar M-ring protein FliF [Sinorhizobium fredii NGR234]
          Length = 559

 Score =  518 bits (1334), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 274/557 (49%), Positives = 378/557 (67%), Gaps = 10/557 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M + DQ   F K+ ++LG+++++ LA   +V I   + A  +VN P Y+ LYV LE SDV
Sbjct: 1   MNLFDQFSTFTKNLSNLGQSKLIALAVAGIVAIGFVLGAAIYVNKPAYETLYVGLERSDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
            +IS+AL+EAN+DF +  +G SI VP  M GKAR+ LA +GLPSS+ N+GYELFD V S 
Sbjct: 61  TQISIALAEANLDFEVGSDGGSIQVPVGMTGKARLLLAERGLPSSA-NAGYELFDNVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQ ISGI AARVHIVMP+ GSFRK    PTASVMIRA 
Sbjct: 120 GLTSFMQEVTRVRALEGEIARTIQQISGIAAARVHIVMPERGSFRKAEQTPTASVMIRAS 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQH 239
                 +A +IRHLVA++VP LD+ DVT+LDSTG+LL + +   N  L +SL +VQ +Q 
Sbjct: 180 ATVGRGAASSIRHLVASSVPGLDIDDVTILDSTGQLLASGDDPANSALNQSLGVVQNVQT 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           ++E  I+ ALA FLG+DNFR++V A LN D QQI+E V+DP+S+VERS R+ K+ Q+S  
Sbjct: 240 DLEKKIDNALAPFLGMDNFRTSVTASLNTDAQQIQETVFDPESRVERSTRVIKEEQKSSQ 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
            QP++A TV+QN+P  + R     +S +   KKEEQ+NYEIN+K+IAT  ++Y +ERLSI
Sbjct: 300 QQPDNAATVQQNVPQAAPRGGAGQQSNDEAAKKEEQTNYEINSKTIATVKNSYSIERLSI 359

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AVVVN+GRL  ++G  ADQ KID+YL ++ KIV++A G+++ RGD +T+ +MDF+E QL 
Sbjct: 360 AVVVNRGRLAAMVGEGADQAKIDAYLQDMQKIVASAAGVDTNRGDVVTLNAMDFVETQLL 419

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAK---KGEVGG 476
           +        M++L+R+   +IN+L F++   LV +LG+  L R           +GE  G
Sbjct: 420 DQAVAGPGVMEMLTRNLGGIINSLAFILVAFLVVWLGMRPLARQMGFGGQSGHLEGEGAG 479

Query: 477 KSILS-PPPISSAVTTGLMP--NDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLH 533
             +    P  +SA    LM     +   DS++ D+ + S +  +  N  V +  + RL  
Sbjct: 480 LELPDFSPAGASAAGGALMEGFGSDFGFDSTD-DLLNIS-DEGNGFNRRVKEGPERRLAR 537

Query: 534 MIEINEERFAKILRKWA 550
           M+EI+EER AKILRKW+
Sbjct: 538 MVEISEERAAKILRKWS 554


>gi|2916780|emb|CAA11947.1| flagellar basal-body MS-ring protein [Sinorhizobium meliloti]
          Length = 557

 Score =  517 bits (1332), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 275/556 (49%), Positives = 370/556 (66%), Gaps = 10/556 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M + DQ   F K+ ++LG+ +++ LA   +V I   + A  +VN   ++ LYV LE SDV
Sbjct: 1   MNLFDQFSTFTKNLSNLGQGKLIALAVAGVVAIGFVLGAGIYVNRRSFETLYVGLERSDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
            +IS+AL+EAN+DF +  +G SI VP  M GKAR+ LA +GLPSS+ N+GYELFD V S 
Sbjct: 61  TQISIALAEANVDFEVGTDGGSIQVPVGMTGKARLLLAERGLPSSA-NAGYELFDNVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEI RTIQ ISGI AARVHIVMP+ GSFRK    PTASVMIRA 
Sbjct: 120 GLTSFMQEVTRVRALEGEIGRTIQQISGIAAARVHIVMPERGSFRKAEQTPTASVMIRAS 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQH 239
                 +A +IRHLVA++VP LD+ DVTVLDSTG+LL + +   N  L +SL +VQ +Q 
Sbjct: 180 ATVGRSAASSIRHLVASSVPGLDVDDVTVLDSTGQLLASGDDPSNSALNQSLGVVQNVQS 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           ++E  I+ ALA FLG+DNFR++V A LN D QQI+E V+DP+S+VERS R+ K+ Q+S  
Sbjct: 240 DLEKKIDNALAPFLGMDNFRTSVTARLNTDAQQIQETVFDPESRVERSTRVIKEEQKSSQ 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
            QP++A TV+QN+P  + R     +S +  +KKEEQ+NYEIN+K+IAT  ++Y +ERLSI
Sbjct: 300 QQPDNAATVQQNVPQAAPRGGAGQQSSDEAEKKEEQTNYEINSKTIATVKNSYSIERLSI 359

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AVVVN+GRL  + G  ADQ KID+YL E+ KIVS+A GI+  RGD +T+ +MDF+E QL 
Sbjct: 360 AVVVNRGRLAAMAGEPADQAKIDAYLQEMQKIVSSAAGIDPGRGDVVTLNAMDFVETQLL 419

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHAL-RRLHNIDDAKK--GEVGG 476
           +        M++L+R+   +INAL F+    LV + G+  L R+L     A K  GE  G
Sbjct: 420 DQAVPGPGIMEMLTRNLGGIINALAFVAVAFLVVWFGMRPLARQLGFGGQAGKLEGEAAG 479

Query: 477 KSILSPPPISSAVTTGLMP--NDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHM 534
             +    P  +     LM     +   D  + D+ +     ++  N  V +  + RL  M
Sbjct: 480 LELPDFSPAGAGAGGALMEGFGSDFGFDGGD-DLLNLGD--EAGFNRRVKEGPERRLARM 536

Query: 535 IEINEERFAKILRKWA 550
           +EI+EER AKILRKWA
Sbjct: 537 VEISEERAAKILRKWA 552


>gi|150395469|ref|YP_001325936.1| flagellar MS-ring protein [Sinorhizobium medicae WSM419]
 gi|150026984|gb|ABR59101.1| flagellar M-ring protein FliF [Sinorhizobium medicae WSM419]
          Length = 557

 Score =  515 bits (1327), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 274/557 (49%), Positives = 371/557 (66%), Gaps = 12/557 (2%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M + DQ   F K+ ++LG+ +++ LA   +V I   + A  +VN P ++ LYV LE SDV
Sbjct: 1   MNLFDQFSTFTKNLSNLGQGKLIALAVAGIVAIGFVLGAGVYVNRPSFETLYVGLERSDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
            +IS+AL+EAN+DF +  +G SI VP  M GKAR+ LA +GLPSS+ N+GYELFD V S 
Sbjct: 61  TQISIALAEANVDFEVGTDGGSIQVPVGMTGKARLLLAERGLPSSA-NAGYELFDNVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQ ISGI AARVHIVMP+ GSFRK    PTASVMIRA 
Sbjct: 120 GLTSFMQEVTRVRALEGEIARTIQQISGIAAARVHIVMPERGSFRKAEQTPTASVMIRA- 178

Query: 181 NPSVYKSAEA-IRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQ 238
           + +V +SA A IRHLVA++VP LD+ DVTVLDSTG+LL + +   N  L +SL +VQ +Q
Sbjct: 179 SATVGRSAAASIRHLVASSVPGLDVDDVTVLDSTGQLLASGDDPANSALNQSLGVVQNVQ 238

Query: 239 HEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE 298
            ++E  I+ ALA FLG+DNFR++V A LN D QQI+E V+DP+S+VERS R+ K+ Q+S 
Sbjct: 239 TDLEKKIDNALAPFLGMDNFRTSVTARLNTDAQQIQETVFDPESRVERSTRVIKEEQKSS 298

Query: 299 TSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLS 358
             QP++A TV+QN+P  +       +S +   KKEEQ+NYEIN+K+IAT  ++Y +ERLS
Sbjct: 299 QQQPDNAATVQQNVPQAAPTGGAGQQSSDEAAKKEEQTNYEINSKTIATVKNSYSIERLS 358

Query: 359 IAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQL 418
           IAVVVN+GRL  + G  ADQ KID+YL ++ KIV++A GI+  RGD +T+ +MDF+E QL
Sbjct: 359 IAVVVNRGRLAAMAGEPADQAKIDAYLVQMQKIVASAAGIDPGRGDVVTLNAMDFVETQL 418

Query: 419 FNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAK---KGEVG 475
            +        M++L+R+   +INAL F+    LV + G+  L R            GE  
Sbjct: 419 LDQAVPGPGMMEVLTRNIGGIINALAFVAVAFLVVWFGMRPLARQMGFGGQSGQLAGEAA 478

Query: 476 GKSILSPPPISSAVTTGLMP--NDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLH 533
           G  +    P ++     LM     +   D  + D+ +     ++  N  V +  + RL  
Sbjct: 479 GLELPDFSPAAAGAGGALMEGFGSDFGFDGGD-DLLNLGD--EAGFNRRVKEGPERRLAR 535

Query: 534 MIEINEERFAKILRKWA 550
           M+EI+EER AKILRKWA
Sbjct: 536 MVEISEERAAKILRKWA 552


>gi|163757999|ref|ZP_02165087.1| flagellar M-ring protein [Hoeflea phototrophica DFL-43]
 gi|162284288|gb|EDQ34571.1| flagellar M-ring protein [Hoeflea phototrophica DFL-43]
          Length = 560

 Score =  456 bits (1173), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 252/561 (44%), Positives = 366/561 (65%), Gaps = 11/561 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M++L+QL Q  K+  SLG+ R+L L  V    + L +AA  F+N P  + LY+ L   D+
Sbjct: 1   MSLLNQLSQIGKNLASLGQARMLTLGGVGAASVALIIAAALFLNKPARETLYIGLSGEDM 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
            +IS+ L+E+NIDF    +G+SI+VP+ M  +AR+ LA +GLPSS++ +GYELFDKV S 
Sbjct: 61  TQISLVLAESNIDFASGLDGNSITVPAGMTSRARMLLAERGLPSSNT-AGYELFDKVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQSI+GI AARVH+VM D G+FR+   +P+ASVM+R  
Sbjct: 120 GLTSFMQEVTRVRALEGEIARTIQSINGISAARVHLVMADRGNFRRGEQQPSASVMVRTG 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQH 239
                ++A +IRHLVA++VP L++ +VTVLD+TG+LL T ++   + L +SLSIVQ +Q+
Sbjct: 180 TNLAPRTANSIRHLVASSVPGLNVDEVTVLDATGQLLATGDDFSNSNLNRSLSIVQLVQN 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           E+E NI KALA FLG++NFR++V A +N D+QQ++E ++DP+S+VERS R++++ Q S  
Sbjct: 240 EVETNIEKALAPFLGIENFRASVTATVNTDSQQVQETIFDPESRVERSTRVTRENQTSNQ 299

Query: 300 SQPESAVTVEQNMPH--VSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
           S  ++  TVEQN+P    +      P+S E  ++KEEQ+NYEIN+K I+T  ++Y +E L
Sbjct: 300 SATDTPATVEQNIPDQGPAAGGAAGPQSSELAERKEEQTNYEINSKVISTVRNSYTVEGL 359

Query: 358 SIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           S+AVVVN+ R+ ++ G +  + +  ++LAE+  +V+ A G++  RGD   IT MDF+ ++
Sbjct: 360 SVAVVVNRARIADMYGGAPTEEQTAAFLAEVQTLVNLAAGVDDERGDRANITVMDFMASE 419

Query: 418 LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGK 477
           L  +   Q  F D L  H  T+INA+ F+   +L+   G   L  L     A++ E    
Sbjct: 420 LLTADAAQGGFGDTLKTHIGTIINAIAFITVAVLLIMFGFRPL--LGAGKTAEQAEDAVD 477

Query: 478 SI-LSPPPISSAV--TTGLMPNDNIALD-SSNQDIFSHSRNLQS-RINSYVSKQSDLRLL 532
            I L  P  S A     G MP +    D    +D  S     +S   N  V +  + RL 
Sbjct: 478 DIGLELPDFSPAAMGGPGAMPMEGFGADFGFGEDGDSELEMEESGSFNRRVKEGPERRLA 537

Query: 533 HMIEINEERFAKILRKWARSE 553
            M+EINEER AKILR+W+  E
Sbjct: 538 RMVEINEERAAKILRQWSSGE 558


>gi|110632647|ref|YP_672855.1| flagellar MS-ring protein [Mesorhizobium sp. BNC1]
 gi|110283631|gb|ABG61690.1| flagellar M-ring protein FliF [Chelativorans sp. BNC1]
          Length = 545

 Score =  411 bits (1057), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 232/556 (41%), Positives = 349/556 (62%), Gaps = 21/556 (3%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           +QL    ++  +LG  R+ ++  V+ + + +      ++N P Y+ LYV LE SDVN+I 
Sbjct: 3   EQLRTIVENLRALGPRRLAMMGGVLALTLAVVTGGAIYLNRPAYETLYVGLERSDVNQIG 62

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
           + L EA I F +  +G+++ VP+    +AR+ LA +GLPSS+ N+GYELFD V S GLT+
Sbjct: 63  LVLGEAGIRFDVVSDGTAVLVPTGKTAEARMLLAEKGLPSSA-NAGYELFDTVGSLGLTT 121

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV 184
           FMQE+TRVRALEGEIARTI+SI+GI AARVHIVMP+ G+FR+ G  P+ASV+IR      
Sbjct: 122 FMQEVTRVRALEGEIARTIRSIAGIRAARVHIVMPERGNFRREGQEPSASVVIRTSGIDG 181

Query: 185 YKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA-NEMERNILGKSLSIVQAIQHEIEM 243
              A +IR+LVAAAVP L    VTVLDS+G LL A ++   N   +S+ I + ++ ++E 
Sbjct: 182 AAKAASIRYLVAAAVPGLSAEKVTVLDSSGMLLAAGDDPANNTAQRSIGIERTVEAQVEE 241

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
           NI +ALA +LG DNFR++V AE+N DT+Q+ E+++DPDS+VERS+++ + A  +      
Sbjct: 242 NIRRALAPYLGPDNFRASVKAEVNTDTRQVEEVIFDPDSRVERSVQIVRTADSATRETAA 301

Query: 304 SAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVV 363
           +  TV QN+P        LPRS E ++++EE +NYE+NTK IAT+ + Y++ RLSIAVVV
Sbjct: 302 TPTTVLQNLPQEEPAPAELPRSSEESERREETTNYELNTKRIATSSNGYQVTRLSIAVVV 361

Query: 364 NKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGT 423
           N+GRL  +LG +A    + + + EI  +V++A G+N  RGD + + +++F++  L     
Sbjct: 362 NEGRLAAILGDNAAPDALQTRIREIETVVASAAGLNETRGDVLNVAAVEFVDG-LDGVEM 420

Query: 424 VQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH----ALRRLHNIDDAKKGEVGGKSI 479
            +   +  L RH  T+INAL F++    +T+ GL     AL R   I+ +  GE      
Sbjct: 421 AEPGPLAALGRHSGTMINALAFVLAAFFITWFGLRPLATALTRGPEIEASAAGE------ 474

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
                I +    G   ++ +AL + N    S   N + ++    + Q+   L  M+++NE
Sbjct: 475 ----EIQALSQEGA--DERLALTAGNGVQSSEEANDEPQLKIKPAPQA--LLARMVDLNE 526

Query: 540 ERFAKILRKWARSEIE 555
           ER A ILRKWAR+E+E
Sbjct: 527 ERTADILRKWARAEVE 542


>gi|319781672|ref|YP_004141148.1| flagellar M-ring protein FliF [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167560|gb|ADV11098.1| flagellar M-ring protein FliF [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 548

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 229/556 (41%), Positives = 336/556 (60%), Gaps = 40/556 (7%)

Query: 16  SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFR 75
             G  R+ +LA + ++ + +   A  ++N P YD LYV L+ +DVN+I + L EA I F 
Sbjct: 14  GFGVKRLAMLAGIAVLVMGVIGIASVYLNRPAYDTLYVGLDRADVNQIGLVLGEAGIGFD 73

Query: 76  ISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRAL 135
           +  +G+S+ VP+    +AR+ LA +GLP+S+ N+GYELFD V S GLTSFMQ+ITRVRAL
Sbjct: 74  VGADGTSVLVPAGTTAQARMLLAEKGLPTSA-NAGYELFDNVGSLGLTSFMQQITRVRAL 132

Query: 136 EGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLV 195
           EGEIARTIQSISGI AARVHIVM +  +FR+   +P+ASV+IR       KSA +IRHLV
Sbjct: 133 EGEIARTIQSISGIKAARVHIVMSERANFRRDEQQPSASVVIRYAGIDAEKSAMSIRHLV 192

Query: 196 AAAVPNLDMGDVTVLDSTGKLLTANEMERNI-LGKSLSIVQAIQHEIEMNINKALAAFLG 254
           AAAVP L    VTVLDS+G LL A +   N    ++L + Q ++ +I  NI +AL A+LG
Sbjct: 193 AAAVPGLSADKVTVLDSSGNLLAAGDDPSNTSAARTLGVEQTVEAQIGDNIRRALTAYLG 252

Query: 255 VDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPH 314
            DNFR++V AE+N DT+Q  E ++DP+S+VERS++  +  + +   Q  +  +VEQN+P 
Sbjct: 253 PDNFRASVKAEVNTDTRQTEETIFDPNSRVERSVQSVRANENNNQKQASTPASVEQNLPE 312

Query: 315 VSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGR 374
                   P+S    D++EE +NYEIN+K IAT  + Y + ++SIAVVVN+ RLT +LG+
Sbjct: 313 TQATATDGPQSSSQNDRREEITNYEINSKKIATVSNGYTVTKMSIAVVVNQQRLTTILGK 372

Query: 375 SADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSR 434
            A   +I   +AEI K+V++ATG++ +RGD I +++++F++  L      Q   +D + +
Sbjct: 373 DATPEQIAKRVAEIQKMVTSATGLDEKRGDIIDVSAVEFIDG-LDGEAIPQAGMLDSIGQ 431

Query: 435 HFATVINALVFLVGTLLVTFLGLHALRRLH-----------NIDDAKKGEVGGKSILSPP 483
           H  T+INA  F+V   LV F GL  +               + DD ++      S+ +P 
Sbjct: 432 HAGTMINAGAFIVVVFLVAFFGLRPMAAALTAKAAPALAGPSFDDVQR------SLPTPE 485

Query: 484 PISSA--VTTGLMPNDN---IALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEIN 538
            +++      G +P        LD   Q I    ++               RL  M+++N
Sbjct: 486 AMAATDNAAVGALPGTRPGPTPLDDLRQKIRPAPQD---------------RLARMVDLN 530

Query: 539 EERFAKILRKWARSEI 554
           EER A+ILRKWA  E+
Sbjct: 531 EERTAQILRKWASQEV 546


>gi|13472585|ref|NP_104152.1| flagellar MS-ring protein [Mesorhizobium loti MAFF303099]
 gi|14023331|dbj|BAB49938.1| flagellar basal-body MS-ring protein; FliF [Mesorhizobium loti
           MAFF303099]
          Length = 549

 Score =  405 bits (1041), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 231/553 (41%), Positives = 333/553 (60%), Gaps = 33/553 (5%)

Query: 16  SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFR 75
             G  R+ +LA + ++ + +   A  ++N P YD LYV L+ +DVN+I + L EA I F 
Sbjct: 14  GFGVKRLAMLAGIAVLVMGVIGIASVYLNRPAYDTLYVGLDRADVNQIGLVLGEAGIGFD 73

Query: 76  ISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRAL 135
           +  +G+S+ VP+    +AR+ LA +GLP+S+ N+GYELFD V + GLTSFMQ+ITRVRAL
Sbjct: 74  VGSDGTSVLVPAGTTAQARMLLAEKGLPTSA-NAGYELFDNVGAMGLTSFMQQITRVRAL 132

Query: 136 EGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLV 195
           EGEIARTIQSISGI AARVHIVM +  +FR+   +P+ASV+IR       KSA++IRHLV
Sbjct: 133 EGEIARTIQSISGIKAARVHIVMSERANFRRDEQQPSASVVIRYAGIDAEKSAQSIRHLV 192

Query: 196 AAAVPNLDMGDVTVLDSTGKLLTANEMERNI-LGKSLSIVQAIQHEIEMNINKALAAFLG 254
           AAAVP L    VTVLDS G LL A +   N    ++L + Q ++ +I  NI +AL  +LG
Sbjct: 193 AAAVPGLSADKVTVLDSNGNLLAAGDDPSNTSAARTLGVEQTVEAQIGDNIRRALTPYLG 252

Query: 255 VDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPH 314
            DNFR++V AE+N DT+Q  E ++DP+S+VERS++  +  + S   Q  +  +VEQN+P 
Sbjct: 253 PDNFRASVKAEVNTDTRQTEETIFDPNSRVERSVQSVRANENSNQKQASTPASVEQNLPE 312

Query: 315 VSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGR 374
                   P++    D+KEE +NYEIN+K IAT  + Y + ++SIAVVVN+ RL  +LG+
Sbjct: 313 TQATSTEGPQTTSANDRKEEITNYEINSKKIATVSNGYTVTKMSIAVVVNQDRLKTILGK 372

Query: 375 SADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSR 434
            A   +I   +AEI K+V++ATG++ +RGD I +++++F++  L      Q   +D + +
Sbjct: 373 DATPEQIAKRVAEIQKMVTSATGLDDKRGDVIDVSAVEFIDG-LDGEAIPQAGMLDSIGQ 431

Query: 435 HFATVINALVFLVGTLLVTFLGLHAL------RRLHNIDDAKKGEVGGKSILSPPPISSA 488
           H  T+INA  F+V   LV F GL  +      R    +      EV  +S+ +P   +SA
Sbjct: 432 HAGTLINAGAFIVVVFLVAFFGLRPMAAALTARATPALSGPNFDEV-QRSLPTPEAAASA 490

Query: 489 VTT-------GLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEER 541
                     G  P  N  LD   Q I    +                RL  M+++NEER
Sbjct: 491 DAGAAIGALPGSRPGTN-PLDDLRQKIRPAPQE---------------RLARMVDLNEER 534

Query: 542 FAKILRKWARSEI 554
            A+ILRKWA  E+
Sbjct: 535 TAQILRKWAAQEV 547


>gi|260466610|ref|ZP_05812798.1| flagellar M-ring protein FliF [Mesorhizobium opportunistum WSM2075]
 gi|259029616|gb|EEW30904.1| flagellar M-ring protein FliF [Mesorhizobium opportunistum WSM2075]
          Length = 549

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 226/543 (41%), Positives = 326/543 (60%), Gaps = 13/543 (2%)

Query: 16  SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFR 75
             G  R+ +LA + ++ + +   A  ++N P YD LYV L+ SDVN+I + L EA I F 
Sbjct: 14  GFGVKRLAMLAGIAVLVMGVIGIASVYLNRPAYDTLYVGLDRSDVNQIGLVLGEAGIGFD 73

Query: 76  ISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRAL 135
           +  +G+S+ VP+    +AR+ LA +GLP+S+ N+GYELFD V + GLTSFMQ+ITRVRAL
Sbjct: 74  VGADGTSVLVPAGTTAQARMLLAEKGLPTSA-NAGYELFDNVGAMGLTSFMQQITRVRAL 132

Query: 136 EGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLV 195
           EGEIARTIQSI+GI AARVHIVM +  +FR+   +P+ASV+IR       KSA +IRHLV
Sbjct: 133 EGEIARTIQSIAGIKAARVHIVMSERANFRRDEQQPSASVVIRYAGIDAEKSAMSIRHLV 192

Query: 196 AAAVPNLDMGDVTVLDSTGKLLTANEMERNI-LGKSLSIVQAIQHEIEMNINKALAAFLG 254
           AAAVP L    VTVLDS G LL A +   N    ++L + Q ++ +I  NI +AL  +LG
Sbjct: 193 AAAVPGLSADKVTVLDSNGNLLAAGDDPSNTSAARTLGVEQTVEAQIGDNIRRALTPYLG 252

Query: 255 VDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPH 314
            DNFR++V AE+N DT+Q  E ++DP+S+VERS++  +  + S   Q  +  +VEQN+P 
Sbjct: 253 PDNFRASVKAEVNTDTRQTEETIFDPNSRVERSVQSVRANENSNQKQASTPASVEQNLPE 312

Query: 315 VSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGR 374
                   P++    D+KEE +NYEIN+K IAT  + Y + ++SIAVVVN+ RL  +LG+
Sbjct: 313 TQAASTEGPQTSSANDRKEEITNYEINSKKIATVSNGYTVTKMSIAVVVNQDRLKTILGK 372

Query: 375 SADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSR 434
            A   +I   +AEI K+VS+ATG + +RGD I +++++F++  L      Q   +D + +
Sbjct: 373 DATPEQIAKRVAEIQKMVSSATGFDDKRGDVIDVSAVEFIDG-LDGEAVPQAGMLDSIGQ 431

Query: 435 HFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLM 494
           H  T+INA  F+V   LV F GL  +             + G       P    V   L 
Sbjct: 432 HAGTLINAGAFIVVVFLVAFFGLRPMAAALTAKATPTPAISG-------PNFDEVQRSLP 484

Query: 495 PNDNIALDSSNQDIFSHSRNLQSRINSYVSK---QSDLRLLHMIEINEERFAKILRKWAR 551
             +  A  ++       +R   + ++    K       RL  M++INEER A+ILRKWA 
Sbjct: 485 TPEAAASANAAVGALPSARPGATPLDDLRQKIRPAPQERLARMVDINEERTAQILRKWAA 544

Query: 552 SEI 554
            E+
Sbjct: 545 QEV 547


>gi|319409176|emb|CBI82820.1| Flagellar M-ring protein [Bartonella schoenbuchensis R1]
          Length = 555

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 225/558 (40%), Positives = 338/558 (60%), Gaps = 25/558 (4%)

Query: 3   ILDQLLQFFKS-GTSLGRTRILILASVILVPIMLF---MAARFFVNSPHYDNLYVKLEVS 58
           +LD+LL F  S G +L +  +  L ++ LV I LF   + + F++  P Y+ LY+ L   
Sbjct: 1   MLDKLLAFLSSSGQALQKLGVKRLVALGLVGITLFGTILFSSFYLTRPSYETLYIGLSRD 60

Query: 59  DVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVN 118
           DVNR+ VAL E  I F +S +GSSI VP     KAR+ LA +GLP+S+ N+GYELFD + 
Sbjct: 61  DVNRMGVALGETGIAFDVSSDGSSIQVPVGQAEKARMFLAEKGLPTSN-NAGYELFDNMG 119

Query: 119 SFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR 178
           S GLTSFMQEITR RALEGEIARTIQ + G+ AARVHIV+PD GSFRK   +PTASV+IR
Sbjct: 120 SLGLTSFMQEITRQRALEGEIARTIQVVQGVKAARVHIVLPDKGSFRKANQKPTASVVIR 179

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIV-QAI 237
                  +SA++IR LV+AAVP+L+   VTV+D+ G+LL +     N     ++++ Q +
Sbjct: 180 TDGGFSAESAQSIRQLVSAAVPSLEASSVTVMDTRGQLLASGVDAANGASVRMALLEQQV 239

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRS 297
             +I+ NI K L  +LG+D+F+++V  +L+ + QQI E V+DP+S+V RS+R  +D   S
Sbjct: 240 ASQIDANIRKQLVPYLGLDHFQTSVQVDLDTNRQQINETVFDPESQVVRSVRSVRDQADS 299

Query: 298 ETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
           + S+   AV VEQN+P          RS +  D++EE +NYEIN+K I+T  D Y +++L
Sbjct: 300 QNSRNNDAVGVEQNIPQEEIANGGGERSTDKKDRREETTNYEINSKIISTVKDGYSVKKL 359

Query: 358 SIAVVVNKGRLTEVLGRSAD-QGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLEN 416
           ++A+VV++ RL    G + D +  I+  +  I ++V+ A G++ +RGD I +T++DF+  
Sbjct: 360 AVAIVVDRARLALAKGNNGDSESFINDEINRIQQMVATAAGLDPKRGDVINVTAVDFMGY 419

Query: 417 QLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRR-----LHNIDDAKK 471
              +   +Q      LS + +T +N L  +V  LL+ FLG+  L R        +D+ + 
Sbjct: 420 SDKDLTPMQTPIWKSLSPYLSTFVNGLALVVAVLLILFLGVRPLMREMREGQKALDNEQN 479

Query: 472 GEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRL 531
              G + +  P   + +   G       A D +  D+ S  R         V+ Q+  RL
Sbjct: 480 ALAGLQDV--PALENQSNINGEFGGIAGAKDDTLNDLRSRMR---------VAPQN--RL 526

Query: 532 LHMIEINEERFAKILRKW 549
             MIEI+E+RFA++LR+W
Sbjct: 527 EKMIEIDEQRFAEVLREW 544


>gi|319898649|ref|YP_004158742.1| flagellar M-ring protein [Bartonella clarridgeiae 73]
 gi|319402613|emb|CBI76158.1| Flagellar M-ring protein [Bartonella clarridgeiae 73]
          Length = 557

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 216/556 (38%), Positives = 337/556 (60%), Gaps = 18/556 (3%)

Query: 3   ILDQLLQFFKSGTS----LGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVS 58
           ++D+ L F  S  +    LG  R++ L  + L      + + F++  P Y+ LYV L   
Sbjct: 1   MIDKFLAFLSSSGNALHKLGAKRLIALGIIGLTLFGTILFSSFYLTRPVYETLYVGLSRD 60

Query: 59  DVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVN 118
           DVNR+ +AL E  I F +S +GS++ VP     +AR+ LA +GLP+S+ N+GYELFD + 
Sbjct: 61  DVNRMGMALGEVGIAFDVSADGSTVQVPVGQAEQARMFLAEKGLPTSN-NAGYELFDNMG 119

Query: 119 SFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR 178
           S GLTSFMQEITR RALEGEIARTIQ + G+ AARVHIV+PD GSFRK   +PTASV+IR
Sbjct: 120 SLGLTSFMQEITRQRALEGEIARTIQVVQGVKAARVHIVLPDKGSFRKANQKPTASVVIR 179

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSL---SIVQ 235
                  +SA++IR LVAAAVP+L+   VTV+D+ G+LL +     N  G S+   S+ Q
Sbjct: 180 TNGGFAVESAQSIRQLVAAAVPSLEASSVTVMDTRGQLLASGVDAMN--GTSMMMASLEQ 237

Query: 236 AIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQ 295
            +  +I+ NI K L  +LG+D+F+++V   L+ D +Q  E V+DP+S+V RS+R  +D  
Sbjct: 238 QVASQIDANIRKQLVPYLGLDHFQTSVQVVLDTDRRQTNETVFDPESQVVRSVRSVRDQA 297

Query: 296 RSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLE 355
            S+ ++   AV VEQN+P          RS +  D++EE +NYEIN+K+I+T  D Y ++
Sbjct: 298 DSQNNRNSDAVGVEQNIPQEEIANGSGERSTDKKDRREETTNYEINSKTISTVSDGYSVK 357

Query: 356 RLSIAVVVNKGRLT-EVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFL 414
           +L++A+VV++ RLT     +   +  ++  +  I ++V+ A G++ +RGD I +T++DF+
Sbjct: 358 KLAVAIVVDRARLTLPDSTKPTSESALNEEINRIQQMVATAAGLDPKRGDIINVTAVDFI 417

Query: 415 ENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEV 474
            +   +   VQ+    +LSR+ + +IN +  ++  LL+ FLG+  L R   + + KK   
Sbjct: 418 GHTESDMIPVQMPLWKLLSRYTSALINGVALVIAVLLILFLGVRPLMR--EMREGKKALE 475

Query: 475 GGKSILSPPPISSAVTTGLMPNDNIA-LDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLH 533
             K+ ++      A+      N   + +  ++ D      NL++R+   V  Q+  RL  
Sbjct: 476 NSKNAMADLENIPALEHQYQANAEFSGITGTSDDTHDALHNLRNRMR--VPPQN--RLEQ 531

Query: 534 MIEINEERFAKILRKW 549
           MI ++EERFA +LR+W
Sbjct: 532 MIAMDEERFAGVLREW 547


>gi|121602745|ref|YP_989390.1| flagellar MS-ring protein [Bartonella bacilliformis KC583]
 gi|120614922|gb|ABM45523.1| flagellar M-ring protein FliF [Bartonella bacilliformis KC583]
          Length = 553

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 219/560 (39%), Positives = 339/560 (60%), Gaps = 29/560 (5%)

Query: 3   ILDQLLQFFKSGTS----LGRTRILILASVILVPIMLF---MAARFFVNSPHYDNLYVKL 55
           +LD+   F  S  S    LG  R++ L    LV + LF   + + F++  P ++ LYV L
Sbjct: 1   MLDKFFVFLSSSGSALYKLGAKRLIALG---LVGVTLFGTILFSSFYLTRPSHETLYVGL 57

Query: 56  EVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFD 115
              DVNRI +AL EA I F +S +G S+ VP      AR+ LA +GLP+S+ N+GYELFD
Sbjct: 58  SRDDVNRIGMALGEAGIAFDVSSDGGSVQVPVGQAEHARMFLAEKGLPTSN-NAGYELFD 116

Query: 116 KVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASV 175
            + S GLTSFMQEITR RALEGEIARTIQ++ G+ AARVHIV+PD GSFR+   +PTASV
Sbjct: 117 NMGSLGLTSFMQEITRQRALEGEIARTIQAVQGVKAARVHIVLPDKGSFRRANQKPTASV 176

Query: 176 MIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQ 235
           +IR       +SA++IRHLVAAAVP+L+   VTV+D+ G++L +     + +  +  ++ 
Sbjct: 177 VIRTDGGFSVESAQSIRHLVAAAVPSLEASSVTVMDTRGQMLASGV---DAINGAPVVMA 233

Query: 236 AIQH----EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLS 291
           +++H    +I+ NI K L  +LG+D+F+++V   L+ D +QI E ++DP+S+V RSIR  
Sbjct: 234 SLEHQVASQIDANIRKQLVPYLGLDHFQTSVQVALDTDRRQINETIFDPESQVVRSIRSV 293

Query: 292 KDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDN 351
           +D   S+ S+   AV VEQN+P           S +  D++EE +NYEIN+K I+T  D 
Sbjct: 294 RDQADSQNSRNSDAVGVEQNIPQEEIANGSGETSTDKKDRREETTNYEINSKIISTVRDG 353

Query: 352 YKLERLSIAVVVNKGRLTEVLGRSA-DQGKIDSYLAEINKIVSAATGINSRRGDTITITS 410
           Y +++L+IA+VV++ RL    G +   +  I+  +  I ++VSAA G++  RGD I +T+
Sbjct: 354 YSVKKLAIAIVVDRARLVPANGETTVSEDFINDEVNRIQQMVSAAAGLDPNRGDIINVTA 413

Query: 411 MDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAK 470
           +DF+ +   +   ++      +SR+   V+N +  ++  LL+ FLG+  L R   + + +
Sbjct: 414 VDFIGHNDADLTPIETPLWKSVSRYIPGVVNGVALVIAVLLILFLGVRPLMR--EMREGQ 471

Query: 471 KGEVGGKSILSPPPISSAVTTGLMPNDNI-ALDSSNQDIFSHSRNLQSRINSYVSKQSDL 529
           K    G++ L+      A+         +  +  +N D     R+L++R+   V  Q+  
Sbjct: 472 KARNSGENALAGLGAVPALDNQSQAAAGVGGVTKTNDDTL---RDLRNRMR--VPPQN-- 524

Query: 530 RLLHMIEINEERFAKILRKW 549
           RL  MI+++EERFA ILR+W
Sbjct: 525 RLEKMIDMDEERFAGILREW 544


>gi|319403971|emb|CBI77559.1| Flagellar M-ring protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 554

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 222/563 (39%), Positives = 336/563 (59%), Gaps = 35/563 (6%)

Query: 3   ILDQLLQFFKSGTS----LGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVS 58
           +LD+ L F  S  +    LG  R++ L  V L      + + F++  P Y+ LYV L   
Sbjct: 1   MLDKFLAFLSSSGNALHKLGVKRLIALGMVGLTLFGTILFSSFYLTRPIYEILYVGLSRD 60

Query: 59  DVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVN 118
           DVNR+ +AL EA I F +S +GS++ VP     +AR+ LA +GLP+S+ N+GYELFD + 
Sbjct: 61  DVNRMGMALGEAGIAFDVSSDGSTVQVPVGQAEQARMFLAEKGLPTSN-NAGYELFDNMG 119

Query: 119 SFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR 178
           S GLTSFMQEITR RALEGEIARTIQ++ G+ AARVHIV+PD GSFRK   +PTASV+IR
Sbjct: 120 SLGLTSFMQEITRQRALEGEIARTIQAVQGLKAARVHIVLPDKGSFRKANQKPTASVVIR 179

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSL---SIVQ 235
             +    + A++IR LVAAAVP+L+   VTV+D+ G+LL +     N  G S+   S+ Q
Sbjct: 180 TNSGFAVEFAQSIRQLVAAAVPSLEASSVTVMDTRGQLLASGVDAMN--GASMMMASLEQ 237

Query: 236 AIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQ 295
            +  +I+ NI K L  +LG+D+F+++V   L+ D +Q  E V+DP+S+V RS+R  +D  
Sbjct: 238 QVASQIDANIRKQLVPYLGLDHFQTSVQVVLDTDRRQTNETVFDPESQVVRSVRSVRDQA 297

Query: 296 RSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLE 355
            S+ ++   AV VEQN+P          RS +  D++EE +NYEIN+K+I+T  D Y ++
Sbjct: 298 DSQNNRNSDAVGVEQNIPQEEIANGGGERSTDKKDRREEITNYEINSKTISTVSDGYSVK 357

Query: 356 RLSIAVVVNKGRLTEVLG-RSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFL 414
           +L++A+VV++ RL    G +   +  ++  +  I ++V+ A G++ +RGD I +T++DF+
Sbjct: 358 KLAVAIVVDRARLVLPDGTKPTSENALNDEVNRIQQMVATAAGLDPKRGDIINVTAVDFV 417

Query: 415 ENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRR--------LHNI 466
            N   +   VQ      LSR+ + +IN +  ++   L+ FLG+  L R        L N 
Sbjct: 418 GNSEADMAPVQEPLWKSLSRYTSGLINGVALVIAVFLILFLGVRPLMREMREGKKALENS 477

Query: 467 DDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQ 526
           ++A  G +G    L      +A   G+   +N  L            NL++R+   V  Q
Sbjct: 478 ENAVAG-LGNIPALEHQYQDNAEFGGVTGTNNDTL-----------HNLRNRMR--VPPQ 523

Query: 527 SDLRLLHMIEINEERFAKILRKW 549
           +  RL  MI ++EERFA +LR+W
Sbjct: 524 N--RLEQMIAMDEERFAGVLREW 544


>gi|319406987|emb|CBI80624.1| Flagellar M-ring protein [Bartonella sp. 1-1C]
          Length = 554

 Score =  366 bits (940), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 221/563 (39%), Positives = 334/563 (59%), Gaps = 35/563 (6%)

Query: 3   ILDQLLQFFKSGTS----LGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVS 58
           +LD+   F  S  +    LG  R++ L  V L      + + F++  P Y+ LYV L   
Sbjct: 1   MLDKFWVFLSSSGNALHKLGVKRLIALGMVGLTLFGTILFSSFYLTRPIYETLYVGLSRD 60

Query: 59  DVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVN 118
           DVNR+ +ALSEA I F +S +G ++ VP     +AR+ LA +GLP+S+ N+GYELFD + 
Sbjct: 61  DVNRMGMALSEAGIAFDVSSDGGTVQVPVGQAEQARMFLAEKGLPTSN-NAGYELFDNMG 119

Query: 119 SFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR 178
           S GLTSFMQEITR RALEGEIARTIQ + G+ AARVHIV+PD GSFRK   +PTASV+IR
Sbjct: 120 SLGLTSFMQEITRQRALEGEIARTIQVVQGVKAARVHIVLPDKGSFRKANQKPTASVVIR 179

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSL---SIVQ 235
             +    + A++IR LVAAAVP+L+   VTV+D+ G+LL +     N  G S+   S+ Q
Sbjct: 180 TNSSFSVEFAQSIRQLVAAAVPSLEASSVTVMDTRGQLLASGVDAMN--GASMMMASLEQ 237

Query: 236 AIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQ 295
            +  +I+ NI K L  +LG+D+F+++V   L+ D +Q  E V+DP+S+V RS+R  +D  
Sbjct: 238 QVASQIDANIRKQLVPYLGLDHFQTSVQVVLDTDRRQTNETVFDPESQVVRSVRSVRDQA 297

Query: 296 RSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLE 355
            S+ ++   AV VEQN+P          RS +  D++EE +NYEIN+K+I+T  D Y ++
Sbjct: 298 DSQNNRNSDAVGVEQNIPQEEIANGGGERSTDKKDRREEITNYEINSKTISTVSDGYSVK 357

Query: 356 RLSIAVVVNKGRLTEVLG-RSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFL 414
           +L++A+VV++ RL    G +   +  ++  +  I ++V+ A G++ +RGD I +T++DF+
Sbjct: 358 KLAVAIVVDRARLVLPDGTKPTSENALNDEVNRIQQMVATAAGLDPKRGDIINVTAVDFV 417

Query: 415 ENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRR--------LHNI 466
            N   +   +Q      LSR+ + +IN +  ++   L+ FLG+  L R        L N 
Sbjct: 418 GNSEADMAPIQEPLWKSLSRYTSGLINGVALVIAVFLILFLGVRPLMREMREGKKALENS 477

Query: 467 DDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQ 526
            +A  G +G    L      +A   G+          +N D  S   NL++R+   V  Q
Sbjct: 478 ANAVAG-LGNIPALEHQYQDNAEFGGVT--------GTNNDTLS---NLRNRMR--VPPQ 523

Query: 527 SDLRLLHMIEINEERFAKILRKW 549
           +  RL  MI ++EERFA +LR+W
Sbjct: 524 N--RLEQMIAMDEERFAGVLREW 544


>gi|319405414|emb|CBI79033.1| Flagellar M-ring protein FliF [Bartonella sp. AR 15-3]
          Length = 554

 Score =  366 bits (940), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 217/556 (39%), Positives = 335/556 (60%), Gaps = 21/556 (3%)

Query: 3   ILDQLLQFFKSGTS----LGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVS 58
           + D+ L F  S  +    LG  R++ L  V L      + + F++  P Y+ LYV L   
Sbjct: 1   MFDKFLAFLSSSGNALYKLGVKRLIALGMVGLTLFGTILFSSFYLTRPVYETLYVGLSRD 60

Query: 59  DVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVN 118
           DVNR+ +AL EA I F +S +GS + VP     +AR+ LA +GLP+S+ N+GYELFD + 
Sbjct: 61  DVNRMGMALGEAGIAFDVSSDGSVVQVPVGQAEQARMFLAEKGLPTSN-NAGYELFDNMG 119

Query: 119 SFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR 178
           S GLTSFMQEITR RALEGEIARTIQ + G+ AARVHIV+PD GSFRK   +PTASV+IR
Sbjct: 120 SLGLTSFMQEITRQRALEGEIARTIQVVQGVKAARVHIVLPDKGSFRKANQKPTASVVIR 179

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSL---SIVQ 235
             +    +SA++IR LVAAAVP+L+   VTV+D+ G+LL +     N  G S+   S+ Q
Sbjct: 180 TNSGFAVESAQSIRQLVAAAVPSLEASSVTVMDTRGQLLASGVDAMN--GASIMMASLEQ 237

Query: 236 AIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQ 295
            +  +I+ NI K L  +LG+D+F+++V   L+ D +Q  E V+DP+S+V RS+R  +D  
Sbjct: 238 QVASQIDANIRKQLVPYLGLDHFQTSVQVVLDTDRRQTNETVFDPESQVVRSVRSVRDQA 297

Query: 296 RSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLE 355
            S+ ++   AV VEQN+P           S +  D++EE +NYEIN+K+I+T  D Y ++
Sbjct: 298 DSQNNRNSDAVGVEQNIPQEEIANGGGETSTDKKDRREEITNYEINSKTISTVSDGYSVK 357

Query: 356 RLSIAVVVNKGRLTEVLG-RSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFL 414
           +L++A+VV++ RL    G +   +  ++  +  I ++V+AA G++ +RGD I +T++DF+
Sbjct: 358 KLAVAIVVDRARLILPDGTKPTSENALNDEVNRIQQMVAAAAGLDPKRGDIINVTAVDFV 417

Query: 415 ENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEV 474
            +   +   VQ      LSR+ + +IN +  ++   L+ FLG+  L R   + + KK   
Sbjct: 418 GHSEADMAPVQTPIWKSLSRYTSGLINGVALVIAVFLILFLGVRPLMR--EMREGKKALE 475

Query: 475 GGKSILSPPPISSAVTTGLMPNDNI-ALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLH 533
             ++ ++      A+      N    ++  +N D  +   NL++R+   V  Q+  RL  
Sbjct: 476 NNENTVAGLGNIPALEHQYQANAEFGSVRGTNNDTLN---NLRNRMR--VPPQN--RLEQ 528

Query: 534 MIEINEERFAKILRKW 549
           MI ++EERFA +LR+W
Sbjct: 529 MIAMDEERFAGVLREW 544


>gi|254504967|ref|ZP_05117118.1| flagellar M-ring protein FliF [Labrenzia alexandrii DFL-11]
 gi|222441038|gb|EEE47717.1| flagellar M-ring protein FliF [Labrenzia alexandrii DFL-11]
          Length = 548

 Score =  360 bits (924), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 219/544 (40%), Positives = 322/544 (59%), Gaps = 30/544 (5%)

Query: 17  LGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRI 76
           LG  R++ LA + L  I    A  F+++ P    LY  L   DV+RI  AL +A I F +
Sbjct: 17  LGMRRLIALALIGLATIATVGAGAFYLSRPETTPLYTGLTGEDVSRIGSALRDAGIPFDV 76

Query: 77  SDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALE 136
           S  G ++ V      KAR+ LA +GLP  + NSGYELFD + S GLTSFMQE+TRVRALE
Sbjct: 77  SSEGDAVMVSHGQTAKARMLLAEKGLPRGA-NSGYELFDDLGSLGLTSFMQEVTRVRALE 135

Query: 137 GEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVA 196
           GE+ARTIQ + GI AARVHIV+P+ GSFR+    P+ASV+IR+  P   ++A+AIRHLVA
Sbjct: 136 GELARTIQLMKGIRAARVHIVLPEKGSFRRDQQPPSASVVIRSDIPDDVRTADAIRHLVA 195

Query: 197 AAVPNLDMGDVTVLDSTGKLLTAN-EMERNILGKSLSIVQAIQHEIEMNINKALAAFLGV 255
           A VP ++   VTVLD+TG +L A  +  +   G+  ++  A+ + I+ N+ K L  +LG+
Sbjct: 196 AGVPGMEAAKVTVLDTTGGILAAGKDPTKASAGQMATLETAVSNRIQENVRKTLTPYLGL 255

Query: 256 DNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHV 315
           DNF+ +V A+LN D + I E ++DPDS++ERS+R  ++ + +E S   + VT EQN+P  
Sbjct: 256 DNFQVSVAAKLNTDRKMIAETIFDPDSRIERSVRTIRENENAENSSAATPVTAEQNLPDE 315

Query: 316 SDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRS 375
           +       RSLE T+++EE  NYEI++K I T+ D Y+++RLSIAV+V++ RL   LG S
Sbjct: 316 NVEADGGERSLEETERREETVNYEISSKRIETSQDGYRVDRLSIAVLVDRTRLAASLGGS 375

Query: 376 ADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRH 435
             Q +I+  + EI  +V+++ G+   RGD + I+ +DF++          +   + L R 
Sbjct: 376 PTQSQIEEQVREIEALVASSAGVTEERGDLVKISVVDFVDGGRDLEPIPPIGVTEYLLRQ 435

Query: 436 FATVINALVFLVGTLLVTFLGLH----ALRRLHNIDDAKKGEVGGKSILSPPPISSAV-- 489
              +INAL  L  ++LV + GL     AL    + + A+  E+G    L P  +  A   
Sbjct: 436 SGNIINALAILTVSMLVIWFGLRPAVAALVPQVSSEQAEMAEIG----LLPEGLEDAADA 491

Query: 490 ----TTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKI 545
               T  LMP D             HS +L   +NS  +K +  +L  ++E NEE+ A I
Sbjct: 492 MDGETGFLMPPD-------------HS-DLLHDLNSKRNKSALKKLESLLEFNEEQSAAI 537

Query: 546 LRKW 549
           LR+W
Sbjct: 538 LRQW 541


>gi|256059797|ref|ZP_05449992.1| flagellar MS-ring protein [Brucella neotomae 5K33]
 gi|261323777|ref|ZP_05962974.1| flagellar M-ring protein FliF [Brucella neotomae 5K33]
 gi|261299757|gb|EEY03254.1| flagellar M-ring protein FliF [Brucella neotomae 5K33]
          Length = 580

 Score =  356 bits (913), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 222/558 (39%), Positives = 333/558 (59%), Gaps = 23/558 (4%)

Query: 4   LDQLLQFFKSGT--SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
             QL++  K GT   LG  ++++L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 10  FQQLIEQLK-GTLGKLGARKLIVLGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 68

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 69  RMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 127

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 128 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 187

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +A E        + S+ Q +   
Sbjct: 188 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASH 247

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  +
Sbjct: 248 VDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNN 307

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLSIA
Sbjct: 308 RNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSKTVSTVSDGYSIKRLSIA 367

Query: 361 VVVNKGRLTEVLGRSADQGK-IDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+    
Sbjct: 368 VVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDPAGA 427

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA-------KKG 472
           +   V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       + G
Sbjct: 428 DMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAG 487

Query: 473 EVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHS-RNLQSRINSYVSKQSDLRL 531
           EV      +P  I  A + G      I   ++  D    S  +L+ R+       + LRL
Sbjct: 488 EVA-----TPNFIGGAESVGEGVQAVIGGPAAYADQMKTSLSDLRQRMR----MPAKLRL 538

Query: 532 LHMIEINEERFAKILRKW 549
             MIE++EER A +L++W
Sbjct: 539 EQMIEMDEERVAAVLKQW 556


>gi|161621189|ref|YP_001595075.1| flagellar MS-ring protein [Brucella canis ATCC 23365]
 gi|161338000|gb|ABX64304.1| flagellar M-ring protein FliF [Brucella canis ATCC 23365]
          Length = 580

 Score =  356 bits (913), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 225/560 (40%), Positives = 337/560 (60%), Gaps = 27/560 (4%)

Query: 4   LDQLLQFFKSGT--SLGRTRILILASV--ILVPIMLFMAARFFVNSPHYDNLYVKLEVSD 59
             QL++  K GT   LG  +++ L  V   L+  +L+M+   ++  P Y+ LYV L   D
Sbjct: 10  FQQLIEQLK-GTLGKLGARKLIALGLVGAALMSAILYMS--IYLGRPSYETLYVGLSRDD 66

Query: 60  VNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNS 119
           VNR+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S
Sbjct: 67  VNRMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGS 125

Query: 120 FGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA 179
            GLTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA
Sbjct: 126 LGLTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRA 185

Query: 180 INPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQ 238
                 +SA++IR LVAAAVP+LD   VTVLD+ G LL +A E        + S+ Q + 
Sbjct: 186 EGGFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVA 245

Query: 239 HEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE 298
             ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S 
Sbjct: 246 SHVDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSR 305

Query: 299 TSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLS 358
            ++ ++A  VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLS
Sbjct: 306 NNRNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSKTVSTVSDGYSIKRLS 365

Query: 359 IAVVVNKGRLTEVLGRSADQGK-IDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           IAVV+++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+  
Sbjct: 366 IAVVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDPA 425

Query: 418 LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA-------K 470
             +   V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       +
Sbjct: 426 GADMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIRE 485

Query: 471 KGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHS-RNLQSRINSYVSKQSDL 529
            GEV      +P  I  A + G      I   ++  D    S  +L+ R+       + L
Sbjct: 486 AGEVA-----TPNFIGGAESVGEGVQAVIGGPAAYADQMKTSLSDLRQRMR----MPAKL 536

Query: 530 RLLHMIEINEERFAKILRKW 549
           RL  MIE++EER A +L++W
Sbjct: 537 RLEQMIEMDEERVAAVLKQW 556


>gi|260568707|ref|ZP_05839176.1| flagellar M-ring protein FliF [Brucella suis bv. 4 str. 40]
 gi|260155372|gb|EEW90453.1| flagellar M-ring protein FliF [Brucella suis bv. 4 str. 40]
          Length = 580

 Score =  355 bits (912), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 225/560 (40%), Positives = 337/560 (60%), Gaps = 27/560 (4%)

Query: 4   LDQLLQFFKSGT--SLGRTRILILASV--ILVPIMLFMAARFFVNSPHYDNLYVKLEVSD 59
             QL++  K GT   LG  +++ L  V   L+  +L+M+   ++  P Y+ LYV L   D
Sbjct: 10  FQQLIEQLK-GTLGKLGARKLIALGLVGAALMGAILYMS--IYLGRPSYETLYVGLSRDD 66

Query: 60  VNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNS 119
           VNR+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S
Sbjct: 67  VNRMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGS 125

Query: 120 FGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA 179
            GLTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA
Sbjct: 126 LGLTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRA 185

Query: 180 INPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQ 238
                 +SA++IR LVAAAVP+LD   VTVLD+ G LL +A E        + S+ Q + 
Sbjct: 186 EGGFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVA 245

Query: 239 HEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE 298
             ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S 
Sbjct: 246 SHVDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSR 305

Query: 299 TSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLS 358
            ++ ++A  VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLS
Sbjct: 306 NNRNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSKTVSTVSDGYSIKRLS 365

Query: 359 IAVVVNKGRLTEVLGRSADQGK-IDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           IAVV+++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+  
Sbjct: 366 IAVVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDPA 425

Query: 418 LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA-------K 470
             +   V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       +
Sbjct: 426 GADMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIRE 485

Query: 471 KGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHS-RNLQSRINSYVSKQSDL 529
            GEV      +P  I  A + G      I   ++  D    S  +L+ R+       + L
Sbjct: 486 AGEVA-----TPNFIGGAESVGEGVQAVIGGPAAYADQMKTSLSDLRQRMR----MPAKL 536

Query: 530 RLLHMIEINEERFAKILRKW 549
           RL  MIE++EER A +L++W
Sbjct: 537 RLEQMIEMDEERVAAVLKQW 556


>gi|189023215|ref|YP_001932956.1| flagellar MS-ring protein [Brucella abortus S19]
 gi|254691603|ref|ZP_05154857.1| flagellar MS-ring protein [Brucella abortus bv. 6 str. 870]
 gi|254698196|ref|ZP_05160024.1| flagellar MS-ring protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|254699268|ref|ZP_05161096.1| flagellar MS-ring protein [Brucella suis bv. 5 str. 513]
 gi|254702392|ref|ZP_05164220.1| flagellar MS-ring protein [Brucella suis bv. 3 str. 686]
 gi|254711225|ref|ZP_05173036.1| flagellar MS-ring protein [Brucella pinnipedialis B2/94]
 gi|254731641|ref|ZP_05190219.1| flagellar MS-ring protein [Brucella abortus bv. 4 str. 292]
 gi|256030146|ref|ZP_05443760.1| flagellar MS-ring protein [Brucella pinnipedialis M292/94/1]
 gi|256256791|ref|ZP_05462327.1| flagellar MS-ring protein [Brucella abortus bv. 9 str. C68]
 gi|189021789|gb|ACD74510.1| flagellar M-ring protein FliF [Brucella abortus S19]
          Length = 575

 Score =  354 bits (909), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 222/558 (39%), Positives = 332/558 (59%), Gaps = 23/558 (4%)

Query: 4   LDQLLQFFKSGT--SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
             QL++  K GT   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 5   FQQLIEQLK-GTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 63

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 64  RMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 122

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 123 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 182

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +A E        + S+ Q +   
Sbjct: 183 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASH 242

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  +
Sbjct: 243 VDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNN 302

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLSIA
Sbjct: 303 RNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSKTVSTVSDGYSIKRLSIA 362

Query: 361 VVVNKGRLTEVLGRSADQGK-IDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+    
Sbjct: 363 VVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDPAGA 422

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA-------KKG 472
           +   V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       + G
Sbjct: 423 DMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAG 482

Query: 473 EVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHS-RNLQSRINSYVSKQSDLRL 531
           EV      +P  I  A + G      I   ++  D    S  +L+ R+       + LRL
Sbjct: 483 EVA-----TPNFIGGAESVGEGVQAVIGGPAAYADQMKTSLSDLRQRMR----MPAKLRL 533

Query: 532 LHMIEINEERFAKILRKW 549
             MIE++EER A +L++W
Sbjct: 534 EQMIEMDEERVAAVLKQW 551


>gi|23500860|ref|NP_700300.1| flagellar MS-ring protein [Brucella suis 1330]
 gi|83269941|ref|YP_419232.1| flagellar MS-ring protein [Brucella melitensis biovar Abortus 2308]
 gi|225628435|ref|ZP_03786469.1| flagellar M-ring protein FliF [Brucella ceti str. Cudo]
 gi|237817511|ref|ZP_04596501.1| flagellar M-ring protein FliF [Brucella abortus str. 2308 A]
 gi|256015905|ref|YP_003105914.1| flagellar M-ring protein FliF [Brucella microti CCM 4915]
 gi|260166802|ref|ZP_05753613.1| flagellar MS-ring protein [Brucella sp. F5/99]
 gi|260544149|ref|ZP_05819970.1| flagellar M-ring protein FliF [Brucella abortus NCTC 8038]
 gi|260757235|ref|ZP_05869583.1| flagellar M-ring protein FliF [Brucella abortus bv. 6 str. 870]
 gi|260759400|ref|ZP_05871748.1| flagellar M-ring protein FliF [Brucella abortus bv. 4 str. 292]
 gi|260762643|ref|ZP_05874975.1| flagellar M-ring protein FliF [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883039|ref|ZP_05894653.1| flagellar M-ring protein FliF [Brucella abortus bv. 9 str. C68]
 gi|261318817|ref|ZP_05958014.1| flagellar M-ring protein FliF [Brucella pinnipedialis B2/94]
 gi|261749710|ref|ZP_05993419.1| flagellar M-ring protein [Brucella suis bv. 5 str. 513]
 gi|261752953|ref|ZP_05996662.1| flagellar M-ring protein FliF [Brucella suis bv. 3 str. 686]
 gi|261756180|ref|ZP_05999889.1| flagellar M-ring protein FliF [Brucella sp. F5/99]
 gi|265987176|ref|ZP_06099733.1| flagellar M-ring protein FliF [Brucella pinnipedialis M292/94/1]
 gi|294852976|ref|ZP_06793648.1| flagellar M-ring protein FliF [Brucella sp. NVSL 07-0026]
 gi|297250144|ref|ZP_06933845.1| flagellar M-ring protein FliF [Brucella abortus bv. 5 str. B3196]
 gi|38257618|sp|Q8FUS3|FLIF_BRUSU RecName: Full=Flagellar M-ring protein FliF
 gi|23464525|gb|AAN34305.1| flagellar M-ring protein FliF [Brucella suis 1330]
 gi|82940215|emb|CAJ13271.1| Flagellar FliF M-ring protein:Type III secretion system outer
           membrane K protein:Secretory protein YscJ/FliF [Brucella
           melitensis biovar Abortus 2308]
 gi|225616281|gb|EEH13329.1| flagellar M-ring protein FliF [Brucella ceti str. Cudo]
 gi|237787266|gb|EEP61484.1| flagellar M-ring protein FliF [Brucella abortus str. 2308 A]
 gi|255998565|gb|ACU50252.1| flagellar M-ring protein FliF [Brucella microti CCM 4915]
 gi|260097420|gb|EEW81294.1| flagellar M-ring protein FliF [Brucella abortus NCTC 8038]
 gi|260669718|gb|EEX56658.1| flagellar M-ring protein FliF [Brucella abortus bv. 4 str. 292]
 gi|260673064|gb|EEX59885.1| flagellar M-ring protein FliF [Brucella abortus bv. 2 str. 86/8/59]
 gi|260677343|gb|EEX64164.1| flagellar M-ring protein FliF [Brucella abortus bv. 6 str. 870]
 gi|260872567|gb|EEX79636.1| flagellar M-ring protein FliF [Brucella abortus bv. 9 str. C68]
 gi|261298040|gb|EEY01537.1| flagellar M-ring protein FliF [Brucella pinnipedialis B2/94]
 gi|261736164|gb|EEY24160.1| flagellar M-ring protein FliF [Brucella sp. F5/99]
 gi|261739463|gb|EEY27389.1| flagellar M-ring protein [Brucella suis bv. 5 str. 513]
 gi|261742706|gb|EEY30632.1| flagellar M-ring protein FliF [Brucella suis bv. 3 str. 686]
 gi|264659373|gb|EEZ29634.1| flagellar M-ring protein FliF [Brucella pinnipedialis M292/94/1]
 gi|294818631|gb|EFG35631.1| flagellar M-ring protein FliF [Brucella sp. NVSL 07-0026]
 gi|297174013|gb|EFH33377.1| flagellar M-ring protein FliF [Brucella abortus bv. 5 str. B3196]
          Length = 580

 Score =  354 bits (909), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 222/558 (39%), Positives = 332/558 (59%), Gaps = 23/558 (4%)

Query: 4   LDQLLQFFKSGT--SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
             QL++  K GT   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 10  FQQLIEQLK-GTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 68

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 69  RMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 127

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 128 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 187

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +A E        + S+ Q +   
Sbjct: 188 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASH 247

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  +
Sbjct: 248 VDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNN 307

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLSIA
Sbjct: 308 RNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSKTVSTVSDGYSIKRLSIA 367

Query: 361 VVVNKGRLTEVLGRSADQGK-IDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+    
Sbjct: 368 VVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDPAGA 427

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA-------KKG 472
           +   V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       + G
Sbjct: 428 DMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAG 487

Query: 473 EVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHS-RNLQSRINSYVSKQSDLRL 531
           EV      +P  I  A + G      I   ++  D    S  +L+ R+       + LRL
Sbjct: 488 EVA-----TPNFIGGAESVGEGVQAVIGGPAAYADQMKTSLSDLRQRMR----MPAKLRL 538

Query: 532 LHMIEINEERFAKILRKW 549
             MIE++EER A +L++W
Sbjct: 539 EQMIEMDEERVAAVLKQW 556


>gi|306841269|ref|ZP_07473980.1| flagellar M-ring protein FliF [Brucella sp. BO2]
 gi|306288671|gb|EFM60002.1| flagellar M-ring protein FliF [Brucella sp. BO2]
          Length = 542

 Score =  353 bits (907), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 214/519 (41%), Positives = 317/519 (61%), Gaps = 20/519 (3%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            ++  P Y+ LYV L   DVNR+ +AL EA I F +  +GSSI VP      AR++LA +
Sbjct: 10  IYLGRPSYETLYVGLSRDDVNRMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEK 69

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP+S+ N+GYELFD + S GLTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ +
Sbjct: 70  GLPTSN-NAGYELFDNMGSLGLTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAE 128

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TA 219
            GSFR+   +P+ASV+IRA      +SA++IR LVAAAVP+LD   VTVLD+ G LL +A
Sbjct: 129 KGSFRRGDQKPSASVVIRAEGGFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASA 188

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
            E        + S+ Q +   ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YD
Sbjct: 189 GEGANGAALMTASLEQQVASHVDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYD 248

Query: 280 PDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYE 339
           P+S+VERS+R+ +++  S  ++ ++A  VEQN+P    +      S E TD++EE +NYE
Sbjct: 249 PESRVERSVRVVRESGDSRNNRNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYE 308

Query: 340 INTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGK-IDSYLAEINKIVSAATGI 398
           +N+K+++T  D Y ++RLSIAVV+++ RL +  G +      +D  + +I  +V+ A G+
Sbjct: 309 VNSKTVSTVSDGYSIKRLSIAVVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGL 368

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           N+ RGD I +T+++FL+    +   V   + D L R   +  NAL  L    L+ + GL 
Sbjct: 369 NANRGDVINVTAVNFLDPAGADMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLR 428

Query: 459 ALRRLHNIDDA-------KKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSH 511
            L R  N+  A       + GEV      +P  I SA + G      I   ++  D    
Sbjct: 429 PLLRDQNVKPAGTEVAIREAGEVA-----TPNFIGSAESVGEGAQAVIGGPAAYADQMKT 483

Query: 512 S-RNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKW 549
           S  +L+ R+       + LRL  MIE++EER A +L++W
Sbjct: 484 SLSDLRQRMR----MPAKLRLEQMIEMDEERVAAVLKQW 518


>gi|261215451|ref|ZP_05929732.1| flagellar M-ring protein FliF [Brucella abortus bv. 3 str. Tulya]
 gi|260917058|gb|EEX83919.1| flagellar M-ring protein FliF [Brucella abortus bv. 3 str. Tulya]
          Length = 580

 Score =  353 bits (906), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 222/558 (39%), Positives = 332/558 (59%), Gaps = 23/558 (4%)

Query: 4   LDQLLQFFKSGT--SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
             QL++  K GT   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 10  FQQLIEQLK-GTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 68

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 69  RMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 127

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 128 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 187

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +A E        + S+ Q +   
Sbjct: 188 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASH 247

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  +
Sbjct: 248 VDDSIRKALAPYLGLGHFQTSVQAVLDTDRRQTKETTYDPESRVERSVRVVRESGDSRNN 307

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLSIA
Sbjct: 308 RNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSKTVSTVSDGYSIKRLSIA 367

Query: 361 VVVNKGRLTEVLGRSADQGK-IDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+    
Sbjct: 368 VVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDPAGA 427

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA-------KKG 472
           +   V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       + G
Sbjct: 428 DMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAG 487

Query: 473 EVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHS-RNLQSRINSYVSKQSDLRL 531
           EV      +P  I  A + G      I   ++  D    S  +L+ R+       + LRL
Sbjct: 488 EVA-----TPNFIGGAESVGEGVQAVIGGPAAYADQMKTSLSDLRQRMR----MPAKLRL 538

Query: 532 LHMIEINEERFAKILRKW 549
             MIE++EER A +L++W
Sbjct: 539 EQMIEMDEERVAAVLKQW 556


>gi|254695100|ref|ZP_05156928.1| flagellar MS-ring protein [Brucella abortus bv. 3 str. Tulya]
          Length = 575

 Score =  353 bits (906), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 222/558 (39%), Positives = 332/558 (59%), Gaps = 23/558 (4%)

Query: 4   LDQLLQFFKSGT--SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
             QL++  K GT   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 5   FQQLIEQLK-GTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 63

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 64  RMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 122

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 123 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 182

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +A E        + S+ Q +   
Sbjct: 183 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASH 242

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  +
Sbjct: 243 VDDSIRKALAPYLGLGHFQTSVQAVLDTDRRQTKETTYDPESRVERSVRVVRESGDSRNN 302

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLSIA
Sbjct: 303 RNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSKTVSTVSDGYSIKRLSIA 362

Query: 361 VVVNKGRLTEVLGRSADQGK-IDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+    
Sbjct: 363 VVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDPAGA 422

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA-------KKG 472
           +   V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       + G
Sbjct: 423 DMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAG 482

Query: 473 EVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHS-RNLQSRINSYVSKQSDLRL 531
           EV      +P  I  A + G      I   ++  D    S  +L+ R+       + LRL
Sbjct: 483 EVA-----TPNFIGGAESVGEGVQAVIGGPAAYADQMKTSLSDLRQRMR----MPAKLRL 533

Query: 532 LHMIEINEERFAKILRKW 549
             MIE++EER A +L++W
Sbjct: 534 EQMIEMDEERVAAVLKQW 551


>gi|256158325|ref|ZP_05456229.1| flagellar MS-ring protein [Brucella ceti M490/95/1]
 gi|256252741|ref|ZP_05458277.1| flagellar MS-ring protein [Brucella ceti B1/94]
          Length = 575

 Score =  353 bits (906), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 222/558 (39%), Positives = 331/558 (59%), Gaps = 23/558 (4%)

Query: 4   LDQLLQFFKSGT--SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
             QL++  K GT   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 5   FQQLIEQLK-GTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 63

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+  AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 64  RMGRALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 122

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 123 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 182

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +A E        + S+ Q +   
Sbjct: 183 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASH 242

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  +
Sbjct: 243 VDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNN 302

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLSIA
Sbjct: 303 RNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSKTVSTVSDGYSIKRLSIA 362

Query: 361 VVVNKGRLTEVLGRSADQGK-IDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+    
Sbjct: 363 VVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDPAGA 422

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA-------KKG 472
           +   V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       + G
Sbjct: 423 DMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAG 482

Query: 473 EVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHS-RNLQSRINSYVSKQSDLRL 531
           EV      +P  I  A + G      I   ++  D    S  +L+ R+       + LRL
Sbjct: 483 EVA-----TPNFIGGAESVGEGVQAVIGGPAAYADQMKTSLSDLRQRMR----MPAKLRL 533

Query: 532 LHMIEINEERFAKILRKW 549
             MIE++EER A +L++W
Sbjct: 534 EQMIEMDEERVAAVLKQW 551


>gi|261219820|ref|ZP_05934101.1| flagellar M-ring protein FliF [Brucella ceti B1/94]
 gi|265996839|ref|ZP_06109396.1| flagellar M-ring protein FliF [Brucella ceti M490/95/1]
 gi|260918404|gb|EEX85057.1| flagellar M-ring protein FliF [Brucella ceti B1/94]
 gi|262551136|gb|EEZ07297.1| flagellar M-ring protein FliF [Brucella ceti M490/95/1]
          Length = 580

 Score =  353 bits (905), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 222/558 (39%), Positives = 331/558 (59%), Gaps = 23/558 (4%)

Query: 4   LDQLLQFFKSGT--SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
             QL++  K GT   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 10  FQQLIEQLK-GTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 68

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+  AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 69  RMGRALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 127

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 128 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 187

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +A E        + S+ Q +   
Sbjct: 188 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASH 247

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  +
Sbjct: 248 VDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNN 307

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLSIA
Sbjct: 308 RNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSKTVSTVSDGYSIKRLSIA 367

Query: 361 VVVNKGRLTEVLGRSADQGK-IDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+    
Sbjct: 368 VVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDPAGA 427

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA-------KKG 472
           +   V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       + G
Sbjct: 428 DMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAG 487

Query: 473 EVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHS-RNLQSRINSYVSKQSDLRL 531
           EV      +P  I  A + G      I   ++  D    S  +L+ R+       + LRL
Sbjct: 488 EVA-----TPNFIGGAESVGEGVQAVIGGPAAYADQMKTSLSDLRQRMR----MPAKLRL 538

Query: 532 LHMIEINEERFAKILRKW 549
             MIE++EER A +L++W
Sbjct: 539 EQMIEMDEERVAAVLKQW 556


>gi|148558201|ref|YP_001258009.1| flagellar MS-ring protein [Brucella ovis ATCC 25840]
 gi|148369486|gb|ABQ62358.1| flagellar M-ring protein FliF [Brucella ovis ATCC 25840]
          Length = 568

 Score =  353 bits (905), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 217/543 (39%), Positives = 325/543 (59%), Gaps = 20/543 (3%)

Query: 17  LGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRI 76
           LG  +++ L  V    +   +    ++  P Y+ LYV L   DVNR+ +AL EA I F +
Sbjct: 12  LGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVNRMGLALGEAGIPFDV 71

Query: 77  SDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALE 136
             +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S GLTSFMQEITRVRALE
Sbjct: 72  KSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLGLTSFMQEITRVRALE 130

Query: 137 GEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVA 196
           GEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA      +SA++IR LVA
Sbjct: 131 GEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEGGFSAESAQSIRQLVA 190

Query: 197 AAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGV 255
           AAVP+LD   VTVLD+ G LL +A E        + S+ Q +   ++ +I KALA +LG+
Sbjct: 191 AAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASHVDDSIRKALAPYLGL 250

Query: 256 DNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHV 315
            +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  ++ ++A  VEQN+P  
Sbjct: 251 GHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNNRNDNATGVEQNIPQE 310

Query: 316 SDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRS 375
             +      S E TD++EE +NYE+N+K+++T  D Y ++RLSIAVV+++ RL +  G +
Sbjct: 311 QIQNRNGESSTEKTDRREELTNYEVNSKTVSTVSDGYSIKRLSIAVVIDQARLLQTAGTT 370

Query: 376 ADQGK-IDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSR 434
                 +D  + +I  +V+ A G+N+ RGD I +T+++FL+    +   V   + D L R
Sbjct: 371 PPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDPAGADMEPVSAPWTDTLLR 430

Query: 435 HFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA-------KKGEVGGKSILSPPPISS 487
              +  NAL  L    L+ + GL  L R  N+  A       + GEV      +P  I  
Sbjct: 431 QSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAGEVA-----TPNFIGG 485

Query: 488 AVTTGLMPNDNIALDSSNQDIFSHS-RNLQSRINSYVSKQSDLRLLHMIEINEERFAKIL 546
           A + G      I   ++  D    S  +L+ R+       + LRL  MIE++EER A +L
Sbjct: 486 AESVGEGVQAVIGGPAAYADQMKTSLSDLRQRMR----MPAKLRLEQMIEMDEERVAAVL 541

Query: 547 RKW 549
           ++W
Sbjct: 542 KQW 544


>gi|122065185|sp|Q8YDM4|FLIF_BRUME RecName: Full=Flagellar M-ring protein
          Length = 580

 Score =  352 bits (904), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 221/558 (39%), Positives = 332/558 (59%), Gaps = 23/558 (4%)

Query: 4   LDQLLQFFKSGT--SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
             QL++  K GT   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 10  FQQLIEQLK-GTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 68

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 69  RMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 127

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 128 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 187

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +A E        + S+ Q +   
Sbjct: 188 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASH 247

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  +
Sbjct: 248 VDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNN 307

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E TD++EE +NYE+N+ +++T  D Y ++RLSIA
Sbjct: 308 RNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSMTVSTVSDGYSIKRLSIA 367

Query: 361 VVVNKGRLTEVLGRSADQGK-IDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL++   
Sbjct: 368 VVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDSAGA 427

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA-------KKG 472
           +   V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       + G
Sbjct: 428 DMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAG 487

Query: 473 EVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHS-RNLQSRINSYVSKQSDLRL 531
           EV      +P  I  A + G      I   ++  D    S  +L+ R+       + LRL
Sbjct: 488 EVA-----TPNFIGGAESVGEGVQAVIGGPAAYADQMKTSLSDLRQRMR----MPAKLRL 538

Query: 532 LHMIEINEERFAKILRKW 549
             MIE++EER A +L++W
Sbjct: 539 EQMIEMDEERVAAVLKQW 556


>gi|62317964|ref|YP_223817.1| flagellar MS-ring protein [Brucella abortus bv. 1 str. 9-941]
 gi|68067522|sp|O52069|FLIF_BRUAB RecName: Full=Flagellar M-ring protein
 gi|62198157|gb|AAX76456.1| FliF, flagellar M-ring protein [Brucella abortus bv. 1 str. 9-941]
          Length = 580

 Score =  352 bits (903), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 221/558 (39%), Positives = 331/558 (59%), Gaps = 23/558 (4%)

Query: 4   LDQLLQFFKSGT--SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
             QL++  K GT   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 10  FQQLIEQLK-GTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 68

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 69  RMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 127

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 128 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 187

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +A E        + S+ Q +   
Sbjct: 188 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASH 247

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  +
Sbjct: 248 VDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNN 307

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E  D++EE +NYE+N+K+++T  D Y ++RLSIA
Sbjct: 308 RNDNATGVEQNIPQEQIQNRNGESSTEKMDRREELTNYEVNSKTVSTVSDGYSIKRLSIA 367

Query: 361 VVVNKGRLTEVLGRSADQGK-IDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+    
Sbjct: 368 VVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDPAGA 427

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA-------KKG 472
           +   V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       + G
Sbjct: 428 DMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAG 487

Query: 473 EVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHS-RNLQSRINSYVSKQSDLRL 531
           EV      +P  I  A + G      I   ++  D    S  +L+ R+       + LRL
Sbjct: 488 EVA-----TPNFIGGAESVGEGVQAVIGGPAAYADQMKTSLSDLRQRMR----MPAKLRL 538

Query: 532 LHMIEINEERFAKILRKW 549
             MIE++EER A +L++W
Sbjct: 539 EQMIEMDEERVAAVLKQW 556


>gi|118589973|ref|ZP_01547377.1| flagellar M-ring protein [Stappia aggregata IAM 12614]
 gi|118437470|gb|EAV44107.1| flagellar M-ring protein [Stappia aggregata IAM 12614]
          Length = 548

 Score =  352 bits (902), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 218/544 (40%), Positives = 316/544 (58%), Gaps = 30/544 (5%)

Query: 17  LGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRI 76
           LG  R++ LA + L  I    A  ++++ P    LY  L+  DV RI  AL +A I F I
Sbjct: 17  LGVRRLVALALIGLATIATVGAGAYYLSRPEQTVLYTGLDGEDVTRIGSALRDAGIPFDI 76

Query: 77  SDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALE 136
           +  G+++ V  +   KAR+ LA +GLP  + NSGYELFD++ S GLTSFMQE+TRVRALE
Sbjct: 77  NSEGTAVMVSHAQTAKARMLLAEKGLPRGA-NSGYELFDELGSLGLTSFMQEVTRVRALE 135

Query: 137 GEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVA 196
           GE+ARTIQ + GI AARVHIV+P+ GSFR+    P+ASV+IR+  P   ++A+AIRHLVA
Sbjct: 136 GELARTIQLMKGIRAARVHIVLPEKGSFRRDQQPPSASVVIRSDVPDDVRTADAIRHLVA 195

Query: 197 AAVPNLDMGDVTVLDSTGKLLTAN-EMERNILGKSLSIVQAIQHEIEMNINKALAAFLGV 255
           A VP +    VTVLD++G +L A  +  +   G+  S+  A+ + I+ NI K L  +LG+
Sbjct: 196 AGVPGMQADKVTVLDTSGGILAAGKDPTKASAGQLASLETAVSNRIQENIRKTLTPYLGL 255

Query: 256 DNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHV 315
           DNF+ +V AELN D + I E ++DPDS+ ERSIR  ++ + ++ S   +  TVEQN+P  
Sbjct: 256 DNFQVSVAAELNTDRKTIAETIFDPDSRTERSIRTIRENENAQNSSVSAPTTVEQNLPEE 315

Query: 316 SDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRS 375
                   RS E  +++EE  NYEI++K I T+ D Y+++RLSIAV+V+K RL + LG  
Sbjct: 316 DVSADNGERSSEENERREETVNYEISSKRIETSQDGYRVDRLSIAVLVDKSRLAQSLGGE 375

Query: 376 ADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRH 435
             Q ++   L EI  +V+++ GI   RGD + +  +DF++          +S  + L R 
Sbjct: 376 PTQAQMQEQLTEIEALVASSAGIEKERGDLVKVAVVDFVDGGRAMEPIPPISITEYLMRQ 435

Query: 436 FATVINALVFLVGTLLVTFLGLH----ALRRLHNIDDAKKGEVGGKSILSPPPISSAV-- 489
              +INAL  L  ++LV + GL     AL         +  E+G    ++P      V  
Sbjct: 436 SGNIINALAILTVSMLVIWFGLRPAVAALVPQIAKPQVEMAELG----MTPETAEGTVEA 491

Query: 490 ----TTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKI 545
                T LMP D             HS  LQ  +NS  +K +  +L  ++E NEE+ A I
Sbjct: 492 VDGEQTFLMPPD-------------HSDMLQD-LNSRRNKSALRKLESLLEFNEEQSAAI 537

Query: 546 LRKW 549
           LR+W
Sbjct: 538 LRQW 541


>gi|153011515|ref|YP_001372729.1| flagellar MS-ring protein [Ochrobactrum anthropi ATCC 49188]
 gi|151563403|gb|ABS16900.1| flagellar M-ring protein FliF [Ochrobactrum anthropi ATCC 49188]
          Length = 579

 Score =  350 bits (897), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 223/572 (38%), Positives = 333/572 (58%), Gaps = 26/572 (4%)

Query: 4   LDQLLQFFKSGT--SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
             QL++  K GT   LG  +++ L  V    +   +    +++ P Y+ LYV L   DVN
Sbjct: 5   FQQLIEQLK-GTLGKLGARKLIALGLVGAALMGAILYTSIYLSRPSYETLYVGLSRDDVN 63

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 64  RMGLALGEAGIPFDVKADGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 122

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIVM + GSFR+   +P+ASV+IRA  
Sbjct: 123 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVMAEKGSFRRGDQKPSASVVIRAEG 182

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G+LL +A E        + S+ Q +   
Sbjct: 183 GFAAESAQSIRQLVAAAVPSLDASAVTVLDTNGRLLASAGEAANGAALMTASLEQQVAGN 242

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +QI E  YDP+S+VERS+R+ +++  S  +
Sbjct: 243 VDDSIRKALAPYLGIGHFQTSVQAVLDTDRRQINETTYDPESRVERSVRVVRESGDSRNN 302

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLSIA
Sbjct: 303 RNDNATGVEQNIPQEEIQNRNGESSTEKTDRREELTNYEMNSKTVSTVSDGYTVKRLSIA 362

Query: 361 VVVNKGRLTEVLGRSADQGK-IDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL E  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+    
Sbjct: 363 VVIDQARLLETAGTTPPPANFVDQQITKIRDLVATAAGLNADRGDVINVTAVNFLDPAGA 422

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
           +   V   + D + R   + +NAL  L    L+ + GL  L R  N       EV  +  
Sbjct: 423 DMEPVSTPWTDTVLRQSGSYVNALAILAAVGLLIWFGLRPLLRDQNAKPTGT-EVAVRE- 480

Query: 480 LSPPPISSAVTTGLMPN--DNIALDSSNQDIFSHSRNLQSRINSYVSK-------QSDLR 530
                 +S V    MPN     A     Q +         ++ + +S         + LR
Sbjct: 481 ------TSEVA---MPNFVGGQAAGEGVQAVIGGPEAYADQMKTSLSDLRQRMRMPAKLR 531

Query: 531 LLHMIEINEERFAKILRKWARSEIEDRYTQHI 562
           L  MI+++EER A IL++W       R  Q +
Sbjct: 532 LEQMIDMDEERVASILKQWIHETAASREAQPL 563


>gi|306845426|ref|ZP_07478000.1| flagellar M-ring protein FliF [Brucella sp. BO1]
 gi|306274169|gb|EFM55985.1| flagellar M-ring protein FliF [Brucella sp. BO1]
          Length = 575

 Score =  350 bits (897), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 221/558 (39%), Positives = 331/558 (59%), Gaps = 23/558 (4%)

Query: 4   LDQLLQFFKSGT--SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
             QL++  K GT   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 5   FQQLIEQLK-GTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 63

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA+I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 64  RMGLALGEADIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 122

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEIT VRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 123 LTSFMQEITHVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 182

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +A E        + S+ Q +   
Sbjct: 183 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALITASLEQQVASH 242

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  +
Sbjct: 243 VDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNN 302

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLSIA
Sbjct: 303 RNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSKTVSTVSDGYSIKRLSIA 362

Query: 361 VVVNKGRLTEVLGRSADQGK-IDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+    
Sbjct: 363 VVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNANRGDVINVTAVNFLDPAGA 422

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA-------KKG 472
           +   V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       + G
Sbjct: 423 DMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAG 482

Query: 473 EVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHS-RNLQSRINSYVSKQSDLRL 531
           EV       P  I  A + G      I   ++  D    S  +L+ R+       + LRL
Sbjct: 483 EVA-----MPNFIGGAESVGEGVQAVIGGPAAYADQMKTSLSDLRQRMR----MPAKLRL 533

Query: 532 LHMIEINEERFAKILRKW 549
             MIE++EER A +L++W
Sbjct: 534 EQMIEMDEERVAAVLKQW 551


>gi|239834433|ref|ZP_04682761.1| flagellar M-ring protein FliF [Ochrobactrum intermedium LMG 3301]
 gi|239822496|gb|EEQ94065.1| flagellar M-ring protein FliF [Ochrobactrum intermedium LMG 3301]
          Length = 590

 Score =  347 bits (890), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 219/568 (38%), Positives = 336/568 (59%), Gaps = 12/568 (2%)

Query: 4   LDQLLQFFKSGT--SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
             QL++  K GT   LG  +++ L  V    +   +    +++ P Y+ LYV L   DVN
Sbjct: 10  FQQLIEQLK-GTLGKLGARKLVALGLVGAALMAAILYTSIYLSRPSYETLYVGLSRDDVN 68

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 69  RMGLALGEAGIPFDVKADGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 127

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 128 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 187

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G+LL +A E        + S+ Q +   
Sbjct: 188 GFAAESAQSIRQLVAAAVPSLDASAVTVLDTNGRLLASAGEAANGAALMTASLEQQVAGN 247

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q  E ++DP+S+VERS+R+ +++  S  +
Sbjct: 248 VDDSIRKALAPYLGMGHFQTSVQAVLDTDRRQTNETIFDPESRVERSVRVVRESGDSRNN 307

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLSIA
Sbjct: 308 RNDNATGVEQNIPQEEIQNRNGESSSEKTDRREELTNYEMNSKTVSTVSDGYTVKRLSIA 367

Query: 361 VVVNKGRLTEVLGRSADQGK-IDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL E  G +      +D  +A+I  +V+ A G+N+ RGD I +T+++FL+    
Sbjct: 368 VVIDQARLLETAGTTPPPANFVDQQIAKIRDLVATAAGLNADRGDVINVTAVNFLDPAGA 427

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGK-- 477
           +   V   + D + R   + +NAL  L    L+ + GL  L R  N   A   EV  +  
Sbjct: 428 DMEPVSTPWTDTVLRQSGSYVNALAILAAVGLLIWFGLRPLLRDQNARTAGT-EVAIRET 486

Query: 478 SILSPPPI--SSAVTTGLMPNDNI-ALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHM 534
           S ++ P      A   G+     + A+    +      +   S +   +   + LRL  M
Sbjct: 487 SDVAAPDFVGGQAAGEGVQGAQGVQAVIGGPEAYADQMKTSLSDLRQRMRMPAKLRLEQM 546

Query: 535 IEINEERFAKILRKWARSEIEDRYTQHI 562
           I+++EER A +L++W       R  Q +
Sbjct: 547 IDMDEERVAAVLKQWIHETAASREGQPL 574


>gi|328545497|ref|YP_004305606.1| flagellar M-ring protein [polymorphum gilvum SL003B-26A1]
 gi|326415238|gb|ADZ72301.1| Flagellar M-ring protein [Polymorphum gilvum SL003B-26A1]
          Length = 546

 Score =  346 bits (888), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 210/536 (39%), Positives = 320/536 (59%), Gaps = 16/536 (2%)

Query: 17  LGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRI 76
           LG  R++ LA + +  I       ++++ P    LY  L+  DV+RI  AL +A I + +
Sbjct: 17  LGTRRLIALALIGVATIATVGLGAYYLSRPQQTTLYTGLQGEDVSRIGSALQDAGIPYDV 76

Query: 77  SDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALE 136
           S +G+++ V      +AR+ LA +GLP  + ++GYELFD + S GLTSFMQE+TRVRALE
Sbjct: 77  SSDGTAVLVNHGAAARARMLLAERGLPRGA-DAGYELFDDLGSLGLTSFMQEVTRVRALE 135

Query: 137 GEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVA 196
           GE+ARTIQ + G+ AARVHIV+P+ GSFR+    P+ASV+IR+  P   ++A+AIRHLV+
Sbjct: 136 GELARTIQLMQGVRAARVHIVLPEKGSFRRDQQPPSASVVIRSDVPDDLRTADAIRHLVS 195

Query: 197 AAVPNLDMGDVTVLDSTGKLLTANEMERNI-LGKSLSIVQAIQHEIEMNINKALAAFLGV 255
           AAVP +    VTVLD++G LL A +   N   G+  S+  A+   I+ NI K L  +LG+
Sbjct: 196 AAVPGMSADKVTVLDTSGGLLAAGKDPANASAGQIASLEAAVSGRIQENIRKTLTPYLGL 255

Query: 256 DNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHV 315
           DNF+ +V A+LN D ++I E +YDP+S+VERS+R  +  + S+ S  E+  TV+QN+P  
Sbjct: 256 DNFQVSVAADLNTDRRRIAETIYDPESRVERSVRTLRQNEMSQNSSTETPTTVQQNLPDE 315

Query: 316 SDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRS 375
           +       RS E   ++EE  NYEI++K+I T+ D Y +ERLSIAV+V++ RL   LG S
Sbjct: 316 TVTAENGERSSEENQRREETVNYEISSKTIETSQDGYSVERLSIAVLVDRARLEASLGGS 375

Query: 376 ADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRH 435
            D   + + L EI ++V+++ G++SRRGD I ++ +DF+           +S  ++L R 
Sbjct: 376 PDPDTVAAQLVEIEQLVASSAGVSSRRGDVIKVSVVDFVNGGRAMEPVPPMSVSELLIRQ 435

Query: 436 FATVINALVFLVGTLLVTFLGLH-ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLM 494
              +INA   L    L+ + GL  AL  L     A   E+G  ++++          GL 
Sbjct: 436 SGNLINAFAILTVAGLLIWFGLRPALAVLVPQKSAAPAEIGELAMMTE-------GEGLA 488

Query: 495 PNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLH-MIEINEERFAKILRKW 549
              + A   +  D   HS  LQ   N     QS L+ L  +++++E++ A IL++W
Sbjct: 489 GEFSEARQLAGPD---HSGMLQDLTNKL--NQSPLKKLESLLDLDEQQSAAILKQW 539


>gi|114705807|ref|ZP_01438710.1| flagellar M-ring protein [Fulvimarina pelagi HTCC2506]
 gi|114538653|gb|EAU41774.1| flagellar M-ring protein [Fulvimarina pelagi HTCC2506]
          Length = 551

 Score =  345 bits (886), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 203/522 (38%), Positives = 315/522 (60%), Gaps = 33/522 (6%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
           +F++    + LY  L+  DV RI  AL+EA I F ++  G ++  P S  G+AR+ LA +
Sbjct: 43  YFLSRADMETLYSGLDRQDVTRIGAALTEAGIPFDVTAEGDAVQTPFSQTGEARMLLAEK 102

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP S  N+GYELFD + S GLTSFMQE+TRVRALEGEIARTIQ+++ I AARVH+V+ D
Sbjct: 103 GLPRSE-NAGYELFDNIGSIGLTSFMQEVTRVRALEGEIARTIQTLANIRAARVHVVLAD 161

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTAN 220
            GSFR+   +P+ASV+IR      + SA AIR LVAAA+P +   +VTVL+S G LL + 
Sbjct: 162 EGSFRRERRKPSASVVIRTDGSEDFGSASAIRSLVAAAIPGMTPQEVTVLNSDGTLLASG 221

Query: 221 EME-RNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
           E    +   K   I + +   +E +I + LA +LGV NF+++V A LN D QQI E ++D
Sbjct: 222 EEGVSSAPSKLFGIEKIMSGSVEESIRRTLAPYLGVGNFQTSVTASLNTDRQQISERIFD 281

Query: 280 PDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKK---EEQS 336
           P+S+VERS+R  K+  +S+ +    AV +EQ++   +D     P    ++D+K   EE +
Sbjct: 282 PESRVERSVRSMKEMDQSQNTTQNEAVGIEQDI-QAADEVEGAPGGESSSDEKERREELT 340

Query: 337 NYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAAT 396
           NYEIN K+I TT + Y++E+LSIAVV+N+ RL   +G +A    ID+ +AEI  +V++A+
Sbjct: 341 NYEINEKTIQTTSEGYEVEKLSIAVVINRQRLAAAIGENATDTDIDARIAEIESLVASAS 400

Query: 397 GINSRRGDTITITSMDFLENQLFNSGTVQ----VSFMDILSRHFATVINALVFLVGTLLV 452
           G +  RGD + +T++DF++     +G+++      F ++  R   T+INAL  LV  +LV
Sbjct: 401 GYSEARGDQLKVTAVDFVD----AAGSLEPIPGPGFSEMFMRQSGTLINALTILVVAVLV 456

Query: 453 TFLGLH-ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTG----LMPNDNIALDSSNQD 507
            + GL  A+R L   + A+       SI +   +   + +G    L P +        +D
Sbjct: 457 IWFGLKPAIRALAAPEPAESEADNDNSIETLQRVGEGMESGSVGSLAPANGT--QGFVED 514

Query: 508 IFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKW 549
           +   +R+ Q+R+ +            +++I+E + A +L++W
Sbjct: 515 LSGAARSPQARLEA------------LVDIDENQAANVLKQW 544


>gi|158422251|ref|YP_001523543.1| flagellar MS-ring protein [Azorhizobium caulinodans ORS 571]
 gi|158329140|dbj|BAF86625.1| flagellar M-ring protein [Azorhizobium caulinodans ORS 571]
          Length = 559

 Score =  340 bits (872), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 210/561 (37%), Positives = 315/561 (56%), Gaps = 13/561 (2%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M   +QL +   +   LG  R++ L  +    + +      +++ P  + LY  L   DV
Sbjct: 1   MNAREQLERLLSNLRQLGARRLVALGLIAFTVMAVIGLGAMYLSQPERETLYANLSRDDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
            RI  AL +A I F +S +G+++ V  S   +AR+ LA +GLP SSS SGYELF+ V SF
Sbjct: 61  TRIGGALKDAGIPFDVSSDGATVLVAHSDTARARMLLAVKGLPQSSS-SGYELFNDVRSF 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+T+VRALEGEIARTIQ++ GI AARVHIV+PD GSFR+     TASV+IR  
Sbjct: 120 GLTSFMQEVTKVRALEGEIARTIQTMKGIKAARVHIVLPDRGSFRRDQQLATASVVIRTE 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG-KSLSIVQAIQH 239
           N +   +A+AIRHLVAAA+P + + +VTVL++ G +LT+ E        +  ++ Q +  
Sbjct: 180 NSADSSTAQAIRHLVAAAIPGMKLDNVTVLNTEGTILTSTEDGVTAAATRKSALQQQVNR 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           E E  I + L  FLG+ NF  +V + LN D   I E  YDP SK ERS R+ K+  +++ 
Sbjct: 240 ETEEKIRRTLTPFLGLGNFEVSVSSRLNTDRSTINETTYDPASKAERSTRVVKEQGQTQN 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
              +   TV+QN+P           + EN  ++EE +N+EI+T+   T  D Y +E LSI
Sbjct: 300 RSQQPNTTVQQNIPPPPGTPGTGTENNENNQRREELTNFEISTRQSQTVRDAYSVENLSI 359

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AV+VNK RLT     + D   +++   EI ++VS+A G +  RGD + + ++ F +    
Sbjct: 360 AVLVNKERLTG----TKDGTPLETQTYEIEQLVSSAAGFDKERGDKLKVVAVPFADGGNN 415

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH-ALRRLHNIDDAKKGEVGGKS 478
                 +++ ++L R   T++NA+  LV  +L+ + GL  ALR +    +  + E    +
Sbjct: 416 MEPIPPLTWSELLFRQAGTIVNAVTILVVAILLIWFGLRPALRAILARPEPDEAEAIEAA 475

Query: 479 ILSP----PPISSAVTTGLMPN--DNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLL 532
           +L+     PP +   +T   PN  D +   +      S   NL   + S V++    RL 
Sbjct: 476 MLAAPTELPPDTVLPSTAQNPNTLDGVTTLAGFTGGDSGPVNLIGDVTSKVNRSPQRRLE 535

Query: 533 HMIEINEERFAKILRKWARSE 553
            MIE +EE+ A ILR+W   E
Sbjct: 536 QMIEYDEEQAAAILRQWLHQE 556


>gi|218512857|ref|ZP_03509697.1| flagellar MS-ring protein [Rhizobium etli 8C-3]
          Length = 316

 Score =  337 bits (863), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 166/307 (54%), Positives = 232/307 (75%), Gaps = 3/307 (0%)

Query: 159 PDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL- 217
           P++G+FRK   +PTASVMIRA   +   +A +IRHLVA+AVP LD+ DVT+LDS G+LL 
Sbjct: 1   PEVGNFRKAEQKPTASVMIRASAATGRSAATSIRHLVASAVPGLDVDDVTILDSAGQLLA 60

Query: 218 TANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIV 277
           + +E   + L +SL+IVQ +Q E+E NI+KALA FLG+DNFRS+V A+LN D QQI+E  
Sbjct: 61  SGDEASNSSLNRSLNIVQNVQQEVESNIDKALAPFLGMDNFRSSVTADLNTDAQQIQETT 120

Query: 278 YDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRK--VPLPRSLENTDKKEEQ 335
           YDP+SKVERS+R +K+AQ+S+  Q ++A TVEQN+P  +        P S + +DK+EEQ
Sbjct: 121 YDPESKVERSVRSTKEAQQSQQKQSDNATTVEQNIPQAAPDAGGASGPESQDKSDKREEQ 180

Query: 336 SNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAA 395
           +NYEIN+++ ATT ++YK+E+LSIAVVVNKGR+ +++G  ADQ KID+YLAE+ KIV++A
Sbjct: 181 TNYEINSRTTATTRNSYKVEKLSIAVVVNKGRIAKMVGEPADQAKIDAYLAEMQKIVASA 240

Query: 396 TGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFL 455
            GI+++RGD +T+T+MDFLENQL    T  V  MD+LSR+ A +IN+L F+    +V ++
Sbjct: 241 AGIDAKRGDVVTVTAMDFLENQLLEDATGGVRVMDMLSRNLAGIINSLAFVAVAFVVVWM 300

Query: 456 GLHALRR 462
           GL  L R
Sbjct: 301 GLRPLVR 307


>gi|2832233|gb|AAC01568.1| M-ring [Brucella abortus]
          Length = 540

 Score =  336 bits (862), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 198/470 (42%), Positives = 293/470 (62%), Gaps = 6/470 (1%)

Query: 4   LDQLLQFFKSGT--SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
             QL++  K GT   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 10  FQQLIEQLK-GTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 68

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +   GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 69  RMGLALGEAGIPFDVKSYGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 127

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 128 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 187

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +A E        + S+ Q +   
Sbjct: 188 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASH 247

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  +
Sbjct: 248 VDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNN 307

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLSIA
Sbjct: 308 RNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSKTVSTVSDGYSIKRLSIA 367

Query: 361 VVVNKGRLTEVLGRSADQGK-IDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+    
Sbjct: 368 VVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDPAGA 427

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA 469
           +   V   + D L R   +  NAL  L    L+ + GL  L R  N+  A
Sbjct: 428 DMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPA 477


>gi|218681104|ref|ZP_03529001.1| flagellar MS-ring protein [Rhizobium etli CIAT 894]
          Length = 282

 Score =  336 bits (861), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 169/273 (61%), Positives = 214/273 (78%), Gaps = 2/273 (0%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           +IL  V  V I + +AA  FVN P  + LYV L+  D+N+IS+AL+EANI+F++  +GSS
Sbjct: 1   MILGGVGAVSIAIVLAAALFVNKPAQETLYVGLDQPDLNQISMALAEANINFQVGTDGSS 60

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           ISVP+ M GKAR+ LA +GLP+S+ N+GYELFD V S GLTSFMQE+TRVRALEGEIART
Sbjct: 61  ISVPAGMTGKARLMLAERGLPNSA-NAGYELFDNVGSLGLTSFMQEVTRVRALEGEIART 119

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNL 202
           IQSISGI AARVHIVMP++G+FRK   +PTASVMIRA   +   +A +IRHLVA+AVP L
Sbjct: 120 IQSISGITAARVHIVMPEVGNFRKQEQKPTASVMIRASAVTGRSAATSIRHLVASAVPGL 179

Query: 203 DMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSA 261
           D+ DVT+LDS G+LL + +   N  L +SL IVQ +Q E+E NI+KALA FLG+DNFRS+
Sbjct: 180 DVDDVTILDSAGQLLASGDDASNSSLNRSLGIVQNVQQEVESNIDKALAPFLGMDNFRSS 239

Query: 262 VVAELNMDTQQIREIVYDPDSKVERSIRLSKDA 294
           V A+LN D QQI+E  YDP+SKVERS+R +K+A
Sbjct: 240 VTADLNTDAQQIQETTYDPESKVERSVRSTKEA 272


>gi|27381975|ref|NP_773504.1| flagellar MS-ring protein [Bradyrhizobium japonicum USDA 110]
 gi|27355145|dbj|BAC52129.1| flagellar M-ring protein [Bradyrhizobium japonicum USDA 110]
          Length = 553

 Score =  335 bits (859), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 173/442 (39%), Positives = 277/442 (62%), Gaps = 2/442 (0%)

Query: 18  GRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRIS 77
           G  R++ L  +    ++  +   ++++ P ++ LY  L   DV R+  AL E NI F ++
Sbjct: 30  GPRRLMALGLIGFAVLVTVVGGAYYLSRPEFETLYTGLSREDVTRMGAALREQNIAFDVN 89

Query: 78  DNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEG 137
             G ++SV  S   +AR+ LA +GLP+S+ NSGYELFDK+ S GLTSFMQE+T++RALEG
Sbjct: 90  TAGDAVSVRPSQTMQARMLLAEKGLPTSA-NSGYELFDKIGSLGLTSFMQEVTKLRALEG 148

Query: 138 EIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAA 197
           EIART+Q + G+ AARVHIVMP  GSFR     P+ASV++R       ++A++IRHLVAA
Sbjct: 149 EIARTVQLMKGVKAARVHIVMPVRGSFRATQQPPSASVVLRTDGAIEARTAQSIRHLVAA 208

Query: 198 AVPNLDMGDVTVLDSTGKLLTANEMERNIL-GKSLSIVQAIQHEIEMNINKALAAFLGVD 256
           A+P +    VTVLD+ G +L A E E      K  S+ + +   ++ NI KAL  +LG+D
Sbjct: 209 AIPGMSRDKVTVLDADGSMLLAEEDEATAAPTKMASLQKTVGGMVQENIRKALTPYLGLD 268

Query: 257 NFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVS 316
           NF  +V  +L+ D +Q  E VYDP+ + ERS+R  ++ + S+ +   +  TV+QN+P   
Sbjct: 269 NFEVSVAPQLSTDKRQTNETVYDPEGRAERSVRNVREKESSQNADRSTPTTVQQNLPDQQ 328

Query: 317 DRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSA 376
                   S E+  ++E+ +N+E+++K+  T  D Y +++L IAV+VN+ RL   LG  +
Sbjct: 329 VNAGGSKNSSEDKTRREDVTNFEVSSKTTTTVSDGYLVKKLFIAVLVNRARLVADLGDKS 388

Query: 377 DQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHF 436
           +Q  +DS LAEI+++ + A G++ +RGD I +T++DF+E     +    +SF++++++  
Sbjct: 389 NQAIVDSKLAEISQLAATAGGLDKQRGDQIQVTAVDFIEGSRELAPVPPISFVEMINKQL 448

Query: 437 ATVINALVFLVGTLLVTFLGLH 458
            +VINA+  L    ++ + GL 
Sbjct: 449 GSVINAVTILAVASMLVWFGLR 470


>gi|323139667|ref|ZP_08074709.1| flagellar M-ring protein FliF [Methylocystis sp. ATCC 49242]
 gi|322395099|gb|EFX97658.1| flagellar M-ring protein FliF [Methylocystis sp. ATCC 49242]
          Length = 565

 Score =  333 bits (854), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 202/565 (35%), Positives = 321/565 (56%), Gaps = 28/565 (4%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           +D++     +  +LG  ++  L     + + +   + ++++ P ++ LY  L+  DV+RI
Sbjct: 13  MDRITLLLDNLKALGTRKLAALGLTFALVVAIVSISAYYLSRPTFEVLYAGLDREDVSRI 72

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
              L    I F I+  G+++SVP     +AR+ LA +GLP S+ N+GYELFDKV + GLT
Sbjct: 73  GSVLKSTGIPFDINTEGNAVSVPYGQTAQARMLLAERGLPQSA-NAGYELFDKVGALGLT 131

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS 183
           SFMQE+TRVRALEGE+ARTIQ I G+ AARVHIVMPD GSFR+    P+ASV+IR   P 
Sbjct: 132 SFMQEVTRVRALEGELARTIQLIRGVKAARVHIVMPDEGSFRRAKQPPSASVIIRTEGPD 191

Query: 184 VYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN--ILGKSLSIVQAIQHEI 241
              +A+AIRHLVA+++P +++  VTVL++ G +L++++ +    +  K+L++ + IQ +I
Sbjct: 192 DTSAAQAIRHLVASSLPGMNVDQVTVLNTDGMILSSSDGDATDAVPVKTLTLEKNIQKDI 251

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
           + NI + L  +L + NF+  V A +N D +QI E +YDPDSKVERS+R  K++ RS+ S 
Sbjct: 252 QDNIRRTLTPYLRLPNFQVTVRARVNTDRKQINETIYDPDSKVERSVRTVKESSRSQDSS 311

Query: 302 PESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAV 361
             +A TV  N+P          +S +   K EE +NYE+++K++ T    Y +E LS+AV
Sbjct: 312 SAAATTVTNNIPQNGVNNADGKQSNDENKKNEELTNYEMSSKTVTTVSGGYNIEHLSVAV 371

Query: 362 VVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNS 421
           ++N+    E       Q  ID  L EI +++S+A G+   RGD + +T++DF+ N+   +
Sbjct: 372 LINRSAFAEPNKEPPKQEAIDRQLKEIEQLISSAAGLKKERGDALKVTAVDFMFNEHEMT 431

Query: 422 GTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRR-LHNIDDAKKGE------V 474
                 F+ +L  H  +++N +  L    LV   GL   RR L      ++ E      +
Sbjct: 432 PVESPGFVAMLGSHLGSILNMIAALGIAALVVIFGLAPARRALLAESSTERTEPPPLIGM 491

Query: 475 GGKSILSP---PPISSAVT--TGLMPNDNIALDSSN--QDIFSHSRNLQSRINSYVSKQS 527
           G +S  SP    P    +    G  P   IA+      +DI    +++  R         
Sbjct: 492 GDQSFESPTFEAPTFDGIPGLAGATPGGAIAMSGPTLLEDISERRQDIARR--------- 542

Query: 528 DLRLLHMIEINEERFAKILRKWARS 552
             +L  +I+ +E + A IL++W RS
Sbjct: 543 --KLEELIQNDEAQAAAILKQWMRS 565


>gi|115523187|ref|YP_780098.1| flagellar MS-ring protein [Rhodopseudomonas palustris BisA53]
 gi|115517134|gb|ABJ05118.1| flagellar M-ring protein FliF [Rhodopseudomonas palustris BisA53]
          Length = 544

 Score =  331 bits (849), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 190/527 (36%), Positives = 301/527 (57%), Gaps = 40/527 (7%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
           ++++ P ++ LY  L   DV R+S AL +ANI F ++  G ++ V      +AR  LA +
Sbjct: 41  YYISRPEFNVLYSGLSREDVTRVSAALRDANIAFDVNATGDTVLVRPGQAAQARTLLADK 100

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLPSS+S  GYELFDK+ S GLTSFMQE+TRVRALEGEIARTIQ I G+ AARVHIVMP 
Sbjct: 101 GLPSSTSG-GYELFDKIGSLGLTSFMQEVTRVRALEGEIARTIQVIKGVKAARVHIVMPA 159

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTAN 220
            GSFR+    P+ASV++R   P+  ++A ++RHLVAAAVP +    VTVLDS G LL ++
Sbjct: 160 RGSFRREQPVPSASVVLRTEGPAEARTARSVRHLVAAAVPGMTPDKVTVLDSDGSLLGSD 219

Query: 221 EMERNILGKSLSIVQ-AIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
           E        +L+ +Q  +   I+ N++KAL  +LG+DNF  +V  +L+ D +Q  E +YD
Sbjct: 220 EDGVGSTPTTLANLQRVVSRSIQDNVSKALTPYLGLDNFEVSVATQLSTDKRQTNETIYD 279

Query: 280 PDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYE 339
           PDS+V+RS+R  ++ + S++   ++  TV+QN+P           S E   ++E+ +N+E
Sbjct: 280 PDSRVQRSVRAVREKETSQSLDRQTPTTVQQNLPDQQVNAGNGNNSNEEKQRREDVTNFE 339

Query: 340 INTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGIN 399
           +++K+I TT D + + ++ +AV+VN+ RL   LG  A +  I++ +AEI ++ + A GI+
Sbjct: 340 VSSKTITTTSDGFAVTKMFLAVLVNRPRLVASLGDKASEAAIEAKVAEIAQLAATAAGID 399

Query: 400 SRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHA 459
             RGD I +++++F+E     +    VSF D+L R   +V++A+  L    ++ + GL  
Sbjct: 400 RPRGDQIQVSAVEFIEGGRDLAPVPGVSFTDVLMRQAGSVVSAVTILAVAGMLIWFGLR- 458

Query: 460 LRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIAL-------------DSSNQ 506
                                   P  + V  G   N+   L              ++ Q
Sbjct: 459 ------------------------PAINTVLAGTKSNEASQLLMNEGAGLLAGAGGAAAQ 494

Query: 507 DIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
                + NL   ++         RL  +++++E++ A IL++W R E
Sbjct: 495 LGHEATPNLVGDVSMRAQHAPQRRLEQIVQLDEKQAAAILKQWIRQE 541


>gi|170748099|ref|YP_001754359.1| flagellar MS-ring protein [Methylobacterium radiotolerans JCM 2831]
 gi|170654621|gb|ACB23676.1| flagellar M-ring protein FliF [Methylobacterium radiotolerans JCM
           2831]
          Length = 546

 Score =  331 bits (849), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 199/556 (35%), Positives = 314/556 (56%), Gaps = 22/556 (3%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           + L + + +   LG  R++ L  V L   +      ++++ P  + LY  L   DV+R+ 
Sbjct: 5   EHLQKLWTNILDLGPRRLIALGLVGLTVFLAVGLGAYYLSRPLRETLYSGLSRDDVSRMG 64

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
            AL +A I F IS +G+S+ V      +AR+ LA +GLP S   +GYELF+ + S GLTS
Sbjct: 65  AALKDAGIPFDISADGTSVLVSYGQTAQARMLLAEKGLPQSG-KAGYELFNDLGSLGLTS 123

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV 184
           FMQ+ITRVRALEGEIARTIQ++  + AARVHIVMPD GSFR+     +ASV++R    + 
Sbjct: 124 FMQDITRVRALEGEIARTIQTLKSVKAARVHIVMPDPGSFRREQQPASASVVVRTEPAND 183

Query: 185 YKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK-LLTANEMERNILGKSLSIVQAIQHEIEM 243
              A AIR LVAAA+P +    VTVL++ G  LL  ++      G+  ++ Q++  EI+ 
Sbjct: 184 ATVAPAIRQLVAAAIPGMKPDKVTVLNTDGTVLLAGDDATTAPAGRLANLEQSVNREIQD 243

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
           NI + L  +LG +NF  +VVA LN D  +  E +++PD KVERS+R  K++  S+   P+
Sbjct: 244 NIRRTLTPYLGPNNFEVSVVARLNTDKTKTDETIFNPDQKVERSLRTIKESDSSQNRAPQ 303

Query: 304 SAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVV 363
              T +QN+P    R      S   + ++EE +N+EI++K++ T  D Y ++ LS+AV+V
Sbjct: 304 KPTTAQQNLPDQRVRSEGAENSSAESQRREELTNFEISSKTVQTVSDGYSIKTLSVAVLV 363

Query: 364 NKGRLTEVLGRSADQG---KIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN 420
           N+ RL E L   A  G    +D  +AEI ++V++A G+N  RGD + + ++ F++     
Sbjct: 364 NRSRL-EALAGGAKGGTAPPLDPQVAEIEQLVTSAAGVNRARGDQLKVAAVSFIDEGQPL 422

Query: 421 SGTVQVSFMDILSRHFATVIN-ALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
           +    + F D+L R   T+IN A + +VG LL+ F     LR   N   A+  E G +  
Sbjct: 423 APAPALGFTDVLMRQSGTLINAATILIVGCLLIWF----GLRPAVNAILARPAETGTELA 478

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
           L+ P   S +             S+ +   S   +L   +  ++++    +L  ++E++E
Sbjct: 479 LATPDAGSGLDG----------PSAEKGGTSPEPSLIEDLTEHMARSPIRKLEQLVELDE 528

Query: 540 ERFAKILRKW-ARSEI 554
           E+ A IL++W  R E+
Sbjct: 529 EQVANILKQWLTREEV 544


>gi|217976233|ref|YP_002360380.1| flagellar MS-ring protein [Methylocella silvestris BL2]
 gi|217501609|gb|ACK49018.1| flagellar M-ring protein FliF [Methylocella silvestris BL2]
          Length = 546

 Score =  330 bits (847), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 181/453 (39%), Positives = 282/453 (62%), Gaps = 2/453 (0%)

Query: 6   QLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISV 65
           QL Q + +   LG  R++ LA + +    +   A +F++ P  + LY  L+  DV+RI  
Sbjct: 6   QLEQIWANLLKLGSRRLIALAMIGVSIFAMTGLAGYFLSRPALETLYAGLDRQDVSRIGA 65

Query: 66  ALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSF 125
           AL EA+I F ++  G++I V      +AR+ LA +GLP+S  N+G ELFDK+ S GLT+F
Sbjct: 66  ALKEADIAFDVNAEGNTILVRYGETARARMLLAEKGLPNSP-NAGNELFDKLGSLGLTTF 124

Query: 126 MQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVY 185
           MQE+TRVRALEGE+ARTIQ + G+ AARVH+VMPD GSFR+    P+ASV+IR       
Sbjct: 125 MQEVTRVRALEGELARTIQLMRGVKAARVHVVMPDEGSFRRTREPPSASVVIRTEMADDV 184

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQHEIEMN 244
            +A++IRHLVA+AVP + M +VTVL++ G LL + N++  +  G  L++ + +  EI  N
Sbjct: 185 GAAKSIRHLVASAVPGMTMEEVTVLNTEGVLLASGNDLADSAPGGMLTLERTVSQEILDN 244

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPES 304
           I K L  +LG+ NF+ +V   LN D +Q  E +Y+PDS+VERS+++++  Q S+ S  +S
Sbjct: 245 IRKTLTPYLGLRNFQVSVATRLNTDKKQTNETIYNPDSRVERSVKVTRQNQLSQNSTAQS 304

Query: 305 AVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVN 364
             TVE+N+P  + +     +S E + K EE +NYE+++K+IATT   + ++ +S+AV++N
Sbjct: 305 PTTVERNLPQENVKADDGKQSNEESKKSEELTNYEVSSKTIATTSGGFAIDNISVAVLIN 364

Query: 365 KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTV 424
           +  L   LG       +   L E+ +++++A G    RGD I I+++DF++         
Sbjct: 365 RASLMASLGDRPAPEALGKQLGELEQLIASAAGARKERGDAIKISAVDFIDAGRDLEPQP 424

Query: 425 QVSFMDILSRHFATVINALVFLVGTLLVTFLGL 457
                ++L R    V+NA+  LV TLL+ + GL
Sbjct: 425 PPPVSELLMRQSGNVLNAVTILVVTLLLIWFGL 457


>gi|296447983|ref|ZP_06889889.1| flagellar M-ring protein FliF [Methylosinus trichosporium OB3b]
 gi|296254493|gb|EFH01614.1| flagellar M-ring protein FliF [Methylosinus trichosporium OB3b]
          Length = 551

 Score =  330 bits (847), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 200/563 (35%), Positives = 324/563 (57%), Gaps = 28/563 (4%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           +D+  Q   +   LG  ++  LA +  + + +     ++V+ P ++ LY  L+  DV+RI
Sbjct: 1   MDRFNQLRDNLIGLGPRKLSALALIFTLVLAITGLGAYYVSRPDFEVLYSGLDREDVSRI 60

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
              L  + + F I+  G+++ V      +AR+ LA +GLP S+ N+GYELFDKV S GLT
Sbjct: 61  GAVLKSSGVAFDINPEGNAVLVRYGQTAQARMLLAERGLPQSA-NAGYELFDKVGSLGLT 119

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS 183
           SFMQE+TRVRALEGE+ARTIQ I G+ AARVHIV+PD GSFR++   P+ASV+IR  +P 
Sbjct: 120 SFMQEVTRVRALEGELARTIQLIRGVKAARVHIVLPDEGSFRRVRQPPSASVVIRTESPD 179

Query: 184 VYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN--ILGKSLSIVQAIQHEI 241
             K+A+AIRHLVAA++P + +  VTVL++ G LL+A++ +       K+L++ + +  +I
Sbjct: 180 DSKAAQAIRHLVAASIPGMTVDQVTVLNTDGMLLSASDGDATDAAPAKTLTLEKTVSKDI 239

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
           + NI + L  +L + NF+ +V A +N D +Q  E ++DP+S+VERS+R+ K+   S+ + 
Sbjct: 240 QDNIRRTLTPYLRLANFQVSVRARINTDRKQTNETIFDPESRVERSVRVVKENSTSQNNS 299

Query: 302 PESAVTVEQNMPHVSDRKVPLPRSLENTDKK-EEQSNYEINTKSIATTHDNYKLERLSIA 360
              A +VE+N+P    +     +   + +KK EE +N+E++TK++ T    Y LE LSIA
Sbjct: 300 TSQAASVERNVPQEKPQAGGEGKQSNDENKKSEELTNFELSTKTVTTVSGGYTLENLSIA 359

Query: 361 VVVNKGRLTEVLGRSADQGK---IDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           V+VN+G L    G   D  K   ++  L EI ++V++A G+   RGDT+ ++++DF  N+
Sbjct: 360 VLVNRGSLA---GSGKDAPKPEALERQLKEIEQLVASAAGVRKDRGDTVKVSAVDFAINE 416

Query: 418 LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL------HNIDDAKK 471
              +      + + L+    +VINA   ++ TLL+ F GL    R         ++ A  
Sbjct: 417 NDLAPVEPAGWSEALTHQLGSVINAGALILVTLLLVFFGLRPASRALLAEAPAPMETALA 476

Query: 472 GEVGGKSILSPPPISSAVTTGLMPNDNIALDSSN-QDIFSHSRNLQSRINSYVSKQSDLR 530
            +VG   + + P I        MP     +D+   +DI    +  Q +           +
Sbjct: 477 DDVGPPLLGAEPSIELPFAPMEMPQFTGQMDTGLIEDIGGREKFNQQK-----------K 525

Query: 531 LLHMIEINEERFAKILRKWARSE 553
           L  +IE +E + A IL++W  +E
Sbjct: 526 LEQLIEADEMQAAAILKQWMYAE 548


>gi|90418370|ref|ZP_01226282.1| putative flagellar M-ring protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90338042|gb|EAS51693.1| putative flagellar M-ring protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 563

 Score =  330 bits (845), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 207/557 (37%), Positives = 329/557 (59%), Gaps = 11/557 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           +A+  +  Q   + T+LG  R+  L  V L+ + L     ++++ P  + LY  L+ +DV
Sbjct: 3   LAVGGKAQQLLTNLTALGPRRLGALGLVGLLVVALVGLGSYYLSRPDMETLYSGLDRTDV 62

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
            RI  AL+EA I F +   G +I  P S    AR+ LA +GLP S  N+GYELFD + S 
Sbjct: 63  TRIGAALTEAGIPFDVDSKGDAILTPFSQTAPARMLLAEKGLPRSE-NAGYELFDNLGSI 121

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQEITRVRALEGEIARTIQ++  + AARVHIV+PD GSFR+   +P+ASV++R  
Sbjct: 122 GLTSFMQEITRVRALEGEIARTIQTLRNVRAARVHIVLPDKGSFRREQQKPSASVVVRTE 181

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQH 239
           N + + SA+AIR LVA+A+P++   +VT+L++ G LL + +E       K   I   +  
Sbjct: 182 NGNDFGSAQAIRSLVASAIPSMTPEEVTILNADGTLLASGDEGVSAAPTKLFGIESVVSK 241

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           +IE +I + LA +LG+ NF+++VVA L+ D +QI E ++DP+S+VERS R  ++  +S  
Sbjct: 242 DIEQSIRRTLAPYLGIGNFQTSVVARLDTDRKQISERIFDPESRVERSTRTIRENNQSAN 301

Query: 300 SQPESAVTVEQNMPHVSDRKV---PLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLER 356
              E+ V VEQ++  V           +S E T+++EE +NYEIN K+I+TT D Y++ER
Sbjct: 302 RASETPVGVEQDVREVDAAPAGGGGGEQSSEETERREELTNYEINEKTISTTSDGYQVER 361

Query: 357 LSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLEN 416
           LS+AVVV++ R+ E +G +    +ID+ + EI  +V++A+G ++ RGD I +T++DF+ +
Sbjct: 362 LSVAVVVDRKRVLEAIGENPTDAQIDARIGEIKALVASASGFSADRGDQIEVTAVDFIAS 421

Query: 417 QLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH-ALRRLHNIDDAKKGEVG 475
                     S  ++  R   T+INAL  L   +++ + GL  A+R +  +  A+   + 
Sbjct: 422 DDALEPIPAPSLGEMFMRQSGTLINALTILAVAIMLIWFGLKPAVRAIAAMPAAEGTTLA 481

Query: 476 GKSILSPPPI---SSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLL 532
                  P +   + A++  L+  +N+  DS       +       +N  V      RL 
Sbjct: 482 ALDDDEMPELDDDARALSESLL--ENLNYDSDPAGGSGNEIGFLDDLNFNVGNSPRARLE 539

Query: 533 HMIEINEERFAKILRKW 549
            +++ NEE  A ++++W
Sbjct: 540 RLLDHNEEHAATVMKQW 556


>gi|170741410|ref|YP_001770065.1| flagellar MS-ring protein [Methylobacterium sp. 4-46]
 gi|168195684|gb|ACA17631.1| flagellar M-ring protein FliF [Methylobacterium sp. 4-46]
          Length = 572

 Score =  329 bits (844), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 200/593 (33%), Positives = 314/593 (52%), Gaps = 72/593 (12%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M+  +Q  + + +   LG  R+  L  + L   +      ++++ P  + LY  L   DV
Sbjct: 1   MSGREQAERLWNNIIELGARRLAALGIIGLTVFLAVGLGAYYLSRPAQETLYGGLSRDDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
            RI   L +ANI F +S +G+++ VP     +AR+ LA +GLP SS  SGYELF+ + S 
Sbjct: 61  GRIGSVLKDANIPFDVSTDGTAVLVPYGHTAQARMLLAEKGLPQSS-KSGYELFNDLGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQ++ G+ AARVHIV+PD GSFR+    P+ASV++R  
Sbjct: 120 GLTSFMQEVTRVRALEGEIARTIQTMKGVKAARVHIVLPDRGSFRREQQPPSASVVVRTE 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQH 239
                  A+AIRHLVA+A+P +    VTV+ + G LL + +++     GK  ++ + +  
Sbjct: 180 PADDGSGAQAIRHLVASAIPGMKPERVTVIGTDGTLLLSGDDVGNAPTGKMANLEKLVNR 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           EI+ NI + L  +LGV NF  +V A LN D     E +++PD +VERS++ +++ + S+ 
Sbjct: 240 EIQDNIRRTLTPYLGVGNFEVSVAARLNTDKTSTNETIFNPDQRVERSVKATRETENSQN 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
              +   T +QN+P    R      S   T K+E+ +NYEI++K+I T  D Y ++++S+
Sbjct: 300 RSSQRPTTAQQNLPDQRTRSDGNDTSSTETQKREDLTNYEISSKTIQTVSDGYGIKQISV 359

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AV+VNK RL+ + G +A    ID  + EI ++V++A G +  RGD + + ++ F+ +   
Sbjct: 360 AVLVNKSRLSSLAGPNAPPAAIDQQIGEIEQLVASAAGFSKERGDHVKVAAVGFVNDGAP 419

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH-ALRRLHNIDDAKK------- 471
                 +S  ++L R  AT+INA   LV   L+ + GL  ALR +  +  A++       
Sbjct: 420 LEPVPPLSLTEVLMRQSATLINAATILVVASLLIWFGLRPALRAILEVPAAEQEIAALAA 479

Query: 472 -----------------------------------GEVGGKSILSPPPISSAVTTGLMPN 496
                                              G   G + L PP ++S +       
Sbjct: 480 EGAAGAVPALPGAEAGSAAAGLLEGSPEAAALAAAGGTPGPAQLGPPVMASLID------ 533

Query: 497 DNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKW 549
                            +L +R+NS   K    +L  MIE +EE+ A IL++W
Sbjct: 534 -----------------DLTNRMNSSPQK----KLEQMIEFDEEQAANILKRW 565


>gi|90422618|ref|YP_530988.1| flagellar MS-ring protein [Rhodopseudomonas palustris BisB18]
 gi|90104632|gb|ABD86669.1| flagellar M-ring protein FliF [Rhodopseudomonas palustris BisB18]
          Length = 544

 Score =  324 bits (830), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 191/541 (35%), Positives = 310/541 (57%), Gaps = 20/541 (3%)

Query: 17  LGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRI 76
           LG  R+ +LA V L          ++++ P ++ LY  L   D+ R+S  L +AN+ F +
Sbjct: 17  LGPRRLTVLAMVGLAVFFGVGGGAYYLSRPEFNVLYSGLSREDITRVSAVLRDANVPFDV 76

Query: 77  SDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALE 136
           +  G +I V      +AR  LA +GLPSS+S  GYELFDK+ S GLTSFMQE+TRVRALE
Sbjct: 77  NATGDTILVRPGQAAQARTLLADKGLPSSTSG-GYELFDKIGSLGLTSFMQEVTRVRALE 135

Query: 137 GEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVA 196
           GEIARTIQ I G+ AARVHIVMP  GSFR+  A PTASV++R   P+  K+A ++RHLVA
Sbjct: 136 GEIARTIQVIKGVKAARVHIVMPARGSFRREQAPPTASVVLRTDGPADAKTARSVRHLVA 195

Query: 197 AAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQ-AIQHEIEMNINKALAAFLGV 255
           AAVP +    VTVLDS G LL A++        +++ +Q  +   I+ N++KAL  +LG+
Sbjct: 196 AAVPGMTPDKVTVLDSDGSLLGADDDGTGTTPTTMANLQRVVSRLIQDNVSKALTPYLGL 255

Query: 256 DNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHV 315
           DNF  +V  +L+ D +Q  E VYDP+S+V+RS+R  ++ + S++   ++  TV+QN+P  
Sbjct: 256 DNFEVSVATQLSTDKRQTNETVYDPESRVQRSVRAVRERETSQSLDRQTPTTVQQNLPDQ 315

Query: 316 SDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRS 375
                    S +   ++E+ +NYE+++K+  T  D Y + ++ +AV+VN+ RL   LG  
Sbjct: 316 QLNAGGGKNSNDEKQRREDVTNYEVSSKTTTTVSDGYVVNKMFLAVLVNRPRLIASLGDK 375

Query: 376 ADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRH 435
             +  +++ +AEI+++ + A G++  RGD I +++++F+E     +    ++F ++L R 
Sbjct: 376 VSESAMEAKVAEISQLAATAAGLDRPRGDQIQVSAVEFIEGARDLAPVPGITFTEVLMRQ 435

Query: 436 FATVINALVFL-VGTLLVTFLGLHALRRLHNI--DDAKKGEVGGKSILSPPPISSAVTTG 492
               ++A+  L V  +L+ F     LR   N+    +K  E           +  A    
Sbjct: 436 SGNFVSAITILAVAGMLIWF----GLRPAINVVLASSKSSEGAPLLAAEAAALLGADAAV 491

Query: 493 LMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARS 552
                  A+ +  QD+   +++   +           RL  +++++E++ A IL++W R 
Sbjct: 492 AAQIAREAMPNLVQDVSRRAQHAPQK-----------RLEQIVQLDEKQAAAILKQWIRQ 540

Query: 553 E 553
           E
Sbjct: 541 E 541


>gi|188579876|ref|YP_001923321.1| flagellar MS-ring protein [Methylobacterium populi BJ001]
 gi|179343374|gb|ACB78786.1| flagellar M-ring protein FliF [Methylobacterium populi BJ001]
          Length = 570

 Score =  323 bits (829), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 183/527 (34%), Positives = 300/527 (56%), Gaps = 22/527 (4%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
           ++++ P  + LY  L   DV+RI   L +  I F +S +G+++ V      +AR+ LA +
Sbjct: 41  YYLSRPAQETLYTGLSREDVSRIGGVLKDNGIPFDVSSDGTAVLVSFGHTAQARMLLAEK 100

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP SS  SGYELF+ + S G+TSFMQE+TRVRALEGEIARTIQ + G+ AARVH+V+PD
Sbjct: 101 GLPQSS-KSGYELFNDLGSLGMTSFMQEVTRVRALEGEIARTIQGMKGVRAARVHLVLPD 159

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK-LLTA 219
            GSFR+     +ASV++R         A+AIR LVA+A+P +    VTV+ S G  LL  
Sbjct: 160 RGSFRRDQQPASASVVVRTEPADDVSGAQAIRQLVASAIPGMKPDRVTVIGSEGTVLLAG 219

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
           ++      GK  ++ +++  E++ NI + L+ +LGV NF  +V  +LN D     E +Y+
Sbjct: 220 DDAGTAPTGKMATLEKSVSREMQDNIRRTLSPYLGVGNFEVSVATQLNTDKTSTNETIYN 279

Query: 280 PDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYE 339
           PD +VERS+R  ++++ ++    +   + ++N+P    R     +S   + KKE+ +NYE
Sbjct: 280 PDQRVERSVRSVRESENAQNRNSQRPTSAQENLPDQRTRSDGNDQSSNESSKKEDLTNYE 339

Query: 340 INTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGIN 399
           I+ K++ T  D Y + RLS+AV+VN+ RLT + G   D+  +D  +AEI ++V +A G +
Sbjct: 340 ISQKTVQTVSDGYAIRRLSVAVLVNRSRLTALAGPD-DKAALDKQIAEIEELVGSAAGFS 398

Query: 400 SRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH- 458
             RGDTI + ++ F+ +         +S  D++ +   T+INA   LV   L+ + GL  
Sbjct: 399 KERGDTIKVAAVGFVNDGQPLEPVPPLSLTDVMMKQSGTLINAATILVVAGLLIWFGLRP 458

Query: 459 ALRRLHNIDDAKKGEVGGKSILSP---PPISSAVTTGLMPNDNIALDSSNQDI------- 508
           ALR +    +A + EV   ++  P   P +++ + +GL  + N+AL +    +       
Sbjct: 459 ALRAILATPEAAQSEVA--ALAGPEGAPALAAGMASGLAADGNMALAAPGTALPGAVGAG 516

Query: 509 ------FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKW 549
                       L   +   +++    RL  +I+I+EE+ A +L++W
Sbjct: 517 EAAKLPAPGVAGLLEELEDKMARSPQKRLEQLIDIDEEQVAAVLKRW 563


>gi|254473325|ref|ZP_05086722.1| flagellar M-ring protein FliF [Pseudovibrio sp. JE062]
 gi|211957441|gb|EEA92644.1| flagellar M-ring protein FliF [Pseudovibrio sp. JE062]
          Length = 562

 Score =  321 bits (822), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 201/566 (35%), Positives = 334/566 (59%), Gaps = 29/566 (5%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           MA  +   + + +   LG  R+++LA + L   +   AA + ++ P  + LY  LE  DV
Sbjct: 1   MAARENAEKIYSNLAELGAKRLMVLAFIGLFTFVAIGAAAYLLSRPEQEVLYANLERDDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
            +I +AL  + I F +S +GS+ISV      +AR+ LA +GLP  S  +GYELFD++ S 
Sbjct: 61  TQIGMALQASGIPFDVSADGSAISVGVGATARARMLLAEKGLPRGS-GAGYELFDEMGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQ +T++RALEGE+AR++QS+ G+ AARVH+V+P+  +FR+   +PTASV+IR  
Sbjct: 120 GLTSFMQSVTKIRALEGEVARSVQSMQGVKAARVHLVLPEKATFRRENQKPTASVLIRTE 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNI-LGKSLSIVQAIQH 239
                  A++IR+LVAAAVP L    VTVLD+ G+LL A E  ++   G+   +   +  
Sbjct: 180 GIQTNSIAQSIRYLVAAAVPGLTAEAVTVLDTEGQLLAAGEDAQSASTGRKAMLESNLAS 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
             E  I +ALA +LGV+NF  +V A +N D Q++ E  YDP+++VERS R+ ++   S+ 
Sbjct: 240 RKENAIRQALAPYLGVNNFEVSVSASVNTDNQRVSETSYDPETRVERSFRVVRENATSQN 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
           +  E+  TVEQN+P  +       RS E  +++EE +NYEI+++++ T  D+Y++ER+SI
Sbjct: 300 ASLENPTTVEQNLPEEAVSSQSGERSSEENERREELTNYEISSRTVETIFDDYRIERMSI 359

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSY-----------LAEINKIVSAATGINSRRGDTITI 408
           AV+VN+ RL E + R  +  K D+            + EI +I++ A G+++ RGD +++
Sbjct: 360 AVLVNRDRLVEEMSRRVEGQKGDAVVEGEAADLTAKVEEIEEIIATAAGVDTARGDKVSV 419

Query: 409 TSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRR--LHNI 466
           ++++F+      +   + ++ D+L R+  +V+NA   L+ TL++ + GL       +   
Sbjct: 420 SAVNFVLAGQQLAAIPERTWQDVLMRNMGSVVNAGAILIVTLMIIWFGLRPAVAFLIPKT 479

Query: 467 DDAKKG-EVGGKSILSPPPISSAVTTGLMPNDNIAL-DSSNQDIFSHSRNLQSRINSYVS 524
           +  ++G  VG  S       S+AV  G +  ++  L D SN D  S        +++ V 
Sbjct: 480 EVVEEGLPVGANS------NSAAVRDGEIEGEDGQLPDYSNGDGLSG-----EGVDATVV 528

Query: 525 KQSDLRLLH-MIEINEERFAKILRKW 549
            + +LR L   +E+++ + A IL++W
Sbjct: 529 NRDNLRKLERAVEMDDMQAAIILKQW 554


>gi|182679604|ref|YP_001833750.1| flagellar MS-ring protein [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182635487|gb|ACB96261.1| flagellar M-ring protein FliF [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 547

 Score =  318 bits (815), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 201/560 (35%), Positives = 317/560 (56%), Gaps = 31/560 (5%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M + +Q+ + + +   LG  R++ LA V +    +   A +F++ P  + LY  L+  DV
Sbjct: 1   MTVREQIERLWANLLKLGTKRLITLAVVGVSVFAMTGLAGYFLSRPALEVLYSGLDRQDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           +RI+ AL EA+I F ++ +G+S+ V      +AR+ LA +GLP+S  N+G ELFDK+ S 
Sbjct: 61  SRIASALKEADIPFDVNADGNSVLVRFGETARARMLLAEKGLPNSP-NAGNELFDKLGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGE+ARTIQ + G+ AARVHIVMPD GSFR+    P+ASV++R  
Sbjct: 120 GLTSFMQEVTRVRALEGELARTIQLMHGVKAARVHIVMPDEGSFRRTRQPPSASVVVRME 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT--ANEMERNILGKSLSIVQAIQ 238
           +     +A+AIRHLVA+AVP + + +VTVL++ G LL   A+ ++    G  + + +A+ 
Sbjct: 180 SNDDPSAAKAIRHLVASAVPGMTVEEVTVLNTEGVLLASGADTVDGAPSGM-IMLEKAVS 238

Query: 239 HEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE 298
            EI  NI K L  +LG+ NF+ +V A LN D +Q  E +Y+PDSKVERSI +++  Q S+
Sbjct: 239 REIIDNIRKTLTPYLGLRNFQISVAARLNTDKRQTNETIYNPDSKVERSIHVTRQNQNSQ 298

Query: 299 TSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLS 358
            S  +S  +VE+N+P  + R     +S E + K++E +NYEI++K + T    Y ++ LS
Sbjct: 299 NSTVQSPTSVERNLPQENARSDDGKQSTEESQKRDELTNYEISSKVVNTVSGGYGIDNLS 358

Query: 359 IAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQL 418
           +AV+VN+  L   LG       +   + EI  +V++A G +  RGD + I+++DF++   
Sbjct: 359 VAVLVNRASLISSLGEKPTPDALAKQMNEIEMLVASAAGAHKERGDIVKISAVDFIDPSH 418

Query: 419 FNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRR--LHN-------IDDA 469
                   S  ++  R    ++NA   LV  +L+ + GL    +  L N       ID  
Sbjct: 419 ELEPQPPPSIGEMFLRQSTNLVNAATILVVAILLIWFGLRPATKAILANTRSTATAIDLR 478

Query: 470 KKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDL 529
            + E         PP     +    PN         +D+ S  R+   +           
Sbjct: 479 DEEEFQALEDDDAPPALPVWSPPSEPN-------LIEDLTSTPRHTPQK----------- 520

Query: 530 RLLHMIEINEERFAKILRKW 549
           RL  ++E +E++ A +L++W
Sbjct: 521 RLEQIVEYDEQQAAAVLKQW 540


>gi|254559216|ref|YP_003066311.1| flagellar M-ring protein FliF [Methylobacterium extorquens DM4]
 gi|254266494|emb|CAX22258.1| Flagellar M-ring protein FliF [Methylobacterium extorquens DM4]
          Length = 559

 Score =  315 bits (807), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 182/514 (35%), Positives = 294/514 (57%), Gaps = 7/514 (1%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
           ++++ P  + LY  L   DV+RI   L +  I F +S +G+++ V      +AR+ LA +
Sbjct: 41  YYLSRPAQEMLYTGLSREDVSRIGGVLKDNGIPFDVSSDGAAVLVSFGHTAQARMLLAEK 100

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP SS  SGYELF+ + S G+TSFMQE+TRVRALEGEIARTIQ + G+ AARVH+V+PD
Sbjct: 101 GLPQSS-KSGYELFNDLGSLGMTSFMQEVTRVRALEGEIARTIQGMKGVRAARVHLVLPD 159

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK-LLTA 219
            GSFR+     +ASV++R         A+AIR LVA+A+P +    VTV+ S G  LL  
Sbjct: 160 RGSFRRDQQPASASVVVRTEPADDTSGAQAIRQLVASAIPGMKPDRVTVIGSEGTVLLAG 219

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
           ++      GK  ++ +++  E++ NI + LA +LGV NF  +V  +LN D     E +++
Sbjct: 220 DDAGTAPTGKMATLEKSVSREMQDNIRRTLAPYLGVGNFEISVATQLNTDKTSTNETIFN 279

Query: 280 PDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYE 339
           PD +VERS+R  ++++ ++    +   + ++N+P    R     +S   + KKE+ +NYE
Sbjct: 280 PDQRVERSVRSVRESENAQNRNSQRPTSAQENLPDQRTRSDGNDQSSNESSKKEDLTNYE 339

Query: 340 INTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGIN 399
           I+ K++ T  D Y + RLS+AV+VN+ RLT + G   D+  +D  +AEI ++V +A G +
Sbjct: 340 ISQKTVQTVSDGYAIRRLSVAVLVNRSRLTALAGPD-DKASLDKQIAEIEELVGSAAGFS 398

Query: 400 SRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH- 458
             RGDTI + ++ F+ +         +S  D++ +   T+INA   LV   L+ + GL  
Sbjct: 399 KERGDTIKVAAVGFVNDGQPMEPVPPLSLTDVMMKQSGTLINAATILVVAGLLIWFGLRP 458

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI---FSHSRNL 515
           ALR +    +  + EV   + L   P+ +A  T  +     AL  S++           L
Sbjct: 459 ALRAILATPETAQSEVAALAGLEGAPVLAADGTMALAAPGAALPGSSEAAKLPAPGVAGL 518

Query: 516 QSRINSYVSKQSDLRLLHMIEINEERFAKILRKW 549
              +   +++    RL  +I+I+EE+ A +L++W
Sbjct: 519 LEELEDKMARSPQKRLEQLIDIDEEQVAAVLKRW 552


>gi|300024598|ref|YP_003757209.1| flagellar M-ring protein FliF [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526419|gb|ADJ24888.1| flagellar M-ring protein FliF [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 561

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 193/562 (34%), Positives = 307/562 (54%), Gaps = 23/562 (4%)

Query: 6   QLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISV 65
           Q    + S   LGR R++ L +   +   L     +F +   ++ LYV L   D++ +  
Sbjct: 5   QFQNLYSSLKGLGRQRLMALGAAGFLVFALISIGSYFASRSSFETLYVGLTPPDISSMGR 64

Query: 66  ALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSF 125
            L++A I F  S +G+ + V      +AR  LA +GLP S  N+GYELFDK+ + GLTSF
Sbjct: 65  ELAQAGIPFEASLDGTKLGVAVGQAEQARALLAEKGLPGSP-NAGYELFDKLGALGLTSF 123

Query: 126 MQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVY 185
           MQE+TRVRALEGE++RTIQ + GI AARVH+ +PD    R     PTASV+I+    S  
Sbjct: 124 MQEVTRVRALEGELSRTIQYLKGIRAARVHLYLPDQNGLRTKKQTPTASVVIKTDVASDA 183

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA-NEMERNILGKSLSIVQAIQHEIEMN 244
            +A AI+HL+AAA+P++   +V V+ + G LL        ++  + L + + I  +++ +
Sbjct: 184 TAAPAIKHLIAAAIPDMKPDEVQVIGTDGTLLGGSGSPSGDVPVQMLDLERTISTQVQDS 243

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPES 304
           + +AL+ +LG+DNF  + +A LN+D  Q  E  YDP+SKVERS R+ K+AQ S      +
Sbjct: 244 VRRALSPYLGIDNFEVSAIARLNIDKHQTTETKYDPESKVERSTRVIKEAQSSTDGSGRT 303

Query: 305 AVTVEQNMPHVSDRKVPLPRSLENT----DKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
            V+VEQN+P+ +      P + E      D+KEE +NYEI++ S +TT + YK+  +S+A
Sbjct: 304 DVSVEQNIPNEA------PTTKEQNKRAQDRKEETTNYEISSHSASTTSEGYKVNNISLA 357

Query: 361 VVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN 420
           VVVNK R+ E++G+ A    I+  +AEI K+  +A G++++RGD I++ +++F ++   +
Sbjct: 358 VVVNKKRIAEIIGKDAKTEDIEKQVAEIEKVALSAAGLDTKRGDRISVAAVEFAQSPFGD 417

Query: 421 SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI- 479
                  +  +L     T I +L  L+   +V F G     RL     A     G  ++ 
Sbjct: 418 ITAPSTDWSVMLMGLAGTGIKSLTILLIAAIVVFAGFKPAMRLLLTGSAATAIEGNGAVA 477

Query: 480 -LSPPPISSA--VTTGL-MPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDL------ 529
            L+ PPI+ A  VT  L MP     L     + F             +S    L      
Sbjct: 478 ALAGPPIADAGGVTAPLDMPEMASPLLEPGANPFDSDFGSSGFAGDGMSFGRSLAFGPVE 537

Query: 530 RLLHMIEINEERFAKILRKWAR 551
           +L  +I+ +E++   I++ W +
Sbjct: 538 KLGAIIDRDEDQATAIMKHWVK 559


>gi|240137205|ref|YP_002961674.1| Flagellar M-ring protein FliF [Methylobacterium extorquens AM1]
 gi|240007171|gb|ACS38397.1| Flagellar M-ring protein FliF [Methylobacterium extorquens AM1]
          Length = 559

 Score =  311 bits (798), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 182/514 (35%), Positives = 292/514 (56%), Gaps = 7/514 (1%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
           ++++ P  + LY  L   DV+RI   L +  I F +S +G+++ V      +AR+ LA +
Sbjct: 41  YYLSRPAQEMLYTGLSREDVSRIGGVLKDNGIPFDVSSDGTAVLVSFGHTAQARMLLAEK 100

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP SS  SGYELF+ + S G+TSFMQE+TRVRALEGEIARTIQ + G+ AARVH+V+PD
Sbjct: 101 GLPQSS-KSGYELFNDLGSLGMTSFMQEVTRVRALEGEIARTIQGMKGVRAARVHLVLPD 159

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK-LLTA 219
            GSFR+     +ASV++R         A+AIR LVA+A+P +    VTV+ S G  LL  
Sbjct: 160 RGSFRRDQQPASASVVVRTEPADDTSGAQAIRQLVASAIPGMKPDRVTVIGSEGTVLLAG 219

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
           ++      GK  ++ +++  E++ NI + LA +LGV NF  +V  +LN D     E +++
Sbjct: 220 DDAGTAPTGKMATLEKSVSREMQDNIRRTLAPYLGVGNFEISVATQLNTDKTSTNETIFN 279

Query: 280 PDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYE 339
           PD +VERS+R  ++++ ++    +   + ++N+P    R     +S   + KKE+ +NYE
Sbjct: 280 PDQRVERSVRSVRESENAQNRNSQRPTSAQENLPDQRTRSDGNDQSSNESSKKEDLTNYE 339

Query: 340 INTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGIN 399
           I+ K++ T  D Y + RLS+AV+VN+ RLT + G   D+  +D  +AEI ++V +A G +
Sbjct: 340 ISQKTVQTVSDGYAIRRLSVAVLVNRSRLTALAGPD-DKASLDKQIAEIEELVGSAAGFS 398

Query: 400 SRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH- 458
             RGDTI + ++ F+ +         +S  D++ +   T+INA   LV   L+ + GL  
Sbjct: 399 KERGDTIKVAAVGFVNDGQPMEPVPPLSLTDVMMKQSGTLINAATILVVAGLLIWFGLRP 458

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHS---RNL 515
           ALR +    +  + EV   +     P  +A  T  +     AL  S +     S     L
Sbjct: 459 ALRAILATPETAQSEVAALAGPEGAPALAADGTMALAAPGAALPGSGEAAKLPSPGVAGL 518

Query: 516 QSRINSYVSKQSDLRLLHMIEINEERFAKILRKW 549
              +   +++    RL  +I+I+EE+ A +L++W
Sbjct: 519 LEELEDKMARSPQKRLEQLIDIDEEQVAAVLKRW 552


>gi|218528674|ref|YP_002419490.1| flagellar MS-ring protein [Methylobacterium chloromethanicum CM4]
 gi|218520977|gb|ACK81562.1| flagellar M-ring protein FliF [Methylobacterium chloromethanicum
           CM4]
          Length = 559

 Score =  311 bits (796), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 181/514 (35%), Positives = 291/514 (56%), Gaps = 7/514 (1%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
           ++++ P  + LY  L   DV+RI   L +  I F +S +G+++ V      +AR+ LA +
Sbjct: 41  YYLSRPAQEMLYTGLSREDVSRIGGVLKDNGIPFDVSSDGTAVLVSFGHTAQARMLLAEK 100

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP SS  SGYELF+ + S G+TSFMQE+TRVRALEGEIARTIQ + G+ AARVH+V+PD
Sbjct: 101 GLPQSS-KSGYELFNDLGSLGMTSFMQEVTRVRALEGEIARTIQGMKGVRAARVHLVLPD 159

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK-LLTA 219
            GSFR+     +ASV++R         A+AIR LVA+A+P +    VTV+ S G  LL  
Sbjct: 160 RGSFRRDQQPASASVVVRTEPADDTSGAQAIRQLVASAIPGMKPDRVTVIGSEGTVLLAG 219

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
           ++      GK  ++ +++  E++ NI + LA +LGV NF  +V  +LN D     E +++
Sbjct: 220 DDAGTAPTGKMATLEKSVSREMQDNIRRTLAPYLGVGNFEISVATQLNTDKTSTNETIFN 279

Query: 280 PDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYE 339
           PD +VERS+R  ++++ ++    +   + ++N+P    R     +S   + KKE+ +NYE
Sbjct: 280 PDQRVERSVRSVRESENAQNRNSQRPTSAQENLPDQRTRSDGNDQSSNESSKKEDLTNYE 339

Query: 340 INTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGIN 399
           I+ K++ T  D Y + RLS+AV+VN+ RLT + G   D+  +D  +AEI ++V +A G +
Sbjct: 340 ISQKTVQTVSDGYAIRRLSVAVLVNRSRLTALAGPD-DKASLDKQIAEIEELVGSAAGFS 398

Query: 400 SRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH- 458
             RGDTI + ++ F+ +         +S  D++ +   T+INA   LV   L+ + GL  
Sbjct: 399 KERGDTIKVAAVGFVNDGQPMEPVPPLSLTDVMMKQSGTLINAATILVVAGLLIWFGLRP 458

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI---FSHSRNL 515
           ALR +    +  + EV   +     P  +A  T  +     AL  S +           L
Sbjct: 459 ALRAILATPETAQSEVAALAGPEGAPALAADGTMALAAPGAALPGSGEAAKLPAPGVAGL 518

Query: 516 QSRINSYVSKQSDLRLLHMIEINEERFAKILRKW 549
              +   +++    RL  +I+I+EE+ A +L++W
Sbjct: 519 LEELEDKMARSPQKRLEQLIDIDEEQVAAVLKRW 552


>gi|163850071|ref|YP_001638114.1| flagellar MS-ring protein [Methylobacterium extorquens PA1]
 gi|163661676|gb|ABY29043.1| flagellar M-ring protein FliF [Methylobacterium extorquens PA1]
          Length = 559

 Score =  310 bits (795), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 181/529 (34%), Positives = 290/529 (54%), Gaps = 37/529 (6%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
           ++++ P  + LY  L   DV+RI   L +  I F +S +G+++ V      +AR+ LA +
Sbjct: 41  YYLSRPAQEMLYTGLSREDVSRIGGVLKDNGIPFDVSSDGTAVLVSFGHTAQARMLLAEK 100

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP SS  SGYELF+ + S G+TSFMQE+TRVRALEGEIARTIQ + G+ AARVH+V+PD
Sbjct: 101 GLPQSS-KSGYELFNDLGSLGMTSFMQEVTRVRALEGEIARTIQGMKGVRAARVHLVLPD 159

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK-LLTA 219
            GSFR+     +ASV++R         A+AIR LVA+A+P +    VTV+ S G  LL  
Sbjct: 160 RGSFRRDQQPASASVVVRTEPADDTSGAQAIRQLVASAIPGMKPDRVTVIGSEGTVLLAG 219

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
           ++      GK  ++ +++  E++ NI + LA +LGV NF  +V  +LN D     E +++
Sbjct: 220 DDAGTAPTGKMATLEKSVSREMQDNIRRTLAPYLGVGNFEISVATQLNTDKTSTNETIFN 279

Query: 280 PDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYE 339
           PD +VERS+R  ++++ ++    +   + ++N+P    R     +S   + KKE+ +NYE
Sbjct: 280 PDQRVERSVRSVRESENAQNRNSQRPTSAQENLPDQRTRSDGNDQSSNESSKKEDLTNYE 339

Query: 340 INTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGIN 399
           I+ K++ T  D Y + RLS+AV+VN+ RLT + G   D+  +D  +AEI ++V +A G +
Sbjct: 340 ISQKTVQTVSDGYAIRRLSVAVLVNRSRLTALAGPD-DKASLDKQIAEIEELVGSAAGFS 398

Query: 400 SRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH- 458
             RGDTI + ++ F+ +         +S  D++ +   T+INA   LV   L+ + GL  
Sbjct: 399 KERGDTIKVAAVGFVNDGQPMEPVPPLSLTDVMMKQSGTLINAATILVVAGLLIWFGLRP 458

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLM------------------PNDNIA 500
           ALR +    +  + EV   ++  P    +    G M                  P   IA
Sbjct: 459 ALRAILATPETAQSEVA--ALAGPEGAPALAADGTMALAAPGAALPGSGEAAKLPAPGIA 516

Query: 501 LDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKW 549
                         L   +   +++    RL  +I+I+EE+ A +L++W
Sbjct: 517 -------------GLLEELEDKMARSPQKRLEQLIDIDEEQVAAVLKRW 552


>gi|312115289|ref|YP_004012885.1| flagellar M-ring protein FliF [Rhodomicrobium vannielii ATCC 17100]
 gi|311220418|gb|ADP71786.1| flagellar M-ring protein FliF [Rhodomicrobium vannielii ATCC 17100]
          Length = 547

 Score =  297 bits (761), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 175/466 (37%), Positives = 272/466 (58%), Gaps = 10/466 (2%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           MAI DQ+     S   LG  R+  L +V +  + +     ++V+    D LYV L  SDV
Sbjct: 13  MAIRDQIDALRVSLLGLGARRLAALVAVGVAIVAIVGVGSYYVSRAEKDVLYVGLTASDV 72

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           +RI   L EA I F  +   + I V      +AR+ LA +GLP++++ +GYELFDK+ S 
Sbjct: 73  SRIGAVLKEAGIPFDSNSEANKIFVNRGDTARARMILAERGLPNNAT-AGYELFDKLGSL 131

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQ ITRVRALEGEIARTI+++  + +ARVH+VM D GSFR+     TASV+++  
Sbjct: 132 GLTSFMQNITRVRALEGEIARTIEAMRAVNSARVHLVMADAGSFRREPQAATASVVVKPA 191

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL-GKSLSIVQAIQH 239
             +   SA AIR +VA+AVP +    V+VL + G +L+A +    +  GK L + + +  
Sbjct: 192 G-AEPPSAAAIRQIVASAVPGMKPDHVSVLSTDGTILSAGDDGPGVASGKMLDLEKQVSR 250

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           EI  NI K L   LG+ NF ++V   LN+D +QI E  +DP+SK ERS R  K++  S+ 
Sbjct: 251 EINDNIRKTLTPVLGLGNFETSVTVRLNLDRKQINETAFDPESKAERSTRTVKESSNSQN 310

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
           +  +  ++VEQN+P       P  +S   +++KEE +NYE+++KS+ T  + Y++E +++
Sbjct: 311 TNQKWNISVEQNIPTDQQNTKPSDQSKRASERKEETTNYEVSSKSVTTQSEGYRVENIAV 370

Query: 360 AVVVNKGRLTEVLGRSADQGKI--DSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           AVV+N+  L      +AD  K   D  +  + ++VS+A G++S RGD  T+ ++DF    
Sbjct: 371 AVVLNRKPLLA----AADSAKTAPDEQIRVVERLVSSAAGLDSLRGDKATVVALDFAGGN 426

Query: 418 LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL 463
            F+     ++F D +     + + A   L+ T+L   +GL    R+
Sbjct: 427 EFDQAP-SLTFWDHVMEGLGSYVIAAALLISTILFVAVGLRPSLRM 471


>gi|304392498|ref|ZP_07374438.1| flagellar M-ring protein FliF [Ahrensia sp. R2A130]
 gi|303295128|gb|EFL89488.1| flagellar M-ring protein FliF [Ahrensia sp. R2A130]
          Length = 535

 Score =  289 bits (739), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 178/517 (34%), Positives = 283/517 (54%), Gaps = 41/517 (7%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
           +F+  P ++ LYV L   D+NRI  ALSEA I + +S +G+S+ V +    +AR  LA +
Sbjct: 50  WFLAQPTFETLYVGLARDDINRIGPALSEAGIGYDVSSDGTSVLVQAGQAARARSILAER 109

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP SS  SGYELFD + S GLTSFMQE+TRVRALEGEIAR+++SI GI  ARVHIV PD
Sbjct: 110 GLPRSS-GSGYELFDNLGSLGLTSFMQEVTRVRALEGEIARSVRSIEGIQGARVHIVQPD 168

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TA 219
             SF     + +ASV+I++    + + A+A+RHLVAAAVP L +G+VTVLDS+G++L + 
Sbjct: 169 RSSFSARNRQASASVLIQSNGRDIDRVAKAVRHLVAAAVPQLAVGNVTVLDSSGQVLASG 228

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
           +E   +    +L + + +++ +  NI + L   LG  NFR AV A L+ D +   E +YD
Sbjct: 229 DEPASSTADGALGMQRLVENRLSENIARVLTPQLGASNFRVAVHAVLDTDQRTTSETIYD 288

Query: 280 PDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKV-PLPRSLENTDKKEEQSNY 338
           P+S+VERSI++ +      +SQ     TVEQ++P     +    P S   ++++EE +NY
Sbjct: 289 PESRVERSIKVVRTQDTDTSSQGGQTTTVEQDIPEEQPAQANAGPSSNRESERREETTNY 348

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E+++K I++  + Y + +L+ +VVVN          SA   +    L  +     AA G+
Sbjct: 349 EMSSKRISSVRNGYSVSKLTASVVVNA---------SALGAEPAVRLEALRASTQAAAGV 399

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           ++ RGD I +++++F+      + T     +   +    +V+ AL FL+  +LV    + 
Sbjct: 400 DAGRGDVIDVSAVEFVTAADL-AATTSSPLLLQATAQLGSVVKALAFLIALVLVLRFAIK 458

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
            L        +    V G+  ++ P  ++ +   + P  + A                  
Sbjct: 459 PLVAAAASALSPPQSVEGEGAIAGPSNNTRLAGPMGPPPSAA------------------ 500

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
                      RL  +++ + ER A++LR W R+  E
Sbjct: 501 ----------DRLAALVDQDSERAAEVLRSWVRAGEE 527


>gi|46204512|ref|ZP_00209445.1| COG1766: Flagellar biosynthesis/type III secretory pathway
           lipoprotein [Magnetospirillum magnetotacticum MS-1]
          Length = 435

 Score =  272 bits (695), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 150/383 (39%), Positives = 227/383 (59%), Gaps = 9/383 (2%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
           ++++ P  + LY  L   DV+RI   L +  I F +S +G+++ V      +AR+ LA +
Sbjct: 41  YYLSRPAQETLYTGLSREDVSRIGGVLKDNGIPFDVSSDGTAVLVSFGHTAQARMLLAEK 100

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP SS  SGYELF+ + S G+TSFMQE+TRVRALEGEIARTIQ + G+ AARVH+V+PD
Sbjct: 101 GLPQSS-KSGYELFNDLGSLGMTSFMQEVTRVRALEGEIARTIQGMKGVRAARVHLVLPD 159

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK-LLTA 219
            GSFR+     +ASV++R         A+AIR LVA+A+P +    VTV+ S G  LL  
Sbjct: 160 RGSFRREQQPASASVVVRTEPADDVSGAQAIRQLVASAIPGMKPDRVTVIGSEGTVLLAG 219

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
           ++      GK  ++ +++  E++ NI + LA +LGV NF  +V  +LN D     E +Y+
Sbjct: 220 DDAGTAPTGKMATLEKSVSREMQDNIRRTLAPYLGVGNFEVSVATQLNTDKTSTNETIYN 279

Query: 280 PDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYE 339
           PD +VERS+R  ++ + ++    +   + ++N+P    R     +S   + KKE+ +NYE
Sbjct: 280 PDQRVERSVRSVRENENAQNRNSQRPTSAQENLPDQRTRSDGNDQSSNESSKKEDLTNYE 339

Query: 340 INTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGIN 399
           I+ K+I T  D Y + RLS+AV+VN+ RLT + G   D+  ID  +AEI  I S      
Sbjct: 340 ISQKTIQTVSDGYAIRRLSVAVLVNRSRLTAMAG-PDDKAGIDKQIAEIEXIGSGLPXPR 398

Query: 400 S------RRGDTITITSMDFLEN 416
                   RGD I + ++ F+ +
Sbjct: 399 PRXLPARERGDIIKVAAVGFIND 421


>gi|265985824|ref|ZP_06098559.1| flagellar M-ring protein FliF [Brucella sp. 83/13]
 gi|264664416|gb|EEZ34677.1| flagellar M-ring protein FliF [Brucella sp. 83/13]
          Length = 324

 Score =  262 bits (670), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 145/314 (46%), Positives = 206/314 (65%), Gaps = 5/314 (1%)

Query: 4   LDQLLQFFKSGT--SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
             QL++  K GT   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 10  FQQLIEQLK-GTLGKLGARKLIALGLVGAALMGAILYTSIYLGCPSYETLYVGLSRDDVN 68

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
            + +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 69  CMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 127

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 128 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 187

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +A E        + S+ Q +   
Sbjct: 188 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVAGH 247

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S VERS+R+ +++  S  +
Sbjct: 248 VDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESCVERSVRVVRESGDSRNN 307

Query: 301 QPESAVTVEQNMPH 314
           + ++A  VEQN+P 
Sbjct: 308 RNDNATGVEQNIPQ 321


>gi|288962688|ref|YP_003452982.1| flagellar M-ring protein [Azospirillum sp. B510]
 gi|288914954|dbj|BAI76438.1| flagellar M-ring protein [Azospirillum sp. B510]
          Length = 579

 Score =  260 bits (665), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 162/452 (35%), Positives = 254/452 (56%), Gaps = 6/452 (1%)

Query: 16  SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFR 75
           SLGR R+L+LA   L  ++        ++ PH   LY  LE ++  RI+ A+ E  +   
Sbjct: 14  SLGRGRLLVLAGTGLGIVLAVAGMALLLSQPHMTALYSGLEPAEAGRIAKAVQEMGVPVN 73

Query: 76  ISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRAL 135
              +G++ISVP + V + R+ LA +GLPS     GYELFD     G+TSFMQ I R+RA+
Sbjct: 74  AGFDGTTISVPQADVSRVRMALAEKGLPSRG-GVGYELFDTDKPLGITSFMQRINRLRAM 132

Query: 136 EGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVY--KSAEAIRH 193
           EGE+ RTI+++SG+ AARVHIV+P+   F +   +PTASV++R    +    K A +IRH
Sbjct: 133 EGELGRTIETLSGVEAARVHIVLPEREEFSRSAPKPTASVVVRMRGRAAMDRKQALSIRH 192

Query: 194 LVAAAVPNLDMGDVTVLDSTGK-LLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAF 252
           LV+AAVPNL    VTV+DS+G+ LLT ++       ++  +  A +  +   + + L A 
Sbjct: 193 LVSAAVPNLKPSAVTVMDSSGELLLTEDDGPGLASARTDGLRVAAETRVARAVEQMLTAR 252

Query: 253 LGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNM 312
           LG  N R  V AE+    + +R   +DP+S+V RS +  ++ +RS+ S  E  VT EQN+
Sbjct: 253 LGAGNVRVQVAAEVETKREVVRSQSFDPNSQVVRSTQTVQEQERSQDSNGEPPVTAEQNL 312

Query: 313 PHVSDR-KVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEV 371
           P    R +   P+S  +T ++EE  NYEI+  S  T  +   + RLS+AV+VN    T  
Sbjct: 313 PQRDVRAQSQGPQSSNDTKRQEETVNYEISNVSRETVIEPGDVRRLSVAVLVNGTWKTAP 372

Query: 372 LGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLE-NQLFNSGTVQVSFMD 430
            G    + +    L  + ++V +A G +  RGD +T+ +++F++         +     +
Sbjct: 373 DGTRQYEPRSTEELRRLGELVRSAMGFSEARGDRVTVDNLEFVDLAPDLTPRPLGDEIAE 432

Query: 431 ILSRHFATVINALVFLVGTLLVTFLGLHALRR 462
            L+R+  T+I  ++ LV + LV  +GL  L R
Sbjct: 433 TLTRNIMTLIQWVILLVLSALVILVGLRPLIR 464


>gi|261216584|ref|ZP_05930865.1| flagellar M-ring protein FliF [Brucella ceti M13/05/1]
 gi|261319454|ref|ZP_05958651.1| flagellar M-ring protein FliF [Brucella ceti M644/93/1]
 gi|260921673|gb|EEX88241.1| flagellar M-ring protein FliF [Brucella ceti M13/05/1]
 gi|261292144|gb|EEX95640.1| flagellar M-ring protein FliF [Brucella ceti M644/93/1]
          Length = 332

 Score =  253 bits (645), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 147/322 (45%), Positives = 211/322 (65%), Gaps = 2/322 (0%)

Query: 17  LGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRI 76
           LG  +++ L  V    +   +    ++  P Y+ LYV L   DVNR+ +AL EA I F +
Sbjct: 12  LGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVNRMGLALGEAGIPFDV 71

Query: 77  SDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALE 136
             +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S GLTSFMQEITRVRALE
Sbjct: 72  KSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLGLTSFMQEITRVRALE 130

Query: 137 GEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVA 196
           GEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA      +SA++IR LV 
Sbjct: 131 GEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEGGFSAESAQSIRQLVT 190

Query: 197 AAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGV 255
           AAVP+LD   VTVLD+ G LL +A E        + S+ Q +   ++ +I KALA +LG+
Sbjct: 191 AAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASHVDDSIRKALAPYLGL 250

Query: 256 DNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHV 315
            +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  ++ ++A  VEQN+P  
Sbjct: 251 GHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNNRNDNATGVEQNIPQE 310

Query: 316 SDRKVPLPRSLENTDKKEEQSN 337
             +      S E TD++EE +N
Sbjct: 311 QIQNRNGESSTEKTDRREELTN 332


>gi|218508689|ref|ZP_03506567.1| flagellar MS-ring protein [Rhizobium etli Brasil 5]
          Length = 332

 Score =  252 bits (644), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 151/357 (42%), Positives = 213/357 (59%), Gaps = 43/357 (12%)

Query: 206 DVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVA 264
           DVT+LDS G+LL + +E   + L +SL+IVQ +Q E+E NI+KALA FLG+DNFRS+V A
Sbjct: 2   DVTILDSAGQLLASGDEASNSSLNRSLNIVQNVQQEVESNIDKALAPFLGMDNFRSSVTA 61

Query: 265 ELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRK--VPL 322
           +LN D QQI+E  YDP+SKVERS+R +K+AQ+S+  Q ++A TVEQN+P  +        
Sbjct: 62  DLNTDAQQIQETTYDPESKVERSVRSTKEAQQSQQKQSDNATTVEQNIPQAAPDAGGASG 121

Query: 323 PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKID 382
           P S + +DK+EEQ +Y+IN+++ ATT ++YK+E+LSIAVVVN                  
Sbjct: 122 PESQDKSDKREEQIHYDINSRTTATTRNSYKVEKLSIAVVVN------------------ 163

Query: 383 SYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINA 442
                     ++A GI+++RGD +T+T+MDFLENQL    T  V  MD+LSR+ A +IN+
Sbjct: 164 ----------TSAAGIDAKRGDVVTVTAMDFLENQLLEDATGGVRVMDMLSRNLAGIINS 213

Query: 443 LVFLVGTLLVTFLGLHALRRLHNIDDAKK------GEVGGKSILSPPPISSAVTTGLMPN 496
           L F+    +V ++GL  L R  + + A         E  G  +    P   A    LM  
Sbjct: 214 LAFVAVAFVVVWMGLRPLVRSVSGNGASAVLGDATPEAAGLELPDFAPAVGAPGGALM-- 271

Query: 497 DNIALD---SSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWA 550
           D    D    S +D+ S   +     N  V +  + +L  M+EINEER AKILRKWA
Sbjct: 272 DGFGSDFGFDSTEDLLSLGDD-DGNFNRRVKEGPERKLARMVEINEERAAKILRKWA 327


>gi|218460680|ref|ZP_03500771.1| flagellar MS-ring protein [Rhizobium etli Kim 5]
          Length = 310

 Score =  252 bits (643), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 139/318 (43%), Positives = 202/318 (63%), Gaps = 28/318 (8%)

Query: 254 GVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMP 313
           G+DNFRS+V A+LN D QQI+E  YDP+SKVERS+R +K+AQ+S+  Q ++A TVEQN+P
Sbjct: 1   GMDNFRSSVTADLNTDAQQIQETTYDPESKVERSVRSTKEAQQSQQKQSDNATTVEQNIP 60

Query: 314 HVSDRKVPLP--RSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEV 371
             +          S + +DK+EEQ+NYEIN+K+ ATT ++Y++E+LSIAVVVNKGR+ ++
Sbjct: 61  QAAPDAGGAGGPESQDKSDKREEQTNYEINSKTTATTRNSYQVEKLSIAVVVNKGRIAKM 120

Query: 372 LGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDI 431
           +G  ADQ K+D+Y+AE+ KIV++A GI+++RGD +T+T+MDFLENQL    T  V  MD+
Sbjct: 121 VGEPADQAKVDAYIAEMQKIVASAAGIDAKRGDVVTVTAMDFLENQLLEDATGGVRVMDM 180

Query: 432 LSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTT 491
           LSR+ A +IN+L F+    +V ++GL  L R      +  G   G ++    P S+ +  
Sbjct: 181 LSRNLAGIINSLAFVAVAFVVVWMGLRPLVR------SVSGNGAGAALGDSSPESAGLE- 233

Query: 492 GLMPN-------------DNIALD---SSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMI 535
             +P+             D    D    S +D+ S   +     N  V +  + +L  M+
Sbjct: 234 --LPDFAPAAGASGGALMDGFGSDFGFDSTEDLLSLGDD-DGNFNRRVKEGPERKLARMV 290

Query: 536 EINEERFAKILRKWARSE 553
           EINEER AKILRKWA  E
Sbjct: 291 EINEERAAKILRKWAIDE 308


>gi|254706488|ref|ZP_05168316.1| flagellar MS-ring protein [Brucella pinnipedialis M163/99/10]
          Length = 330

 Score =  247 bits (631), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 146/314 (46%), Positives = 208/314 (66%), Gaps = 5/314 (1%)

Query: 4   LDQLLQFFKSGT--SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
             QL++  K GT   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 5   FQQLIEQLK-GTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 63

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 64  RMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 122

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 123 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 182

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +A E        + S+ Q +   
Sbjct: 183 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASH 242

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  +
Sbjct: 243 VDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNN 302

Query: 301 QPESAVTVEQNMPH 314
           + ++A  VEQN+P 
Sbjct: 303 RNDNATGVEQNIPQ 316


>gi|261313942|ref|ZP_05953139.1| flagellar MS-ring protein [Brucella pinnipedialis M163/99/10]
 gi|261302968|gb|EEY06465.1| flagellar MS-ring protein [Brucella pinnipedialis M163/99/10]
          Length = 335

 Score =  246 bits (629), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 146/314 (46%), Positives = 208/314 (66%), Gaps = 5/314 (1%)

Query: 4   LDQLLQFFKSGT--SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
             QL++  K GT   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 10  FQQLIEQLK-GTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 68

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 69  RMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 127

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 128 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 187

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +A E        + S+ Q +   
Sbjct: 188 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASH 247

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  +
Sbjct: 248 VDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNN 307

Query: 301 QPESAVTVEQNMPH 314
           + ++A  VEQN+P 
Sbjct: 308 RNDNATGVEQNIPQ 321


>gi|288960029|ref|YP_003450369.1| flagellar M-ring protein [Azospirillum sp. B510]
 gi|288912337|dbj|BAI73825.1| flagellar M-ring protein [Azospirillum sp. B510]
          Length = 553

 Score =  230 bits (587), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 169/563 (30%), Positives = 286/563 (50%), Gaps = 24/563 (4%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           ++ LLQ  ++   LG  R+  +  V L+ I  F+     +++P  + LY +L+ ++   I
Sbjct: 1   MNNLLQTLRN---LGPARLAAIGGVGLLLIGFFVYLTTRLSTPEMELLYAELQPTEAAAI 57

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
           +  L EA + F +  +G+ I VP+  VG  R+ +AAQGLPS  S  GYELFDK   FG T
Sbjct: 58  AKKLEEAKVPFSVDKSGTKIMVPADQVGPMRMRMAAQGLPSGGS-VGYELFDKGEGFGAT 116

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS 183
           SFMQ I  +RALEGE+ART+Q+++G+  ARVH+V+P    F +     TASV ++ + P 
Sbjct: 117 SFMQNINHLRALEGEMARTVQTLNGVQQARVHLVLPKRELFARQQNPATASVFLK-LRPG 175

Query: 184 VYKSAE---AIRHLVAAAVPNLDMGDVTVLDSTGKLL---TANEMERNILGKSLSIVQAI 237
              S E   AI+ L+AA+VPNLD   ++++D  GKLL   T ++    ++  +    QA 
Sbjct: 176 AQLSRENIQAIQQLIAASVPNLDPNRISIVDDKGKLLARGTGSDTAEAMMASAEEKKQAY 235

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRS 297
           +  +   I   L   LG    R+ V A+L+ D    +  ++DPDS+V RS +   ++  S
Sbjct: 236 EGRLARTIEDLLGRTLGYGKVRAEVSADLDFDRITTQSEIFDPDSQVVRSTQTVNESNES 295

Query: 298 ETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
               P + VTV+QN+P         P S   +++ EE  NYEI   + +   ++ ++ RL
Sbjct: 296 SDRDPLAPVTVDQNLPTAQSSSSASPLSSNKSNRAEETINYEITKTTKSHVRESGQVRRL 355

Query: 358 SIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFL--E 415
           S+AV+V+           A Q + D  +  I  +V +A G+++ RGD++ + +M F   E
Sbjct: 356 SVAVLVDGTYQLSKDAPPAYQPRSDQEIESIKALVRSAVGLDAVRGDSLEVINMRFWSPE 415

Query: 416 NQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHAL--RRLHNIDDAKKGE 473
           + +     +   FM +       +   +V  +  +L+  L +  L  R     +  ++ E
Sbjct: 416 DDIQKPDEL---FMGMTKDDLFRIAEMVVLGIVAVLIILLVIRPLIARAFEKAEMQEEDE 472

Query: 474 VGGKSILSPP---PISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLR 530
           +    +L+     P + A  TG +  D +AL+++  D         +R+   V   S  +
Sbjct: 473 M--DRLLTDQAGMPAALAAPTGALAQD-LALEAAQADEELEQMIDINRVEGRVRASSLRK 529

Query: 531 LLHMIEINEERFAKILRKWARSE 553
           +  +++ + E    ILR W   E
Sbjct: 530 VGEIVDKHPEEAVSILRNWLYQE 552


>gi|209963531|ref|YP_002296446.1| flagellar M-ring protein FliF [Rhodospirillum centenum SW]
 gi|209956997|gb|ACI97633.1| flagellar M-ring protein FliF [Rhodospirillum centenum SW]
          Length = 573

 Score =  227 bits (578), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 149/422 (35%), Positives = 242/422 (57%), Gaps = 19/422 (4%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
           A++  LLQ  ++   LG+ R+++LA+     ++      F ++      LY  L+ ++  
Sbjct: 22  AVVANLLQNLRA---LGQRRLMLLAAAGAGVLLAVALVAFGLSRAPMGLLYAGLDDAEAG 78

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           RI   L    + +++S  G +I +P   + + R+ LA QGLPS+   +GYELFD+  + G
Sbjct: 79  RILTQLQSMKVPYQVSGTGGAILLPQDQIARTRMLLAQQGLPSAG-GAGYELFDEQGALG 137

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQ + + RALEGE+ARTIQ+++G+ +ARVH+ MPD  +F    A   ASV++R + 
Sbjct: 138 LTSFMQRLNKARALEGELARTIQTLNGVKSARVHLSMPDGEAFAPGAAPAGASVVVRTVT 197

Query: 182 PSVYKS-AEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHE 240
             + +S A AIRHLVAAAVP L  G VTV+D++G +L A+    +  G +L   + ++  
Sbjct: 198 GGLDRSQALAIRHLVAAAVPRLQPGAVTVMDASGVVLAADGGATD--GLALLHAEELRSA 255

Query: 241 IEMNINKALAAFL----GVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQR 296
            E  + +A+   L    G  N R  V AE+++  + +RE  +DP+S+V RS +  ++ + 
Sbjct: 256 TETRLARAIEEMLVPRFGPGNIRVRVAAEIDLGRETLREQTFDPNSRVLRSTQTVEERES 315

Query: 297 S---ETSQPESAVTVEQNMP-HVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNY 352
           S   +T QP    TVEQN+P   +D + P     E+  ++EE +NYEI++       D  
Sbjct: 316 SLDRDTDQP---TTVEQNLPLEAADAQAPQGSRSESA-REEETANYEISSILRERAQDAG 371

Query: 353 KLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMD 412
           ++ RL++AVVVN   +    G+S  Q + D  L+ I  +V  A G + RRGD + + ++ 
Sbjct: 372 EIRRLAVAVVVNGSYVPGADGKSVYQPRSDEELSRIEHLVRTAIGFDDRRGDMVAVENLQ 431

Query: 413 FL 414
           FL
Sbjct: 432 FL 433


>gi|56384261|gb|AAV85779.1| FliF [Azospirillum brasilense]
          Length = 521

 Score =  216 bits (550), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 162/526 (30%), Positives = 267/526 (50%), Gaps = 24/526 (4%)

Query: 43  VNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGL 102
           +++P  + LY +L+ ++   I+  L EA + F +   G+ I V +  VG  R+ +AA GL
Sbjct: 4   LSTPEMELLYAELQPTEAAAIAKKLEEAKVPFTVDKTGTKIMVAAEQVGPTRMRMAAAGL 63

Query: 103 PSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMG 162
           PS  S  GYELFDK   FG TSFMQ I  +RALEGE+ART+Q+++G+ +ARVH+V+P   
Sbjct: 64  PSGGS-IGYELFDKGEGFGATSFMQNINHLRALEGEMARTVQTLNGVQSARVHLVLPKRE 122

Query: 163 SFRKIGARPTASVMIRAINPSVYKSAE---AIRHLVAAAVPNLDMGDVTVLDSTGKLL-- 217
            F +     TAS+ I+ + P    S E   AI+HL+AA+VPNLD   ++++D  G LL  
Sbjct: 123 LFARQQNPATASIFIK-LRPGAQLSRENIQAIQHLIAASVPNLDPSRISIVDDKGTLLAR 181

Query: 218 -TANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI 276
            T N+    +L  +     A +  +   I   L   +G    R+ V A+L+ D    +  
Sbjct: 182 GTGNDSADAMLASAEEKKVAYESRVARIIEDLLGRTVGYGKVRAEVSADLDFDRITTQSE 241

Query: 277 VYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQS 336
           ++DP+S+V RS +   +A  S    P S VTV+QN+P         P S    ++ EE  
Sbjct: 242 IFDPESQVVRSTQTVTEANESHDRDPLSPVTVDQNLPTAQSGNNAGPISQNKQNRSEETI 301

Query: 337 NYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGR----SADQGKIDSYLAEINKIV 392
           NYEI+  +     ++ ++ RLS+AV+V+    T  L R    +A Q + +  L  I  +V
Sbjct: 302 NYEISRTTKNHVRESGQVRRLSVAVLVDG---TYSLPRDGNPAAYQPRPEQELESIKALV 358

Query: 393 SAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLV 452
            +A G+++ RGDT+ + +M F   +  +    +  F+ +       +   +V  +  +L+
Sbjct: 359 RSAVGLDAVRGDTLEVINMRFWSPE-DDVQKPEELFLGMTKDDLFRIAEMVVLGIVAVLI 417

Query: 453 TFLGLHAL--RRLHNIDDAKKGEVGGKSIL---SPPPISSAVTTGLMPNDNIALDSSNQD 507
             L +  L  R     D  ++ ++    +L   S  P + A  TG +  D +AL+++  D
Sbjct: 418 ILLVIRPLITRAFEKADQQEEDDM--DRLLADQSGMPAALAAPTGALAQD-LALEAAQAD 474

Query: 508 IFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
                    +R+   V   S  ++  ++E + E    ILR W   E
Sbjct: 475 EELEQMIDINRVEGRVRASSLRKVGEIVEKHPEEAVSILRNWLYQE 520


>gi|114765263|ref|ZP_01444395.1| flagellar M-ring protein [Pelagibaca bermudensis HTCC2601]
 gi|114542398|gb|EAU45426.1| flagellar M-ring protein [Roseovarius sp. HTCC2601]
          Length = 535

 Score =  209 bits (533), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 151/472 (31%), Positives = 239/472 (50%), Gaps = 26/472 (5%)

Query: 34  MLFMAARFF----VNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSM 89
           M+F  A FF    V +P Y  LY  L  ++  R+  +L +A I  R    G+++SVP   
Sbjct: 1   MVF--AMFFGLSAVTTPDYVALYRDLSPAEAGRMVESLEQAGIRSRTDMAGTAVSVPGED 58

Query: 90  VGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGI 149
           + +AR+ LA  GLP+  +  G+E+FD+ +  G+ +FMQ + R RA+EGE+AR+IQ+I G+
Sbjct: 59  MARARMLLAGAGLPNDGT-PGWEIFDEASGLGMNTFMQRVNRARAMEGELARSIQTIDGV 117

Query: 150 VAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTV 209
            AARVH+V+P+   F +   RP+ASV++R       + A AIR LVA+AVP+L    VTV
Sbjct: 118 EAARVHLVLPEREPFSRERPRPSASVIVRGSRQVGMRQARAIRSLVASAVPDLAPAQVTV 177

Query: 210 LDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMD 269
           L +TG+ + + + E        S    I+  +   I + L+A +G  N R  V  +L  +
Sbjct: 178 LSATGETILSEDGEAGSEASLQSARAQIEDRLGQRIAQILSARVGAGNARVQVSVDLTTE 237

Query: 270 TQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENT 329
            Q +RE  YDPD +V RS   +++  R + +     V V  ++P      VP   +    
Sbjct: 238 RQVVREQTYDPDQRVVRSTE-TREETREDQTAAGGEVGVADDIPAALAADVPG-NNRNTA 295

Query: 330 DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKID------S 383
           +   E  NYEI   S  T  +   +E++S+AV+VN       +    D G +D       
Sbjct: 296 NSTNEIVNYEIGGTSSETVREPGDIEKVSVAVLVNG------IYNVQDGGAVDYEERSQE 349

Query: 384 YLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINAL 443
            L  +  +V +A G +  RGD++ + S+ F++  +     V  SF   L+ +  T++  +
Sbjct: 350 ELQRLEALVQSAIGFDEARGDSVEVVSLRFMDYSMDVGEPVSRSFAQTLTENTGTILRGV 409

Query: 444 VFLVGTLLVTFLGLH-ALRRLHNIDDAKKGEVGGKSILSPPPISS--AVTTG 492
             L     V  LG+  AL R+   D     E G   +   PP  +  A TTG
Sbjct: 410 FALALVAAVLALGVRPALNRV--FDQPAIAEGGSADLPGLPPSGNLPATTTG 459


>gi|209964124|ref|YP_002297039.1| flagellar MS-ring protein [Rhodospirillum centenum SW]
 gi|209957590|gb|ACI98226.1| flagellar M-ring protein FliF [Rhodospirillum centenum SW]
          Length = 556

 Score =  209 bits (532), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 160/554 (28%), Positives = 264/554 (47%), Gaps = 17/554 (3%)

Query: 10  FFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSE 69
           F ++  +LG  R+  +    LV + LF+      +SP    LY  L  +D   I   L +
Sbjct: 9   FLQTLRNLGAVRLAAIGGATLVIVGLFVYMMSQWSSPGMSLLYSDLTPADGGAIVQQLEQ 68

Query: 70  ANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEI 129
             I ++ S +G+ I VPS  VG+ R+ +A QGLPS   N GYELF++    G TSFMQ I
Sbjct: 69  QQIPYKASPDGTRIEVPSDQVGRVRMLMAQQGLPSGG-NVGYELFNQPEGLGTTSFMQNI 127

Query: 130 TRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE 189
            ++RALEGE++RT+Q++  + AAR+H+V+P    F +     TASV +R + P      E
Sbjct: 128 QQLRALEGELSRTVQTLQPVQAARIHLVLPKRELFSRQNQTATASVFVR-LRPGASLGKE 186

Query: 190 ---AIRHLVAAAVPNLDMGDVTVLDSTGKLLT---ANEMERNILGKSLSIVQAIQHEIEM 243
              AI+ LVAAAVP L+   V ++D  G +L     ++ +  +L  +     A +  +  
Sbjct: 187 QVLAIQTLVAAAVPQLEPDMVAIVDDKGNVLARGMGSDSQEAMLATAEEKKLAYEQRLTQ 246

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            +   L+  +G    R+ V AEL+ D       +YDPDS+V RS +   +    +     
Sbjct: 247 TVEDLLSRTVGFGRVRAQVSAELDFDRITTNSEIYDPDSQVVRSTQTVNEQSEDQNRDGI 306

Query: 304 SAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVV 363
             VTV  N+P           S   T + EE  NYEIN        +  ++ RLS+AV+V
Sbjct: 307 DPVTVANNLPTADATNTASGLSSSKTSRAEESINYEINRTVKVHERETGQIRRLSVAVLV 366

Query: 364 NKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF-LENQLFNSG 422
           +        G S  Q + ++ L ++ ++V +A G ++ RGDT+ + +M F   + L   G
Sbjct: 367 DGTYAAAEDGTSTYQPRPEAELDQLRRLVESAIGFDAARGDTVEVVNMRFATPDDLAGLG 426

Query: 423 TVQVSFM---DILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
              +  +   D+       V+  +  LV  L++  L   AL R   ++D      GG  +
Sbjct: 427 EETIFGLPKEDVFRIAQTIVLAIVAILVILLVIKPLVARALDRTPQLEDEPDLLAGGDGV 486

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
               P  +    G +  + +AL+++  +         +R++  V   S  ++  ++E + 
Sbjct: 487 ----PQLAGPGGGALARE-LALEAAQANEELEQMIDINRVDGRVRASSLRKVGEIVEKHP 541

Query: 540 ERFAKILRKWARSE 553
           E    I+R W   E
Sbjct: 542 EEAVSIIRNWLYQE 555


>gi|17988495|ref|NP_541128.1| flagellar M-ring protein FLIF [Brucella melitensis bv. 1 str. 16M]
 gi|265998972|ref|ZP_05464502.2| flagellar M-ring protein FliF [Brucella melitensis bv. 2 str. 63/9]
 gi|17984286|gb|AAL53392.1| flagellar m-ring protein flif [Brucella melitensis bv. 1 str. 16M]
 gi|263091454|gb|EEZ15990.1| flagellar M-ring protein FliF [Brucella melitensis bv. 2 str. 63/9]
 gi|326554600|gb|ADZ89239.1| flagellar MS-ring protein [Brucella melitensis M5-90]
          Length = 242

 Score =  204 bits (518), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 147/218 (67%), Gaps = 4/218 (1%)

Query: 4   LDQLLQFFKSGT--SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
             QL++  K GT   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 10  FQQLIEQLK-GTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 68

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 69  RMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 127

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 128 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 187

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +
Sbjct: 188 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLAS 225


>gi|326411311|gb|ADZ68375.1| flagellar MS-ring protein [Brucella melitensis M28]
          Length = 239

 Score =  204 bits (518), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 147/218 (67%), Gaps = 4/218 (1%)

Query: 4   LDQLLQFFKSGT--SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
             QL++  K GT   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 7   FQQLIEQLK-GTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 65

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 66  RMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 124

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 125 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 184

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +
Sbjct: 185 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLAS 222


>gi|256042874|ref|ZP_05445820.1| flagellar M-ring protein FLIF [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256112169|ref|ZP_05453090.1| flagellar M-ring protein FLIF [Brucella melitensis bv. 3 str.
           Ether]
          Length = 237

 Score =  204 bits (518), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 147/218 (67%), Gaps = 4/218 (1%)

Query: 4   LDQLLQFFKSGT--SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
             QL++  K GT   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 5   FQQLIEQLK-GTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 63

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 64  RMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 122

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 123 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 182

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +
Sbjct: 183 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLAS 220


>gi|83591884|ref|YP_425636.1| flagellar MS-ring protein [Rhodospirillum rubrum ATCC 11170]
 gi|83574798|gb|ABC21349.1| Flagellar FliF M-ring protein [Rhodospirillum rubrum ATCC 11170]
          Length = 551

 Score =  197 bits (500), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 160/570 (28%), Positives = 274/570 (48%), Gaps = 49/570 (8%)

Query: 10  FFKSGTSLGRTRILILASVI--LVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           F ++  +LG  R+  LA V   L+  ++++A+R    S   + LY  L  +D  +I   L
Sbjct: 4   FVQTMRNLGPVRLAALAGVAIALIGFVIYVASRLSGTS--MELLYGDLAPADAKQIIAQL 61

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
            E NI ++++++G S+ VPS  V K R+ +A   LPS ++  GYE+FD  ++ G T F Q
Sbjct: 62  EERNIPYQMANDGRSVLVPSDQVLKLRVQMAESALPSGAT-VGYEIFDSASALGSTQFTQ 120

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI----RAINPS 183
            I  VRALEGE+ART+++I G+  ARVH+V+P    F +    P+ASV++    R + P 
Sbjct: 121 NINMVRALEGELARTVRTIQGVEGARVHLVLPKREPFTRDQVAPSASVVLLMKGRRLQP- 179

Query: 184 VYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL--GKSLSIVQAIQHEI 241
             +   A+++LVAAAVP +  G V+++D  G LLT    E   L       + +A +  +
Sbjct: 180 --EQVVAVQNLVAAAVPGMKPGQVSIIDERGTLLTRGMGEEGALIAQNQDELRKAEERRL 237

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
             +I + L   +GV   R+ VVA+++ +        +DP+ +V RS     +  +S  S 
Sbjct: 238 AQSIEQLLERTIGVGKVRAEVVADMDFNRIVTSRESFDPNGQVVRSTTTVDEQNKS--SD 295

Query: 302 PESAVTVEQNMPH---VSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLS 358
             S V+V+QN+P      +   P  ++ EN  + EE  NYEI         +   ++RLS
Sbjct: 296 AVSNVSVQQNLPEAQFAGNGGAPTSQTSEN--RTEETVNYEITKIVTNEVKEAGVVKRLS 353

Query: 359 IAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQL 418
           +AV+V+    T   G +  Q + D  + +I  +V +A G +  RGD I + +M F++   
Sbjct: 354 VAVMVDGTSTTNDAGVTTWQPRSDDEMQKITSLVRSAMGYDQARGDQIEVVNMQFIDPGA 413

Query: 419 FNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHAL--RRLHNIDDAKKGEVGG 476
                    F+         +   L   V  +L+  L +  L  R   N+      + GG
Sbjct: 414 LFDDAAAWEFLGFTKAEVMKMAEGLGVAVVAILIILLVVRPLVQRAFENLPSG--ADQGG 471

Query: 477 KSILSPP---------PISSAVTTGL--MPNDNIALDSSNQ--DIFSHSRNLQSRINSYV 523
             +L+           P   ++  G+  MP++   +D + +  DI         ++   V
Sbjct: 472 AGLLTAEMQSHPQLTGPGGGSIPAGMLGMPDE---MDDAEELIDI--------DKVEGRV 520

Query: 524 SKQSDLRLLHMIEINEERFAKILRKWARSE 553
              S  ++  +++ + E    I+R W   E
Sbjct: 521 KASSLRKIGEIVDKHPEEALSIIRNWLYQE 550


>gi|83955113|ref|ZP_00963769.1| flagellar FliF M-ring protein [Sulfitobacter sp. NAS-14.1]
 gi|83840442|gb|EAP79615.1| flagellar FliF M-ring protein [Sulfitobacter sp. NAS-14.1]
          Length = 564

 Score =  195 bits (496), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 136/451 (30%), Positives = 231/451 (51%), Gaps = 11/451 (2%)

Query: 16  SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFR 75
           SLG+ ++++L    +  ++L +     V  P Y  LY  L ++  N I   L+ A  +  
Sbjct: 10  SLGKNKLMMLGGAGIGVVLLMILGIGAVTRPDYAPLYSNLSITSANSIEATLANAGFNAM 69

Query: 76  ISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRAL 135
           +S++G+SISVP     +AR+ LA  G+P    + G+ELFD+ +   + SF+Q+I ++RA+
Sbjct: 70  VSEDGTSISVPRGDAVRARMVLAETGMPIDG-DPGWELFDESSGLAMNSFLQKINKMRAM 128

Query: 136 EGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVY--KSAEAIRH 193
           EGE+AR+IQ++ GI +ARVH+V+PD   F +    P AS+++R  +      K A A+ +
Sbjct: 129 EGELARSIQTLDGISSARVHLVLPDREPFSRDAPAPRASIILRPESGRAVTRKQAVAVSN 188

Query: 194 LVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFL 253
           LVA+AV +LD+  VTVL ++G+ + A   + +  G   S    I+  +   I   L A +
Sbjct: 189 LVASAVADLDISRVTVLSASGETILAEGPDGSSQGGVQSAKAGIEDRLSQEIQNILTARV 248

Query: 254 GVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESA-VTVEQNM 312
           G  N R  V  EL    + I E  YDPD +V RS     + Q   T   E+  V VE N+
Sbjct: 249 GAGNARVHVNVELTTQREVIVEQTYDPDQQVVRSTETKSEDQ---TGTKEAGNVGVENNI 305

Query: 313 PHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVL 372
           P           S   ++  +E   YEI         +   + R+S+AV+VN   +  V 
Sbjct: 306 PAALADGNGAGTSTRRSE-ADEIVQYEIGNTRREIVREAGDVRRMSVAVLVNG--IYNVD 362

Query: 373 GRSADQG-KIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDI 431
           G       +    LA + ++V  A G ++ RGD++++ SM F++  +     +  S  D 
Sbjct: 363 GSDVIYAERTPEELARLGELVKTAVGFDTTRGDSVSVDSMRFMDYSMDLGDPIDKSIGDE 422

Query: 432 LSRHFATVINALVFLVGTLLVTFLGLHALRR 462
           L+ +  +++  ++ L+   L+   G+  + R
Sbjct: 423 LTDNVVSIVRGVLALLVVGLILVFGVRPMLR 453


>gi|254470345|ref|ZP_05083749.1| flagellar M-ring protein FliF [Pseudovibrio sp. JE062]
 gi|211960656|gb|EEA95852.1| flagellar M-ring protein FliF [Pseudovibrio sp. JE062]
          Length = 528

 Score =  193 bits (491), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 154/535 (28%), Positives = 266/535 (49%), Gaps = 25/535 (4%)

Query: 27  SVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVP 86
           + +L+ +  F+  R    +P    L+  L + D   I   +    + + +  NG S+ VP
Sbjct: 2   AALLIGLFSFIIVR--ATAPQMVPLFTDLTLEDAAAIVSQVESQGVSYELGVNGRSVLVP 59

Query: 87  SSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSI 146
              V + R+ LA  GLPS     GYE+FDK ++ G TSF+Q + R RALEGE++RTI+SI
Sbjct: 60  QENVHRLRMTLAEAGLPSGG-GVGYEIFDKTDTLGATSFVQNLNRTRALEGELSRTIRSI 118

Query: 147 SGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGD 206
             I +ARVH+V+P+   F++    PTAS+ I+           AI+HLVA AV  L+   
Sbjct: 119 GRIASARVHLVIPEKQLFQRDREPPTASIAIKVQGSLTNGQIRAIQHLVATAVEGLEPSY 178

Query: 207 VTVLDSTGKLLTANEMERNILGKSLSIVQ---AIQHEIEMNINKALAAFLGVDNFRSAVV 263
           V+++D  G LL +   ++  L    S+ +    ++  +   + + L   +G    R  V 
Sbjct: 179 VSIVDERGTLLASGTGDKEGLAGGSSLDERRLTMESRLRQQVEEILNNVVGTGRARVRVA 238

Query: 264 AELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLP 323
           AE+N + +   + ++DPD +V RS + SK+   S T+  E  V+V   +P+ +D      
Sbjct: 239 AEINYNRKTETQELFDPDGQVLRSSQ-SKEENASSTNG-EDTVSVGNQLPN-ADAAGSSA 295

Query: 324 RSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDS 383
            S ++++  EE  NYEI+  ++   ++   LERLS+AV+V+    T   G    Q +   
Sbjct: 296 GSKDSSNVSEEILNYEISKSTVTEIYEAGGLERLSVAVLVDGTYTTSEDGTQTYQPRSRE 355

Query: 384 YLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN-----SGTVQVSFMDILSRHFAT 438
            L +I  +V  A G +  RGDT+ + +M F+E  L +      G    +  DI+   FA 
Sbjct: 356 ELEQIATLVRTAVGFSKHRGDTVEVVNMRFVEAPLSDFADGEGGLFDFTRADIM--KFAE 413

Query: 439 VINALVFLVGTLLVTFLGLHALRRLHNIDDAKKG--EVGGKSILSPPPISSAVTTGLMPN 496
           +   ++F++  LL+ F     ++R+   DD  +   E GG  +L   P  + VT      
Sbjct: 414 L--GVLFVITVLLLIFAVSPLMKRILAKDDEPEAAIEGGGVQML---PDGTLVTESPAQV 468

Query: 497 DNIA--LDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKW 549
           + I   +++   +I +      +++ + + + S  ++  MIE +      I+R W
Sbjct: 469 EGIVGEMEAVPTEIPTAEWIEDAKMQAALHQSSIKQISEMIEDSPSEAVNIVRGW 523


>gi|83309602|ref|YP_419866.1| flagellar MS-ring protein [Magnetospirillum magneticum AMB-1]
 gi|82944443|dbj|BAE49307.1| Flagellar biosynthesis/type III secretory pathway lipoprotein
           [Magnetospirillum magneticum AMB-1]
          Length = 574

 Score =  191 bits (485), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 139/458 (30%), Positives = 230/458 (50%), Gaps = 40/458 (8%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           D +  F +    LG  R+  +A V +  +  F+     V +P  + LY  L++ D  +I 
Sbjct: 20  DDVNAFLQMLRGLGPMRLAAIAGVGVSILGFFIYLMSRVAAPQMELLYGDLDLGDSKQII 79

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L+   I + +  +G+ + VP       R+ +A Q LP+    +GYELFDK ++ G TS
Sbjct: 80  EKLTADKIPYELRKDGTEVWVPKDRKLDLRVRMAEQALPAGGRMAGYELFDKQDALGSTS 139

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV 184
           F Q IT VRALEGE+++TI+SI  + AARVH+V+P   +F +    P+ASV+I+      
Sbjct: 140 FQQNITMVRALEGELSKTIRSIDRVKAARVHLVLPKREAFSRDTQEPSASVIIKMNGAQR 199

Query: 185 YKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLL-------------TANEMERNILGK 229
               +  AI+HL+AAAVP +    ++++D  G LL             TA EM+     K
Sbjct: 200 LDKGQVSAIQHLIAAAVPKMKPSRISIVDDKGTLLAKGFENSKEYQAQTAEEMKVKTEAK 259

Query: 230 SLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIR 289
              +V+ I+  +E +        LG    R+ V  +++M      E  +DP++KV RS  
Sbjct: 260 ---LVKTIEDLLERS--------LGPGRVRAEVTVDMDMSQATTTEETFDPETKVVRSQV 308

Query: 290 LSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTH 349
              + ++S+ ++P + VTV+QN+P  +       R+    +K +E  NYEI+ K+ +T  
Sbjct: 309 TVNEGEQSQDAEP-TPVTVQQNLPDPNASSSGNIRTSTKINKNQETVNYEISRKTKSTVR 367

Query: 350 DNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSY-------LAEINKIVSAATGINSRR 402
           +  ++ ++S AV+V+      V  +SAD GK  SY       L++I  +V +A G    R
Sbjct: 368 EMGEIRKVSAAVIVDG-----VREQSAD-GKQTSYRERTAEELSQIEALVKSAIGYTKDR 421

Query: 403 GDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVI 440
            D + + SM F + +          F+  + R F   I
Sbjct: 422 DDQVKVASMPFYKGEELLQAEEPGEFIFGMRRDFVEKI 459


>gi|89068713|ref|ZP_01156099.1| putative flagellar M-ring protein [Oceanicola granulosus HTCC2516]
 gi|89045676|gb|EAR51738.1| putative flagellar M-ring protein [Oceanicola granulosus HTCC2516]
          Length = 562

 Score =  189 bits (480), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 130/405 (32%), Positives = 218/405 (53%), Gaps = 9/405 (2%)

Query: 16  SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFR 75
           SLG+ R++ LA+  +      +     V +P Y  LY  L  S   ++   L +A     
Sbjct: 10  SLGQRRLIALAATGIGLTAALLLGVGAVLAPTYAPLYSGLSPSGAAQVVGTLEQAGFRVD 69

Query: 76  ISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRAL 135
           +S +G+ +SVP S + +AR+ LA QGLP      G+ELFD     G+ SFMQ I R+RAL
Sbjct: 70  VSADGTMVSVPDSDLARARMALADQGLPDEGV-PGWELFDNSTGLGMNSFMQRINRLRAL 128

Query: 136 EGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVY--KSAEAIRH 193
           EGE+AR+IQ+I  + +ARVH+V+P+  +F +    P+ASV++RA   S      A AIR+
Sbjct: 129 EGELARSIQTIDAVDSARVHLVLPEREAFSRARPEPSASVIVRASGRSEIGRNQARAIRN 188

Query: 194 LVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFL 253
           LVAAAVP+L    VTVL ++G+ + A++ E        S+  +++  +  +I++ L+A +
Sbjct: 189 LVAAAVPDLAPSRVTVLSASGETILADDGEPGSDVSLQSVRASLEDRMSRSIDQILSARV 248

Query: 254 GVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMP 313
           G  N R  V  +L  + Q I +  YDP+ +V RS   +++    +T   +  V    N+P
Sbjct: 249 GAGNARVQVSVDLTTERQVILQQSYDPNQRVVRSTE-TRNETVEDTQAGQDQVDAAGNLP 307

Query: 314 H-VSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNK--GRLTE 370
             +         +  N    +E  NYEI +       +   +E++S+AV+VN    RL  
Sbjct: 308 EALGGEAEGSTGARSNRTAADEIVNYEIGSTRSEVIREPGDVEKISVAVLVNGIYNRLPN 367

Query: 371 VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLE 415
             G    + +    +  + ++V +A G +++RGDT+++ S+ F++
Sbjct: 368 --GDVEYEERPPEEIERLTRLVESAVGYDAQRGDTVSVESLRFMD 410


>gi|83944186|ref|ZP_00956642.1| flagellar M-ring protein [Sulfitobacter sp. EE-36]
 gi|83845053|gb|EAP82934.1| flagellar M-ring protein [Sulfitobacter sp. EE-36]
          Length = 548

 Score =  189 bits (480), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 134/444 (30%), Positives = 225/444 (50%), Gaps = 11/444 (2%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           ++L    +  ++L +     V  P Y  LY  L ++  N I   L+ A  +  +S++G+S
Sbjct: 1   MMLGGAGIGVVLLMILGIGAVTRPDYAPLYSNLSITSANSIEATLANAGFNAMVSEDGTS 60

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           ISVP     +AR+ LA  G+P    + G+ELFD+ +   + SF+Q+I ++RA+EGE+AR+
Sbjct: 61  ISVPRGDAVRARMVLAETGMPIDG-DPGWELFDESSGLAMNSFLQKINKMRAMEGELARS 119

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVY--KSAEAIRHLVAAAVP 200
           IQ++ GI +ARVH+V+PD   F +    P AS+++R  +      K A A+ +LVA+AV 
Sbjct: 120 IQTLDGISSARVHLVLPDREPFSRDAPAPRASIILRPESGRAVTRKQAVAVSNLVASAVA 179

Query: 201 NLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRS 260
           +LD+  VTVL ++G+ + A   + +  G   S    I+  +   I   L A +G  N R 
Sbjct: 180 DLDISRVTVLSASGETILAEGPDGSSQGGVQSAKAGIEDRLSQEIQNILTARVGAGNARV 239

Query: 261 AVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESA-VTVEQNMPHVSDRK 319
            V  EL    + I E  YDPD +V RS     + Q   T   E+  V VE N+P      
Sbjct: 240 HVNVELTTQREVIVEQTYDPDQQVVRSTETKSEDQ---TGTKEAGNVGVENNIPAALADG 296

Query: 320 VPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQG 379
                S   ++  +E   YEI         +   + R+S+AV+VN   +  V G      
Sbjct: 297 NGAGTSTRRSE-ADEIVQYEIGNTRREIVREAGDVRRMSVAVLVNG--IYNVDGSDVIYA 353

Query: 380 -KIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFAT 438
            +    LA + ++V  A G ++ RGD++++ SM F++  +     +  S  D LS +  +
Sbjct: 354 ERTPEELARLGELVKTAVGFDTTRGDSVSVDSMRFMDYSMDLGDPIDKSIGDELSENVVS 413

Query: 439 VINALVFLVGTLLVTFLGLHALRR 462
           ++  ++ L+   L+   G+  + R
Sbjct: 414 IVRGVLALLVVGLILVFGVRPMLR 437


>gi|46201261|ref|ZP_00055409.2| COG1766: Flagellar biosynthesis/type III secretory pathway
           lipoprotein [Magnetospirillum magnetotacticum MS-1]
          Length = 560

 Score =  188 bits (478), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 133/447 (29%), Positives = 227/447 (50%), Gaps = 18/447 (4%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           D +  F +    LG  R+  +A V +  +  F+     V +P  + LY  L++ D  +I 
Sbjct: 6   DDVNAFLQMLRGLGPMRLAAIAGVGVSILGFFIYLMSRVAAPQMELLYGDLDLGDSKQII 65

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L+   I + +  +G+ + VP       R+ +A Q LP+    +GYELFDK ++ G TS
Sbjct: 66  EKLTADKIPYELRKDGTEVWVPKDRKLDLRVRMAEQALPAGGRMAGYELFDKQDALGSTS 125

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV 184
           F Q IT VRALEGE+++TI+SI  + AARVH+V+P   +F +    P+ASV+I+      
Sbjct: 126 FQQNITMVRALEGELSKTIRSIDKVKAARVHLVLPKREAFSRDTQEPSASVIIKMNGSQR 185

Query: 185 YKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTAN-EMERNILGKSLSIVQA-IQHE 240
               +  AI+HL+AAAVP +    ++++D  G LL    E  +    ++   ++   + +
Sbjct: 186 LDKGQVSAIQHLIAAAVPKMKPSRISIVDDKGTLLAKGFENSKEYQAQTAEDMKVKTEAK 245

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           +   I   L   LG    R+ V  ++++      E  +DP++KV RS     + ++S+ +
Sbjct: 246 LVKTIEDLLERSLGPGRVRAEVTVDMDLSQATTTEETFDPETKVVRSQVTVNEGEQSQDA 305

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           +P + VTV+QN+P  +       R+    +K +E  NYEI+ K+ +T  +  ++ ++S A
Sbjct: 306 EP-TPVTVQQNLPDPNASSGGNIRTSTKINKNQETVNYEISRKTKSTVREMGEIRKVSAA 364

Query: 361 VVVNKGRLTEVLGRSADQGKIDSY-------LAEINKIVSAATGINSRRGDTITITSMDF 413
           V+V+      V  +SAD GK  SY       L++I  +V +A G    R D + + SM F
Sbjct: 365 VIVDG-----VREQSAD-GKQTSYRDRTAEELSQIEALVKSAIGYTKDRDDQVKVASMPF 418

Query: 414 LENQLFNSGTVQVSFMDILSRHFATVI 440
            + +          F+  + R F   I
Sbjct: 419 YKGEELLQAEEPGEFIFGMRRDFVEKI 445


>gi|254294565|ref|YP_003060588.1| flagellar M-ring protein FliF [Hirschia baltica ATCC 49814]
 gi|254043096|gb|ACT59891.1| flagellar M-ring protein FliF [Hirschia baltica ATCC 49814]
          Length = 568

 Score =  188 bits (478), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 163/570 (28%), Positives = 285/570 (50%), Gaps = 41/570 (7%)

Query: 6   QLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDN--LYVKLEVSDVNRI 63
           + +   K  T+ G+ RI+   + ++V  ++     F +     D   LY  L++++   I
Sbjct: 3   ETVSIIKKITNGGQMRII---AALMVVALVGAGLGFIMLRGGADEALLYSGLDLTESAEI 59

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
           S  L +ANI + I  +G+SI V    V  AR+ L+ +GLP+  +  GYE+FDK  + G T
Sbjct: 60  SGRLDQANISYTIRGDGASIFVNRDQVLDARMMLSEEGLPTRGA-MGYEIFDKSEALGTT 118

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI----RA 179
           SF+Q I RVRALEGE+ARTI S+  I  +RVH+V+P+   F +    P+ASV+I    R 
Sbjct: 119 SFVQNINRVRALEGELARTISSLDNIRGSRVHLVLPERRLFERGTQTPSASVVISVAGRG 178

Query: 180 INPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTAN--EMERNILGKSLSIVQ-A 236
           + PS  +   AIR+L+A +VPNL++  +T+LD  G+LL A     E    G S    Q  
Sbjct: 179 MLPSQVR---AIRNLIAGSVPNLEVNRITLLDDKGRLLAAGAENSENGFSGGSADERQTG 235

Query: 237 IQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQR 296
           I+ +I   +   + +  G    R  V A+++ +       ++DP+ +V RS   ++D+ R
Sbjct: 236 IEDQIRNKVLSVVESVTGPGAARVQVAADIDFNRITQSSEIFDPEGRVIRSSTTTEDSSR 295

Query: 297 SETSQPESAVTVEQNMPHVSDRKVPL-PRSLENTDKKEEQSNYEINTKSIATTHDNYKLE 355
             +++P  AVT E N+P  +    P  P S   T+  +E +NYEI+  +     +  ++ 
Sbjct: 296 ESSTEPAGAVTAENNIPAGTAADGPADPTSQAETNHLQETTNYEISKTTKTEITEGGRIR 355

Query: 356 RLSIAVVVNKGRLTEVLGRSADQG------KIDSYLAEINKIVSAATGINSRRGDTITIT 409
           ++S+AV ++  R+       AD+       +    +A I  +V +A G +  RGD + + 
Sbjct: 356 KISVAVALDDVRVP-----GADETEATFAPRTPEEIANIKTLVRSAVGYDEARGDIVEVV 410

Query: 410 SMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFL-VGTLLVTFLGLHALRRLHNIDD 468
           ++ F+  +   +  ++   M  L+++    I+ L  L VG +L+    L  L +      
Sbjct: 411 NVSFMRPESSVNLAIEDPGMLGLTKNDIMRISELAALFVGAVLLIIFVLRPLVKGLMSPS 470

Query: 469 AKKGE---VGGKSILSPPPISSAVTTGLMPNDNIAL----DSSNQDIFSHSR-NLQ-SRI 519
           A+ G+   VG   +   P  S      +  ++N+ L    D  N  I    +  L  +RI
Sbjct: 471 AESGDSFYVGEAKL---PGGSGNAAQKVTLSENLVLPGSGDGGNGQITEDDQFGLDVARI 527

Query: 520 NSYVSKQSDLRLLHMIEINEERFAKILRKW 549
           +  V+  S  ++  ++E + +   +I+R W
Sbjct: 528 SGKVNASSVKKISEVVESHPDESIQIIRAW 557


>gi|188583761|ref|YP_001927206.1| flagellar MS-ring protein [Methylobacterium populi BJ001]
 gi|179347259|gb|ACB82671.1| flagellar M-ring protein FliF [Methylobacterium populi BJ001]
          Length = 538

 Score =  187 bits (475), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 149/542 (27%), Positives = 262/542 (48%), Gaps = 23/542 (4%)

Query: 15  TSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDF 74
           T LG  RI  +A+V L  +  F      V+ P    L+  L + D + +   L    I +
Sbjct: 9   TKLGPARIAAMAAVTLTLVGFFAFVILRVSRPDMGVLFSDLSMQDSSAVIRELDARGIAY 68

Query: 75  RISDN-GSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVR 133
                 G ++  P + + K R+  A +GLP+     GYE+FDK ++F  TSF+Q +  +R
Sbjct: 69  ETKGELGQTVLAPRADLAKLRMDFAGKGLPAQG-GIGYEIFDKGDAFSSTSFVQNVNHLR 127

Query: 134 ALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRH 193
           A+EGE+AR+I++I  + AARVH+V+P+   F +    P+A+++++ +         AIRH
Sbjct: 128 AMEGELARSIRAIGRVQAARVHLVIPERRLFERDREAPSAAIVVKLMGDLDPSQVRAIRH 187

Query: 194 LVAAAVPNLDMGDVTVLDSTGKLLT--ANEMERNILGKSLSIVQAIQHEIEMNINKALAA 251
           L A+AV  L    V+++D  G+LL   A   E    G        I+  +   I + +A 
Sbjct: 188 LAASAVEGLKPERVSIVDERGRLLADGARGAEAEGAGALEERQAGIERRMRAQIEEIVAG 247

Query: 252 FLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQN 311
            +G    R  V AEL+++  + R   +DP+S+V RS +    ++ S T   E  V+V   
Sbjct: 248 IVGQGRARVQVTAELDLNRVESRSESFDPESRVVRSTQTR--SENSLTGGAEGQVSVGNE 305

Query: 312 MPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEV 371
           +P  +  + P P+  +++ K EE +NYEI+  +   T +  +L+RLS+AV+V+       
Sbjct: 306 LPGANQNQPP-PQQKDSSQKNEEVTNYEISRVTKVETLEGGRLKRLSVAVLVDGVYAPGA 364

Query: 372 LGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLEN----QLFNSGTVQVS 427
            G++A Q + D+ +A I  +V  A G +  RGD + + ++ F E     +    G +Q S
Sbjct: 365 DGKAAYQPRSDAEIARIAALVRTAVGYDKARGDQVEVVNLRFAETPAAAEFAEPGLIQ-S 423

Query: 428 FMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISS 487
           F+         ++   V  + TL+V    +  L R     DA    + G ++        
Sbjct: 424 FLSPSKEDVMRLVELAVLSLLTLIVLMAVVRPLLRRVLESDAPVAALAGPALALAGAGGE 483

Query: 488 AVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILR 547
             T        IA+  ++ + F  S    ++IN  +  ++  R++ M+  +     ++LR
Sbjct: 484 GPT-------EIAVRENSTNKFLES----AKINGQIQAETVERVVDMVRASPTETVEVLR 532

Query: 548 KW 549
            W
Sbjct: 533 NW 534


>gi|92116309|ref|YP_576038.1| flagellar MS-ring protein [Nitrobacter hamburgensis X14]
 gi|91799203|gb|ABE61578.1| flagellar M-ring protein FliF [Nitrobacter hamburgensis X14]
          Length = 540

 Score =  187 bits (474), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 155/556 (27%), Positives = 264/556 (47%), Gaps = 37/556 (6%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           LL F K    LG +R++ + +V    I  F      V +P    L+  L V D + I   
Sbjct: 4   LLAFLKG---LGPSRLMAMVAVTTALIGFFAFVIMRVTAPQMTTLFTDLSVEDSSGIIKD 60

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L    I + + ++G+ I VP   V + R+ LA  GLP      GYE+FDK ++ G TSF+
Sbjct: 61  LERQAIPYELRNDGAVIMVPKDKVTRLRMKLAEAGLPKGG-GVGYEIFDKSDALGTTSFV 119

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           Q I R+RALEGE++RTI++I  I  ARVH+V+PD   F +   +P+AS+++R       +
Sbjct: 120 QNINRLRALEGELSRTIKAIDRIQDARVHLVLPDRPLFSREAPQPSASIVLRVRGGLEPQ 179

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL---TANEMERNILGKSLSIVQAIQHEIEM 243
              AIRHLVA+AV  L    V+++D TG+LL   +A + +     +  +   A +  +  
Sbjct: 180 QIRAIRHLVASAVNGLKPQRVSIVDETGQLLADGSATDADGTTGDERRT---AFEKRMRN 236

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            +   +++ +G    R  + A+ + +        +DP+ +V RS +  +++  S T+   
Sbjct: 237 QVEAIVSSVVGSGRARVQLSADFDYNKITQTSDKFDPEGRVLRSSQTREES--SVTADNN 294

Query: 304 SAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVV 363
             VTV   +P       P P + + + K EE +NYEI+  +     +  ++ R+S+AV+V
Sbjct: 295 GQVTVNNELPGNQQSDNPSP-ARDQSKKSEETNNYEISRTTKTEVTEAGRVNRISVAVLV 353

Query: 364 NKGRLTEVLGRSADQGKI------DSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           + G  T+      DQG++         L  I  +V +A G + +RGD + + ++ F E  
Sbjct: 354 D-GTYTK-----NDQGQMVYAERSKEQLDRIATLVRSAIGFDQKRGDQVEVVNLKFAEPP 407

Query: 418 L---FNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHAL-RRLHNIDDAKKGE 473
                      +  M +       VI+  V L+  L+VTF+ +  L RR+   + A  G 
Sbjct: 408 AAVPLAEPAGLLGMMALTKDDVMYVIDLAVMLLLGLVVTFMVIRPLVRRILASEPAPAGA 467

Query: 474 VGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLH 533
              +    P P  +    G    + +   S+   +        +++   V  QS  R+  
Sbjct: 468 APSQ---LPAPADATAQAGATGQNLVPGGSATAQLIDV-----AQVQGQVHAQSVHRVGE 519

Query: 534 MIEINEERFAKILRKW 549
           + E N    A I+R+W
Sbjct: 520 LAERNPAETASIIRQW 535


>gi|163744330|ref|ZP_02151690.1| flagellar M-ring protein FliF [Oceanibulbus indolifex HEL-45]
 gi|161381148|gb|EDQ05557.1| flagellar M-ring protein FliF [Oceanibulbus indolifex HEL-45]
          Length = 567

 Score =  186 bits (471), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 140/467 (29%), Positives = 246/467 (52%), Gaps = 21/467 (4%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVIL-VPIMLFMAARFFVNSPHYDNLYVKLEVSDVNR 62
           ++Q+++  K    LG  R+ +L  + L +   +F+ AR  + +P Y  +Y +L     ++
Sbjct: 1   MNQIVENLKD---LGPKRLALLGGIGLAITAAVFIGARTIL-APTYVPVYSQLSPGTASQ 56

Query: 63  ISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGL 122
           +   L +A +   +S NG +ISV  + + +AR+ LA  GLP      G+E+FD ++  G+
Sbjct: 57  MMQTLEQAGLTVDLSRNGDTISVAENDIARARMALADAGLPGEGV-PGWEIFDNMSGMGM 115

Query: 123 TSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA-IN 181
            SFMQ++ R+RALEGE+AR+IQ+ISGI AARVH+V+P+  +F +  A  + SV++R+  N
Sbjct: 116 NSFMQKVNRLRALEGELARSIQTISGIKAARVHLVLPERAAFSRSRAEASGSVIVRSQAN 175

Query: 182 PSVYKS-AEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQA---- 236
            S+ +S A+AI+ LVA+AV +L+  +VTVL ++G+ + A    ++  G S   +Q     
Sbjct: 176 ASMTRSQAQAIQALVASAVADLEAQNVTVLSASGETILA----KDDGGSSDFSLQGQRSM 231

Query: 237 IQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQR 296
           I+ ++   +   L A +G  N R  V  +L  + +      +DP  +V RSI  ++    
Sbjct: 232 IEEQLAQKVESILNARVGPGNARVRVSVDLTTEREVRVSRTFDPAQQVARSIE-TRVRNS 290

Query: 297 SETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLER 356
           +ET      V V  N+P                 + +E  NYEI +       +   +ER
Sbjct: 291 NETDPATGTVDVANNIPDELRDDAGGGAGQSTRSENDEIINYEIGSVQSEMVREPGDIER 350

Query: 357 LSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFL-- 414
           +S+AV+VN    T   G      + +  +  ++++VS A G +  RGD + + S+ FL  
Sbjct: 351 ISVAVLVNGSYGTLPDGSEGYIERSEEEMQRLSQLVSTAIGFDQNRGDQVQVDSLQFLDF 410

Query: 415 ENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALR 461
           +++  N G   +    +L+ +  T++ +L  L    ++  LG   LR
Sbjct: 411 DSEFSNPGGRGLGA--VLADNAMTILRSLFALALVAIIMLLGARPLR 455


>gi|332296504|ref|YP_004438427.1| flagellar M-ring protein FliF [Thermodesulfobium narugense DSM
           14796]
 gi|332179607|gb|AEE15296.1| flagellar M-ring protein FliF [Thermodesulfobium narugense DSM
           14796]
          Length = 515

 Score =  186 bits (471), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 133/402 (33%), Positives = 211/402 (52%), Gaps = 29/402 (7%)

Query: 21  RILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNG 80
           R L+L+ V LV  +LF+    F+  P    L+  L  SD   I   L E  I + + D+G
Sbjct: 23  RFLLLSGVSLV-FILFVFGSLFLFKPQMAPLFTHLSSSDGAAIVAKLKEQKIPYELKDSG 81

Query: 81  SSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIA 140
           ++I VP   V + R+ LAAQGLP  S   G+E+FDK N F  T F Q +  VRAL+GE+A
Sbjct: 82  TTILVPKDKVYELRLSLAAQGLPEGS-GVGFEIFDKNNLF-TTDFTQRVDYVRALQGELA 139

Query: 141 RTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS---VYKSAEAIRHLVAA 197
           RTI  I+G+  ARVHIV+P  G F       +ASVM+  + P      K  EAI  LV+ 
Sbjct: 140 RTISQINGVEGARVHIVLPKTGVFVSQDIPASASVMLN-LKPGQSISEKETEAIAFLVSR 198

Query: 198 AVPNLDMGDVTVLDSTGKLLTA--NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGV 255
           AV  L   +VT++D+ G+LL+A  N  +  +  +   I +  + E++  I   L   LG 
Sbjct: 199 AVEGLKPENVTIMDTRGELLSADLNFNKSGLSQREFDIKRKYESEVQRKIQTMLDTMLGP 258

Query: 256 DNFRSAVVAELNMDTQQIREIVYDP---DSKVERSIRLSKDAQRSETSQPES-AVTVEQN 311
                 V AELN+ + ++++I Y P    + +  S +++ D  +S+ + P++ + TV Q 
Sbjct: 259 GKSVVRVSAELNLASSEVKKITYSPVVGQNGIVISSKVTTDTSKSQNTTPQTPSATVPQG 318

Query: 312 MPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEV 371
           +P     + P P S  ++ K EE +NY++N +     + +  ++RL+++V+V+    T  
Sbjct: 319 IPSY---QTPAPTSSSSSRKTEEITNYDVNKQEEMIKNPSGDIKRLTVSVIVDGTPQT-- 373

Query: 372 LGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
                        L  +   VS A GI  +RGD++ + +M F
Sbjct: 374 -----------VNLQALTAAVSNAAGILPQRGDSVDVQAMPF 404


>gi|218532348|ref|YP_002423164.1| flagellar MS-ring protein [Methylobacterium chloromethanicum CM4]
 gi|218524651|gb|ACK85236.1| flagellar M-ring protein FliF [Methylobacterium chloromethanicum
           CM4]
          Length = 540

 Score =  185 bits (469), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 126/405 (31%), Positives = 213/405 (52%), Gaps = 7/405 (1%)

Query: 15  TSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDF 74
           T LG  RI  +A+V L  +  F      V+ P    L+  L + D + +   L    I +
Sbjct: 9   TKLGPARIAAMAAVTLTLVGFFAFVILRVSRPDMGVLFSDLSLQDSSSVIRELDARGITY 68

Query: 75  RI-SDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVR 133
               + G ++  P + + K R+  A +GLPS     GYE+FDK ++F  TSF+Q +  +R
Sbjct: 69  ETKGEMGQTVLAPRADLAKLRMDFAGKGLPSQG-GIGYEIFDKGDAFSSTSFVQNVNHLR 127

Query: 134 ALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRH 193
           A+EGE+AR+I++I  + AARVH+V+P+   F +    P+A+++++ +         AIRH
Sbjct: 128 AMEGELARSIRAIGRVQAARVHLVIPERRLFERDREAPSAAIVVKLMGDLDASQVRAIRH 187

Query: 194 LVAAAVPNLDMGDVTVLDSTGKLLT--ANEMERNILGKSLSIVQAIQHEIEMNINKALAA 251
           L A+AV  L    V+++D  G+LL   A   E +  G        I+  +   I + +A 
Sbjct: 188 LAASAVEGLKPERVSIVDERGRLLADGARGAEADGAGALEERQAGIERRMRSQIEEIVAG 247

Query: 252 FLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQN 311
            +G    R  V AEL+++  + R   +DP+S+V RS +    ++ S T   E  VTV   
Sbjct: 248 IVGQGRARVQVTAELDLNRVESRSESFDPESRVVRSTQTR--SENSLTGGAEGQVTVGNE 305

Query: 312 MPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEV 371
           +P  +++  P P+  +++ K EE +NYEI+  +   T +  +L+RLS+AV+V+       
Sbjct: 306 LPG-ANQNQPAPQQKDSSQKNEETTNYEISRVTKVETLEGGRLKRLSVAVLVDGVYAPGA 364

Query: 372 LGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLEN 416
            G+ A Q + D+ +A I  +V  A G +  RGD + + ++ F E 
Sbjct: 365 DGKPAYQPRSDAEIARITALVRTAVGYDKVRGDQVEVVNLRFAET 409


>gi|240140910|ref|YP_002965390.1| flagellar biosynthesis; basal-body MS(membrane and
           supramembrane)-ring and collar protein [Methylobacterium
           extorquens AM1]
 gi|240010887|gb|ACS42113.1| flagellar biosynthesis; basal-body MS(membrane and
           supramembrane)-ring and collar protein [Methylobacterium
           extorquens AM1]
          Length = 540

 Score =  184 bits (468), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 126/405 (31%), Positives = 213/405 (52%), Gaps = 7/405 (1%)

Query: 15  TSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDF 74
           T LG  RI  +A+V L  +  F      V+ P    L+  L + D + +   L    I +
Sbjct: 9   TKLGPARIAAMAAVTLTLVGFFAFVILRVSRPDMGVLFSDLSLQDSSSVIRELDARGITY 68

Query: 75  RI-SDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVR 133
               + G ++  P + + K R+  A +GLPS     GYE+FDK ++F  TSF+Q +  +R
Sbjct: 69  ETKGEMGQTVLAPRADLAKLRMDFAGKGLPSQG-GIGYEIFDKGDAFSSTSFVQNVNHLR 127

Query: 134 ALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRH 193
           A+EGE+AR+I++I  + AARVH+V+P+   F +    P+A+++++ +         AIRH
Sbjct: 128 AMEGELARSIRAIGRVQAARVHLVIPERRLFERDREAPSAAIVVKLMGDLDASQVRAIRH 187

Query: 194 LVAAAVPNLDMGDVTVLDSTGKLLT--ANEMERNILGKSLSIVQAIQHEIEMNINKALAA 251
           L A+AV  L    V+++D  G+LL   A   E +  G        I+  +   I + +A 
Sbjct: 188 LAASAVEGLKPERVSIVDERGRLLADGARGAEADGAGALEERQAGIERRMRSQIEEIVAG 247

Query: 252 FLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQN 311
            +G    R  V AEL+++  + R   +DP+S+V RS +    ++ S T   E  VTV   
Sbjct: 248 IVGQGRARVQVTAELDLNRVESRSESFDPESRVVRSTQTR--SENSLTGGAEGQVTVGNE 305

Query: 312 MPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEV 371
           +P  +++  P P+  +++ K EE +NYEI+  +   T +  +L+RLS+AV+V+       
Sbjct: 306 LPG-ANQNQPAPQQKDSSQKNEETTNYEISRVTKVETLEGGRLKRLSVAVLVDGVYAPGA 364

Query: 372 LGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLEN 416
            G+ A Q + D+ +A I  +V  A G +  RGD + + ++ F E 
Sbjct: 365 NGKPAYQPRSDAEIARITALVRTAVGYDKVRGDQVEVVNLRFAET 409


>gi|254563420|ref|YP_003070515.1| basal-body MS biosynthesis protein [Methylobacterium extorquens
           DM4]
 gi|254270698|emb|CAX26702.1| flagellar biosynthesis; basal-body MS(membrane and
           supramembrane)-ring and collar protein [Methylobacterium
           extorquens DM4]
          Length = 540

 Score =  184 bits (468), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 126/405 (31%), Positives = 213/405 (52%), Gaps = 7/405 (1%)

Query: 15  TSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDF 74
           T LG  RI  +A+V L  +  F      V+ P    L+  L + D + +   L    I +
Sbjct: 9   TKLGPARIAAMAAVTLTLVGFFAFVILRVSRPDMGVLFSDLSLQDSSSVIRELDARGITY 68

Query: 75  RI-SDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVR 133
               + G ++  P + + K R+  A +GLPS     GYE+FDK ++F  TSF+Q +  +R
Sbjct: 69  ETKGEMGQTVLAPRADLAKLRMDFAGKGLPSQG-GIGYEIFDKGDAFSSTSFVQNVNHLR 127

Query: 134 ALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRH 193
           A+EGE+AR+I++I  + AARVH+V+P+   F +    P+A+++++ +         AIRH
Sbjct: 128 AMEGELARSIRAIGRVQAARVHLVIPERRLFERDREAPSAAIVVKLMGDLDASQVRAIRH 187

Query: 194 LVAAAVPNLDMGDVTVLDSTGKLLT--ANEMERNILGKSLSIVQAIQHEIEMNINKALAA 251
           L A+AV  L    V+++D  G+LL   A   E +  G        I+  +   I + +A 
Sbjct: 188 LAASAVEGLKPERVSIVDERGRLLADGARGAEADGAGALEERQAGIERRMRSQIEEIVAG 247

Query: 252 FLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQN 311
            +G    R  V AEL+++  + R   +DP+S+V RS +    ++ S T   E  VTV   
Sbjct: 248 IVGQGRARVQVTAELDLNRVESRSESFDPESRVVRSTQTR--SENSLTGGAEGQVTVGNE 305

Query: 312 MPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEV 371
           +P  +++  P P+  +++ K EE +NYEI+  +   T +  +L+RLS+AV+V+       
Sbjct: 306 LPG-ANQNQPAPQQKDSSQKNEETTNYEISRVTKVETLEGGRLKRLSVAVLVDGVYAPGA 364

Query: 372 LGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLEN 416
            G+ A Q + D+ +A I  +V  A G +  RGD + + ++ F E 
Sbjct: 365 DGKPAYQPRSDAEIARITALVRTAVGYDKVRGDQVEVVNLRFAET 409


>gi|170696757|ref|ZP_02887869.1| flagellar M-ring protein FliF [Burkholderia graminis C4D1M]
 gi|170138336|gb|EDT06552.1| flagellar M-ring protein FliF [Burkholderia graminis C4D1M]
          Length = 600

 Score =  184 bits (467), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 129/409 (31%), Positives = 207/409 (50%), Gaps = 27/409 (6%)

Query: 23  LILASVILVPIM--LFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNG 80
           LI A  +LV I+  LF+ +R    +P Y  LY  L   D   I  AL +ANI ++ S+ G
Sbjct: 67  LIFAVALLVAIVAGLFLWSR----APDYKVLYSNLSDRDGGAIITALQQANIPYKFSEAG 122

Query: 81  SSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIA 140
            +I VPS  V + R+ LA+QGLP S S  G+EL D    FG++ F ++I   RALEGE+ 
Sbjct: 123 GAILVPSEQVHEMRLRLASQGLPKSGS-VGFELMDN-QKFGISQFAEQINYQRALEGELE 180

Query: 141 RTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAA 198
           RTI+S+S + +ARVH+ +P    F +    P+ASV++           +  AI H+V++A
Sbjct: 181 RTIESVSSVKSARVHLAIPKPSVFVRDKEAPSASVLVNLYPGRALDEGQVLAITHMVSSA 240

Query: 199 VPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNF 258
           VP + +  VT+LD  G LLT   +   +    L   Q I+   +  I+  LA   G  N 
Sbjct: 241 VPEMPVKGVTILDQDGNLLTQPSVGGGLDASQLKYRQQIERSTQQRIDAILAPLFGSGNA 300

Query: 259 RSAVVAELNMDTQQIREIVYDPDSKVER-SIRLSKDAQRSETS-------------QPES 304
            S V A+++    +     Y P+   ++ +IR  + +  +E S             QP  
Sbjct: 301 HSQVSADIDFSRSEQTSENYGPNGNPQQAAIRSQQSSTATEMSQGGASGVPGALSNQPPQ 360

Query: 305 AVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVN 364
             +   N P  +   V    +   +D+K+  +NYE++            ++RLS+AVVVN
Sbjct: 361 PASAPINAPAGASGGV---TTTPVSDRKDMTTNYELDKTVRHLEQPMGGIKRLSVAVVVN 417

Query: 365 KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
             R+ +  G +  Q      LA++N++V  A G +++RGD++ + +  F
Sbjct: 418 YLRVVDAKGHATMQPVTADKLAQVNQLVKDAMGFDAQRGDSVNVVNSPF 466


>gi|163853490|ref|YP_001641533.1| flagellar MS-ring protein [Methylobacterium extorquens PA1]
 gi|163665095|gb|ABY32462.1| flagellar M-ring protein FliF [Methylobacterium extorquens PA1]
          Length = 540

 Score =  184 bits (467), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 126/405 (31%), Positives = 213/405 (52%), Gaps = 7/405 (1%)

Query: 15  TSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDF 74
           T LG  RI  +A+V L  +  F      V+ P    L+  L + D + +   L    I +
Sbjct: 9   TKLGPARIAAMAAVTLTLVGFFAFVILRVSRPDMGVLFSDLSLQDSSSVIRELDARGITY 68

Query: 75  RI-SDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVR 133
               + G ++  P + + K R+  A +GLPS     GYE+FDK ++F  TSF+Q +  +R
Sbjct: 69  ETKGEMGQTVLAPRADLAKLRMDFAGKGLPSQG-GIGYEIFDKGDAFSSTSFVQNVNHLR 127

Query: 134 ALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRH 193
           A+EGE+AR+I++I  + AARVH+V+P+   F +    P+A+++++ +         AIRH
Sbjct: 128 AMEGELARSIRAIGRVQAARVHLVIPERRLFERDREAPSAAIVVKLMGDLDASQVRAIRH 187

Query: 194 LVAAAVPNLDMGDVTVLDSTGKLLT--ANEMERNILGKSLSIVQAIQHEIEMNINKALAA 251
           L A+AV  L    V+++D  G+LL   A   E +  G        I+  +   I + +A 
Sbjct: 188 LAASAVEGLKPERVSIVDERGRLLADGARGAEADGAGALEERQAGIERRMRSQIEEIVAG 247

Query: 252 FLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQN 311
            +G    R  V AEL+++  + R   +DP+S+V RS +    ++ S T   E  VTV   
Sbjct: 248 IVGQGRARVQVTAELDLNRVESRSESFDPESRVVRSTQTR--SENSLTGGAEGQVTVGNE 305

Query: 312 MPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEV 371
           +P  +++  P P+  +++ K EE +NYEI+  +   T +  +L+RLS+AV+V+       
Sbjct: 306 LPG-ANQNQPAPQQKDSSQKNEETTNYEISRVTKVETLEGGRLKRLSVAVLVDGVYAPGA 364

Query: 372 LGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLEN 416
            G+ A Q + D+ +A I  +V  A G +  RGD + + ++ F E 
Sbjct: 365 DGKPAYQPRSDAEIARIAALVRTAVGYDKVRGDQVEVVNLRFAET 409


>gi|307731342|ref|YP_003908566.1| flagellar M-ring protein FliF [Burkholderia sp. CCGE1003]
 gi|307585877|gb|ADN59275.1| flagellar M-ring protein FliF [Burkholderia sp. CCGE1003]
          Length = 600

 Score =  184 bits (466), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 136/446 (30%), Positives = 218/446 (48%), Gaps = 29/446 (6%)

Query: 35  LFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKAR 94
           LF+ +R    +P Y  LY  L   D   I  AL +ANI ++ SD G +I VP+  V + R
Sbjct: 81  LFLWSR----APDYKVLYSNLSDRDGGAIITALQQANIPYKFSDAGGAILVPAEQVHEMR 136

Query: 95  IHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARV 154
           + LA+ GLP S S  G+EL D    FG++ F ++I   RALEGE+ RTIQSIS + +ARV
Sbjct: 137 LRLASLGLPKSGS-VGFELMDN-QKFGISQFAEQINYQRALEGELERTIQSISSVKSARV 194

Query: 155 HIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDS 212
           H+ +P    F +    P+ASV++           +  AI H+V++AVP + +  VT+LD 
Sbjct: 195 HLAIPKPSVFVRDKEAPSASVLVNLYPGRALDEGQVLAITHMVSSAVPEMPVKGVTILDQ 254

Query: 213 TGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQ 272
            G LLT   +   +    L   Q I+   +  I+  LA   G  N  S V A+++    +
Sbjct: 255 DGNLLTQPSVGGGLDASQLKYRQQIERNTQQRIDAILAPLFGAGNAHSQVSADIDFSRSE 314

Query: 273 IREIVYDPDSKVER-SIRLSKDAQRSETS-------------QPESAVTVEQNMPHVSDR 318
                Y P+   ++ +IR  + +  +E S             QP    +   N P+ +  
Sbjct: 315 QTSEAYGPNGNPQQAAIRSQQSSTATEMSQGGASGVPGALSNQPPQPASAPINAPNGASS 374

Query: 319 KVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQ 378
            V    +   +D+K+  +NYE++            ++RLS+AVVVN  R+ +  GR+  Q
Sbjct: 375 SV---TTTPVSDRKDMTTNYELDKTVRHLEQPMGGIKRLSVAVVVNYLRVVDGKGRATMQ 431

Query: 379 GKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILS--RHF 436
                 LA++N++V  A G +++RGD++ + +  F      N+        D+L+  +  
Sbjct: 432 PVSADKLAQVNQLVKDAMGFDAQRGDSVNVVNSPFTAELDPNADLPWWRTPDMLALYKQI 491

Query: 437 ATVINALVFLVGTLLVTFLGLHALRR 462
           AT +   +  V   L   +   ALRR
Sbjct: 492 ATYLG--IGAVALFLYFVMVKPALRR 515


>gi|118593642|ref|ZP_01551018.1| flagellar M-ring protein [Stappia aggregata IAM 12614]
 gi|118433753|gb|EAV40414.1| flagellar M-ring protein [Stappia aggregata IAM 12614]
          Length = 537

 Score =  183 bits (465), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 160/557 (28%), Positives = 273/557 (49%), Gaps = 37/557 (6%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           ++ L++F K+   LG  RI  + +V  + + +F    F V +P    LY +L + D   I
Sbjct: 1   MNGLVEFIKT---LGAARIAAMGAVAAILVGVFAFIIFRVTAPQMTTLYNELTLEDSAAI 57

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
              L    + F I+  G+SI VP+  V + R+ LAA+GLP+  S  GYE+FD+ ++ G T
Sbjct: 58  VSQLESQGVQFEIARQGASILVPNEQVARLRMQLAAEGLPTGGS-IGYEIFDRSDTLGAT 116

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR---AI 180
           SF+Q I  +RA+EGE++RTI S+  I AARVH+V+P+   F+K    P+AS+++    A+
Sbjct: 117 SFVQNINHLRAMEGELSRTIGSLDRIRAARVHLVIPERQLFQKDRRPPSASIVLNVRGAL 176

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA--NEMERNILGKSLSI-VQAI 237
            P   +   A++HLVA AV  L+   V+++D +G+LL +     E  +L  SL      +
Sbjct: 177 GPGEIR---AVQHLVATAVDGLEPDRVSIVDESGRLLASGVGNDEDGLLTNSLQERTVEV 233

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRS 297
           +  +   I + L + +G    R  V AE++ +        +DPD +V RS + SK+   S
Sbjct: 234 EGRLRNQIEEILNSVVGPGRARVRVNAEVDYNRLTETTETFDPDGQVVRSTQ-SKEEASS 292

Query: 298 ETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
             S+    VTV   +P+    +    R  + +   EE  NYEI+  +     +  K++RL
Sbjct: 293 AVSR-NGQVTVANQLPNADAGQGGAER--DTSSVTEEIVNYEISHSTRTEVVEAGKIKRL 349

Query: 358 SIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFL--- 414
           S+AV+V+     +  G S    +    L  I  +V +A G +S RGD + + ++ F    
Sbjct: 350 SVAVLVDGTYQPDGNGGSTYTPRSQETLDRIAVLVRSAVGFDSERGDVVEVVNLQFALPP 409

Query: 415 ENQLFNSGTVQVSFM--DILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKG 472
           ++ L         F   DI+   FA +   ++FL+  +L+ F+    LRR+   ++ +  
Sbjct: 410 QDDLLAESDSLFDFTRNDII--RFAEL--GVLFLIAVMLLLFVVRPLLRRIVTPEEKQPQ 465

Query: 473 EVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLL 532
           E      L   P  + V    +P +    D    +    ++   +   S ++K  D    
Sbjct: 466 E------LMIGPDGTLVIETEVPQEEAVEDEFVIEWLEQAKQEGAMQASSIAKVGD---- 515

Query: 533 HMIEINEERFAKILRKW 549
            MI+ +      I+R W
Sbjct: 516 -MIKDHPTEAVTIVRGW 531


>gi|91785611|ref|YP_560817.1| flagellar MS-ring protein [Burkholderia xenovorans LB400]
 gi|91689565|gb|ABE32765.1| Flagellar FliF M-ring protein [Burkholderia xenovorans LB400]
          Length = 600

 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 136/446 (30%), Positives = 215/446 (48%), Gaps = 30/446 (6%)

Query: 35  LFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKAR 94
           LF+ +R    +P Y  LY  L   D   I  AL  ANI ++ SD G +I VP+  V + R
Sbjct: 80  LFLWSR----APDYKVLYSNLSDRDGGAIITALQAANIPYKFSDAGGAILVPAEQVHEMR 135

Query: 95  IHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARV 154
           + LA+QGLP S S  G+EL D    FG++ F ++I   RALEGE+ RT++SIS + +ARV
Sbjct: 136 LRLASQGLPKSGS-VGFELMDN-QKFGISQFAEQINYQRALEGELERTVESISSVKSARV 193

Query: 155 HIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDS 212
           H+ +P    F +    P+ASV++           +  AI H+V++AVP++ +  VT+LD 
Sbjct: 194 HLAIPKPSVFVRDKEAPSASVLVNLYPGRALDEGQVLAITHMVSSAVPDMPVKGVTILDQ 253

Query: 213 TGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQ 272
            G LLT       +    L   Q I+   +  I+  LA   G  N  S V A+++    +
Sbjct: 254 DGNLLTQPSTGSGLDASQLKYRQQIERSTQQRIDAILAPLFGSGNAHSQVSADIDFSRSE 313

Query: 273 IREIVYDPDSKVER-SIRLSKDAQRSETS-------------QPESAVTVEQNMPHVSDR 318
                Y P+   ++ +IR  + +  +E S             QP    +   N P  +  
Sbjct: 314 QTSENYGPNGNPQQAAIRSQQSSSATEMSQGGASGVPGALSNQPPQPASAPINAPTGASG 373

Query: 319 KVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQ 378
               P S    D+K+  +NYE++            ++RLS+AVVVN  R+ +  G +  Q
Sbjct: 374 VTTTPVS----DRKDSTTNYELDKTVRHLERPMGGIKRLSVAVVVNYLRVVDAKGHATMQ 429

Query: 379 GKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDI--LSRHF 436
                 LA++N++V  A G ++ RGD++ + +  F  +   N+        D+  L+R  
Sbjct: 430 PVTADKLAQVNQLVKDAMGFDAARGDSVNVVNSPFTTDLDPNADLPWWRTPDMIALARQV 489

Query: 437 ATVINALVFLVGTLLVTFLGLHALRR 462
           AT +   +  V   L   +   ALRR
Sbjct: 490 ATYLG--IGAVALFLYFVMVKPALRR 513


>gi|323527692|ref|YP_004229845.1| flagellar M-ring protein FliF [Burkholderia sp. CCGE1001]
 gi|323384694|gb|ADX56785.1| flagellar M-ring protein FliF [Burkholderia sp. CCGE1001]
          Length = 600

 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 135/446 (30%), Positives = 216/446 (48%), Gaps = 29/446 (6%)

Query: 35  LFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKAR 94
           LF+ +R    +P Y  LY  L   D   I  AL +ANI ++ SD G +I VP+  V + R
Sbjct: 81  LFLWSR----APDYKVLYSNLSDRDGGAIITALQQANIPYKFSDAGGAILVPAEQVHEMR 136

Query: 95  IHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARV 154
           + LA+QGLP S S  G+EL D    FG++ F ++I   RALEGE+ RTI+SIS + +ARV
Sbjct: 137 LRLASQGLPKSGS-VGFELMDN-QKFGISQFAEQINYQRALEGELERTIESISSVKSARV 194

Query: 155 HIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDS 212
           H+ +P    F +    P+ASV++           +  AI H+V++AVP + +  VT+LD 
Sbjct: 195 HLAIPKPSVFVRDKEAPSASVLVNLFPGRALDEGQVLAITHMVSSAVPEMPVKGVTILDQ 254

Query: 213 TGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQ 272
            G LLT       +    L   Q I+   +  I+  LA   G  N  S V A+++    +
Sbjct: 255 DGNLLTQPSTGGGLDASQLKYRQQIERNTQQRIDAILAPLFGAGNAHSQVSADIDFSRSE 314

Query: 273 IREIVYDPDSKVER-SIRLSKDAQRSETS-------------QPESAVTVEQNMPHVSDR 318
                Y P+   ++ +IR  + +  +E S             QP    +   N P+ +  
Sbjct: 315 QTSENYGPNGNPQQAAIRSQQSSTATEMSQGGASGVPGALSNQPPQPASAPINAPNGASS 374

Query: 319 KVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQ 378
            V    +   +D+K+  +NYE++            + RLS+AVVVN  R+ +  G +  Q
Sbjct: 375 SV---TTTPVSDRKDMTTNYELDKTVRHLEQPMGGIRRLSVAVVVNYLRVVDGKGHATMQ 431

Query: 379 GKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILS--RHF 436
                 LA++N++V  A G +++RGD++ + +  F      N+        D+L+  +  
Sbjct: 432 PVSADKLAQVNQLVKDAMGFDAQRGDSVNVVNSPFTAELDPNADLPWWRTPDMLALYKQI 491

Query: 437 ATVINALVFLVGTLLVTFLGLHALRR 462
           AT +   +  V   L   +   ALRR
Sbjct: 492 ATYLG--IGAVALFLYFVMVKPALRR 515


>gi|163781742|ref|ZP_02176742.1| Flagellar M-ring protein [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882962|gb|EDP76466.1| Flagellar M-ring protein [Hydrogenivirga sp. 128-5-R1-1]
          Length = 502

 Score =  181 bits (459), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 136/398 (34%), Positives = 205/398 (51%), Gaps = 32/398 (8%)

Query: 26  ASVILVPIMLF---MAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           A V+ +P ++F   +    +   P Y  LY  L   D+N +   L +  + +++  +G +
Sbjct: 24  ALVVGLPAVIFSLLVTVLIYSLQPDYAVLYSNLSPEDMNAVLTELDKEGVKYKVGRDGRT 83

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP + V   R+ LAA+G+P+     GYELFDK ++ GL+ F Q +   RA+EGE+ RT
Sbjct: 84  ILVPENKVRDVRLKLAAKGIPNKGV-IGYELFDK-STIGLSEFQQRVNFKRAIEGELVRT 141

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE---AIRHLVAAAV 199
           I     I  ARVHI +P+   F +    P+ASV IR + P    + E   AIR+LVAA++
Sbjct: 142 ILRFKNIEDARVHIALPEKSIFLRDEKEPSASVFIR-LRPGAEITEEQVKAIRNLVAASI 200

Query: 200 PNLDMGDVTVLDSTGKLLTAN--EMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDN 257
            NL   +V V+D  G+ LTAN  E +  I  K L I +  + EIE  +  AL   LG  N
Sbjct: 201 ENLKPENVVVIDDKGRNLTANLDEGKEEISNKQLKIRREFEREIERKVQTALEEALGYGN 260

Query: 258 FRSAVVAELNMDTQQIREIVYDPD--SKVERSIRLSKDAQRSETSQPESAVTVEQNMPHV 315
            +  V  EL+    Q RE  YDPD  + V    R  K         P +A  +      V
Sbjct: 261 VKVRVSVELDFTKVQRREETYDPDMTAVVSEQKRKEKTTGAPVGGVPGAAANIPPGTGAV 320

Query: 316 SDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRS 375
             +   L      T+KKE  +NYE++ K + +  +  K++RLS+ V++NK  L +V   S
Sbjct: 321 QGQGGTL------TEKKETITNYEVSKKEVISVDNTLKIKRLSVGVIINK-ELKDVNEES 373

Query: 376 ADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
                       I KIVSAA G++ +RGDT+++ ++ F
Sbjct: 374 ------------IKKIVSAAVGLDPKRGDTLSVVAVPF 399


>gi|75674797|ref|YP_317218.1| flagellar MS-ring protein [Nitrobacter winogradskyi Nb-255]
 gi|74419667|gb|ABA03866.1| flagellar FliF M-ring protein [Nitrobacter winogradskyi Nb-255]
          Length = 541

 Score =  181 bits (459), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 161/558 (28%), Positives = 269/558 (48%), Gaps = 40/558 (7%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           LL F K    LG +R++ + +V  V I  F      V +P    L+  L V D + I   
Sbjct: 4   LLAFLKG---LGASRLMAMVAVTAVLIGFFAFVIMRVTTPQMTTLFTDLSVEDSSGIIKD 60

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L    I F + ++G+ I VP   V + R+ LA  GLP      GYE+FDK ++ G TSF+
Sbjct: 61  LERQAIPFELRNDGAVIMVPKDKVTRLRMKLAEAGLPKGG-GVGYEIFDKSDALGTTSFV 119

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           Q I R+RALEGE+ARTI++I  +  ARVH+V+P+   F +   +P+AS+++R       +
Sbjct: 120 QNINRLRALEGELARTIRAIDRVQDARVHLVLPERPLFTREAPQPSASIVLRVRGGLEPQ 179

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL---TANEMERNILGKSLSIVQAIQHEIEM 243
              AIRHLVA+AV  L    V+++D TG+LL   +A + +  + G       A +  +  
Sbjct: 180 QIRAIRHLVASAVNGLKPQRVSIVDETGQLLADGSATDAD-GVSGDERRA--AFEKRMRS 236

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIV--YDPDSKVERSIRLSKDAQRSETSQ 301
            +   +++ +G  N R+ V    + D  +I +    +DP+ +V RS +  +++  S T+ 
Sbjct: 237 QVEAIVSSVVG--NGRARVQLSADFDYNKITQTSDKFDPEGRVLRSSQTREES--SLTAD 292

Query: 302 PESAVTVEQNMP--HVSDRKVPLPRSLENTDKK-EEQSNYEINTKSIATTHDNYKLERLS 358
               VTV   +P    SD     P +  +  KK EE +NYEI+  +     +  ++ R+S
Sbjct: 293 NNGQVTVNNELPGNQPSDN----PNTARDQSKKSEETNNYEISRTTKTEVTEAGRVNRIS 348

Query: 359 IAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQL 418
           +AV+V+        G+   + +    L  I  +V +A G + +RGD + + ++ F E  +
Sbjct: 349 VAVLVDGAYARNDKGQMVYEERSQEQLDRIATLVRSAIGFDQKRGDQVEVVNLKFAEPPV 408

Query: 419 ---FNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHAL-RRLHNIDDAKKGEV 474
                  T  +  M +       V    V  +  L+VTF+ +  L +R+   + A     
Sbjct: 409 VVPLAEPTGWLGMMTLTKDDVMYVFELGVMALLGLVVTFMVIRPLVQRILAAEPATPSAQ 468

Query: 475 GGKSILSPPPISSAVT-TG--LMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRL 531
              ++  P   S+  T TG  L+P  N    ++ Q I        +++   V  QS  R+
Sbjct: 469 PAAALPVPADASAQPTETGQNLIPGSN----ATAQLIDV------AQVQGQVHAQSVHRV 518

Query: 532 LHMIEINEERFAKILRKW 549
             + E N    A I+R+W
Sbjct: 519 GELAERNPAETASIIRQW 536


>gi|187925740|ref|YP_001897382.1| flagellar MS-ring protein [Burkholderia phytofirmans PsJN]
 gi|187716934|gb|ACD18158.1| flagellar M-ring protein FliF [Burkholderia phytofirmans PsJN]
          Length = 603

 Score =  180 bits (456), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 125/395 (31%), Positives = 196/395 (49%), Gaps = 26/395 (6%)

Query: 35  LFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKAR 94
           LF+ +R    +P Y  LY  L   D   I  AL  ANI ++ SD G +I VP+  V + R
Sbjct: 81  LFLWSR----APDYKVLYSNLSDRDGGAIITALQAANIPYKFSDAGGAILVPAEQVHEMR 136

Query: 95  IHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARV 154
           + LA+QGLP S S  G+EL D    FG++ F ++I   RALEGE+ RTI+SIS + +ARV
Sbjct: 137 LRLASQGLPKSGS-VGFELMDN-QKFGISQFAEQINYQRALEGELERTIESISSVKSARV 194

Query: 155 HIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDS 212
           H+ +P    F +    P+ASV++           +  AI H+V++AVP++ +  VT+LD 
Sbjct: 195 HLAIPKPSVFVRDKEAPSASVLVNLYPGRALDEGQVLAITHMVSSAVPDMPVKGVTILDQ 254

Query: 213 TGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQ 272
            G LLT       +    L   Q I+   +  I+  LA   G  N  S V A+++    +
Sbjct: 255 DGNLLTQLSTGSGLDASQLKYRQQIERSTQQRIDAILAPLFGSGNAHSQVSADIDFSHSE 314

Query: 273 IREIVYDPDSKVER-SIRLSKDAQRSETS-------------QPESAVTVEQNMPHVSDR 318
                Y P+   ++ +IR  + +  +E S             QP    +   N P+ +  
Sbjct: 315 QTSENYGPNGNPQQAAIRSQQSSSATEMSQGAASGVPGALSNQPPQPASAPINAPNGASG 374

Query: 319 KVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQ 378
               P S    D+K+  +NYE++            ++RLS+AVVVN  R+ +  G +  Q
Sbjct: 375 VTTTPVS----DRKDSTTNYELDKTVRHLERPMGGIKRLSVAVVVNYLRVVDAKGHATMQ 430

Query: 379 GKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
                 LA++N++V  A G +  RGD++ + +  F
Sbjct: 431 PVTADKLAQVNQLVKDAMGFDQARGDSVNVVNSPF 465


>gi|292492381|ref|YP_003527820.1| flagellar M-ring protein FliF [Nitrosococcus halophilus Nc4]
 gi|291580976|gb|ADE15433.1| flagellar M-ring protein FliF [Nitrosococcus halophilus Nc4]
          Length = 566

 Score =  179 bits (455), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 144/548 (26%), Positives = 258/548 (47%), Gaps = 58/548 (10%)

Query: 28  VILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPS 87
           +I V + L +    +  SP+Y  LY  +   +   I  AL +ANID+++ +   ++ VP+
Sbjct: 46  MIAVSVALGVGIFLWSQSPNYQILYGAVSGKEKGEIVEALQKANIDYQLDEATGALMVPA 105

Query: 88  SMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSIS 147
           S V + R+ LA +GLP S+  +G+EL ++   FG++ F+++    R LEGE+ARTI +++
Sbjct: 106 SQVHEVRLQLAMEGLPRSA-GTGFELLEQNPGFGVSEFLEKARYQRVLEGELARTISTLN 164

Query: 148 GIVAARVHIVMPDMGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNL 202
            + +ARVH+ +P    F +    P+ASV++     R + P       AI HLVA+++P L
Sbjct: 165 NVKSARVHLALPKRSVFIRDRKVPSASVVLDLYPGRMLAPG---QVAAITHLVASSIPEL 221

Query: 203 DMGDVTVLDSTGKLLTANEMERNI--LGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRS 260
           +   VTV++  G LLT  E  + +          + I+ E    I + LA  +G D  R+
Sbjct: 222 ESAGVTVVNQEGDLLTQPERSQTLEMTASQFEYTRRIEEEYGHRIQRILAPLVGADKVRA 281

Query: 261 AVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKV 320
            VVAE++    +  +  Y+P+ +  RS + +++ +R     P        N P     + 
Sbjct: 282 QVVAEVDFTVTEQTQERYEPEKRALRSEQTAEE-ERIGGRLPGGIPGALSNQP---PDEA 337

Query: 321 PLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLE--------------RLSIAVVVNKG 366
            +P +L   ++ E Q +   +++S+  T  NY+L+              RLS+AV+V++ 
Sbjct: 338 QVPETLNGANEGESQPSEPPSSRSLRATR-NYELDRTISHIRLAPGDIRRLSVAVLVDEK 396

Query: 367 RLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTV-- 424
            +T+  G  +   +    L  I  +V  A G N  RGDTI + +  F+ N+         
Sbjct: 397 LVTDAEGNVSTSPRSPQELEHITGLVKEAVGFNPDRGDTINVINAPFVPNEELEPLPEPP 456

Query: 425 --QVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSP 482
             Q  +  +  +    ++  L  L+G L  TF      RRL  +               P
Sbjct: 457 FWQQEWFWVAVKQGGGILAVLFLLLGVLRPTF------RRLTTV---------------P 495

Query: 483 PPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDL-RLLHMIEINEER 541
            P++          D   L      + S++  LQ  ++   S +++L R+  M   + ER
Sbjct: 496 EPVTVPSLPKGSDEDKEGLKEDRLTLSSNAPTLQ--LSGPDSLEANLERVRKMAADDSER 553

Query: 542 FAKILRKW 549
            A++++ W
Sbjct: 554 VAQVVKNW 561


>gi|296157432|ref|ZP_06840267.1| flagellar M-ring protein FliF [Burkholderia sp. Ch1-1]
 gi|295892204|gb|EFG71987.1| flagellar M-ring protein FliF [Burkholderia sp. Ch1-1]
          Length = 600

 Score =  179 bits (453), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 139/480 (28%), Positives = 224/480 (46%), Gaps = 43/480 (8%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  L   D   I  AL  ANI ++ SD G +I VP+  V + R+ LA+Q
Sbjct: 82  LWSRAPDYKVLYSNLSDRDGGAIITALQAANIPYKFSDAGGAILVPAEQVHEMRLRLASQ 141

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP S S  G+EL D    FG++ F ++I   RALEGE+ RT++SIS + +ARVH+ +P 
Sbjct: 142 GLPKSGS-VGFELMDN-QKFGISQFAEQINYQRALEGELERTVESISSVKSARVHLAIPK 199

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV++           +  AI H+V++AVP++ +  VT+LD  G LLT
Sbjct: 200 PSVFVRDKEAPSASVLVNLYPGRALDEGQVLAITHMVSSAVPDMPVKGVTILDQDGNLLT 259

Query: 219 ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
                  +    L   Q I+   +  I+  LA   G  N  S V A+++    +     Y
Sbjct: 260 QPSTGNGLDASQLKYRQQIERSTQQRIDAILAPLFGSGNAHSQVSADIDFSHSEQTSENY 319

Query: 279 DPDSKVER-SIRLSKDAQRSETS-------------QPESAVTVEQNMPHVSDRKVPLPR 324
            P+   ++ +IR  + +  +E S             QP    +   N P  +      P 
Sbjct: 320 GPNGNPQQAAIRSQQSSSATEMSQGAASGVPGALSNQPPQPASAPINAPTGASGVTTTPV 379

Query: 325 SLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSY 384
           S    D+K+  +NYE++            ++RLS+AVVVN  R+ +  G +  Q      
Sbjct: 380 S----DRKDSTTNYELDKTVRHLERPMGGIKRLSVAVVVNYLRVVDAKGHATMQPVTADK 435

Query: 385 LAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDI--LSRHFATVINA 442
           LA++N++V  A G +  RGD++ + +  F  +   N+        D+  L++  AT +  
Sbjct: 436 LAQVNQLVKDAMGFDQARGDSVNVVNSAFSTDLDPNADLPWWRTPDMIALAKQIATYLG- 494

Query: 443 LVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALD 502
            +  V   L   +   ALRR     +              PP++ A+ +   P++ I LD
Sbjct: 495 -IGAVALFLYFVMVKPALRRAFPPPE--------------PPVAGALPS---PDEPILLD 536


>gi|300114783|ref|YP_003761358.1| flagellar M-ring protein FliF [Nitrosococcus watsonii C-113]
 gi|299540720|gb|ADJ29037.1| flagellar M-ring protein FliF [Nitrosococcus watsonii C-113]
          Length = 567

 Score =  178 bits (452), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 120/417 (28%), Positives = 221/417 (52%), Gaps = 26/417 (6%)

Query: 16  SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFR 75
           SL +   L+LA  I   + L +    +  +P Y  +Y  +   +   I  AL +ANI++R
Sbjct: 36  SLQKQVGLLLA--IAASVALVVGVVMWALAPTYQVMYGAVTGEEKGEIVAALQKANIEYR 93

Query: 76  ISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRAL 135
           +++N  +I VP+S V + R+ LA +GLP  S+++G+EL ++   FG + F+++    RAL
Sbjct: 94  LAENTGAIMVPASKVHEVRLQLAMEGLP-RSADTGFELLEQNPGFGASEFLEKARYQRAL 152

Query: 136 EGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI-----RAINPSVYKSAEA 190
           EGE+ARTI +++ +  ARVH+ +P    F +    P+ASV++     RA++P       A
Sbjct: 153 EGELARTIGTLNNVRNARVHLALPKQSVFIRNRQAPSASVVLDLYAGRALDPG---QVAA 209

Query: 191 IRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKS---LSIVQAIQHEIEMNINK 247
           I HLV++++PNL+   VT++D  G LLT  +  ++ LG +       + ++ +    I  
Sbjct: 210 ITHLVSSSIPNLESSGVTLVDQRGNLLTRQDRSQS-LGMTEGQFEYTRRLEEKYIRRIQH 268

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE--------- 298
            LA  +G D  R+ VVAE++    +  +  Y+P+S   RS ++S++ +            
Sbjct: 269 ILAPMIGSDKARAQVVAEVDFTVTEQTQEYYNPESAALRSEQMSEEERTGSRFPQGIPGA 328

Query: 299 -TSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
            ++QP +     + +P  +D + P+  ++  T  +    NYE++     +      + RL
Sbjct: 329 LSNQPPAEAQAPEVVPEANDDEAPI-EAVPTTRSQRATRNYELDRTISHSRLSPGSIRRL 387

Query: 358 SIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFL 414
           S+AV+V++  + +  G  +   +    LA++  +V  A G N+ RGDTI + +  F+
Sbjct: 388 SVAVLVDEKAVADAEGTVSTVPRSPQELAQVTALVKEAVGFNAERGDTINVINAPFV 444


>gi|154252631|ref|YP_001413455.1| flagellar M-ring protein FliF [Parvibaculum lavamentivorans DS-1]
 gi|154156581|gb|ABS63798.1| flagellar M-ring protein FliF [Parvibaculum lavamentivorans DS-1]
          Length = 552

 Score =  178 bits (452), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 127/407 (31%), Positives = 216/407 (53%), Gaps = 14/407 (3%)

Query: 16  SLGRTRI--LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANID 73
           SLG  R+  L L ++ L     F+A R   N P    L+  + V D  ++   L  A + 
Sbjct: 10  SLGTMRLAALGLVAIALFSFFAFIALRMG-NEPKA-LLFSDVGVEDAAKMIAELDAAKVS 67

Query: 74  FRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVR 133
           + +  NG  I VP + V + R+ LA +GLP+  +  GYE+FD  ++ G TSF+Q I  +R
Sbjct: 68  YELRGNGGMIYVPQADVLRLRMMLAGKGLPAGGT-VGYEIFDNADALGTTSFLQNINHLR 126

Query: 134 ALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-AINPSVYKSAEAIR 192
           ALEGE+ARTI++I GI  ARVH+V+P+   F +    PTAS++++ + N    +  +AI+
Sbjct: 127 ALEGELARTIRAIEGIGGARVHLVLPERELFSRDRREPTASIVLKVSRNSLTTQQVKAIQ 186

Query: 193 HLVAAAVPNLDMGDVTVLDSTGKLLTA--NEMERNILGKSLSIVQ-AIQHEIEMNINKAL 249
           +LVA+AV  L  G V+++D  G LL +   E  +++L  S+   +   ++ +  ++   L
Sbjct: 187 YLVASAVDGLSPGRVSIVDERGALLASGVGEDTQSLLVTSVDERRTGYENRLRTHLENIL 246

Query: 250 AAFLGVDNFRSAVVAELNMDTQQIREI--VYDPDSKVERSIRLSKDAQRSETSQPESAVT 307
              +G D  R  V A+  MD  +I +    +DP+ +V RS +   D   S        VT
Sbjct: 247 QRVVGADKARVEVTAQ--MDYNRITQTSDTFDPNGQVVRSTQTVDDNSTSADGAQNDGVT 304

Query: 308 VEQNMPHVSDRKVPLPR-SLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG 366
           V  N+P+ +         S + +++ EE  NYEI+  +     +  +++RLS+AV+V+  
Sbjct: 305 VGNNLPNANLGGAEAETGSRQASNRTEETVNYEISRTTKTEVLEPGRVKRLSVAVLVDGS 364

Query: 367 RLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
              +  G +    + +  L +I  +V +A G ++ RGD + I ++ F
Sbjct: 365 YAADAEGNTVYTPRTEQELGKIEALVKSAIGFDTSRGDQVEIVNLQF 411


>gi|254502238|ref|ZP_05114389.1| flagellar M-ring protein FliF [Labrenzia alexandrii DFL-11]
 gi|222438309|gb|EEE44988.1| flagellar M-ring protein FliF [Labrenzia alexandrii DFL-11]
          Length = 538

 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 125/416 (30%), Positives = 219/416 (52%), Gaps = 15/416 (3%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           ++ L++F K+   LG  RI  + +V  + + +F    F V +P    LY +L + D   I
Sbjct: 1   MNGLIEFIKT---LGPARIAAMGAVAAILVGVFAFIIFRVTAPQMTTLYNELTLEDSAAI 57

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
              L    + F+++  G+SI VP   V + R+ LAA+GLP+  S  GYE+FD+ ++ G T
Sbjct: 58  VSQLESQGVQFKLAREGASIMVPQEQVARLRMQLAAEGLPTGGS-IGYEIFDRSDTLGAT 116

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR---AI 180
           SF+Q I  +RA+EGE++RTI S+  I +ARVH+V+P+   F++    P+AS+++     +
Sbjct: 117 SFVQNINHLRAMEGELSRTISSLDRIRSARVHLVIPERQLFQRDRRPPSASIVLNVRGGL 176

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL---TANEMERNILGKSLSIVQAI 237
            P   +   A++HLVA AV  LD   V+++D +G+LL    +++ E  +  +      AI
Sbjct: 177 GPGEIR---AVQHLVATAVDGLDPDKVSIVDESGRLLASGASSDDEGMVSARLQERSTAI 233

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRS 297
           +  +   + + L + +G    R  V A+++ +        +DP+ +V RS + SK+   S
Sbjct: 234 ESRLRNQVEEILNSVVGPGRARVRVNADIDFNRLTETTETFDPEGQVVRSTQ-SKEEATS 292

Query: 298 ETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
            T Q +  VTV   +P+    +       + +   EE  NYEI+  +     +  ++ RL
Sbjct: 293 STRQ-DGQVTVGNELPNADANQNNDAEEQDTSSLTEEIVNYEISRSTRTEVVEAGRITRL 351

Query: 358 SIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           S+AV+V+    T+  G S    +    L  I  +V +A G +  RGD + + ++ F
Sbjct: 352 SVAVLVDGTYQTDEDGNSIYTPRAQEALDRIAVLVRSAVGFDEARGDVVEVINLQF 407


>gi|78067882|ref|YP_370651.1| flagellar MS-ring protein [Burkholderia sp. 383]
 gi|77968627|gb|ABB10007.1| Flagellar FliF M-ring protein [Burkholderia sp. 383]
          Length = 587

 Score =  177 bits (450), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 122/413 (29%), Positives = 204/413 (49%), Gaps = 25/413 (6%)

Query: 18  GRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRIS 77
           G  ++  L +V    + +  A   +  +P Y  LY  L   D   I  AL +AN+ ++ +
Sbjct: 57  GNPKLPFLIAVAFA-VAVITALVLWSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFA 115

Query: 78  DNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEG 137
           D G +I VPS+ V + R+ LAA GLP   S  G+EL D    FG++ F ++I   RALEG
Sbjct: 116 DAGGAILVPSNQVHETRLKLAAMGLPKGGS-VGFELMDN-QKFGISQFAEQINYQRALEG 173

Query: 138 EIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLV 195
           E+ RTI+SI+ +  ARVH+ +P    F +    P+ASV +      V    +  AI  +V
Sbjct: 174 ELQRTIESINAVRGARVHLAIPKPSVFVRDKEAPSASVFVDLYPGRVLDEGQVQAITRMV 233

Query: 196 AAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGV 255
           ++ VP++   +VT++D  G LLT       +    L  VQ ++H  +  I+  LA   G 
Sbjct: 234 SSGVPDMPAKNVTIVDQDGNLLTQTASASGLDASQLKYVQQVEHNTQKRIDAILAPIFGT 293

Query: 256 DNFRSAVVAELNMDTQQIREIVYDPDSKVERS-IRLSKDAQRSETSQ------------- 301
            N RS V A+L+    +     Y P+   ++S IR  + +  +E +Q             
Sbjct: 294 GNARSQVSADLDFSKIEQTSESYGPNGNPQQSAIRSQQTSSATELAQGGASGVPGALSNT 353

Query: 302 -PESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
            P+ A     + P V+      P++   +D+K++ +NYE++            ++RLS+A
Sbjct: 354 PPQPA-----SAPIVAGNGQNAPQTTPVSDRKDQTTNYEVDKTIRHLEQPMGSVKRLSVA 408

Query: 361 VVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           VVVN   + +  G    Q    + LA++ ++V  A G + +RGD++ + +  F
Sbjct: 409 VVVNYQPVADAKGHVTMQPLPPAKLAQVEQLVKDAMGYDEKRGDSVNVVNSAF 461


>gi|209522223|ref|ZP_03270859.1| flagellar M-ring protein FliF [Burkholderia sp. H160]
 gi|209497337|gb|EDZ97556.1| flagellar M-ring protein FliF [Burkholderia sp. H160]
          Length = 555

 Score =  177 bits (450), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 139/461 (30%), Positives = 224/461 (48%), Gaps = 34/461 (7%)

Query: 23  LILASVILVPIM--LFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNG 80
           L+ A  +LV ++  LF+ +R    +P Y  LY  L   D   I  AL +ANI +++SD+G
Sbjct: 26  LVFAIALLVAVVAGLFLWSR----TPDYKVLYSNLSDRDGGSIIAALQQANIPYKLSDSG 81

Query: 81  SSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIA 140
            +I VP+  V + R+ LA+QGLP S S  G+EL D    FG++ F ++I   R+LEGE+ 
Sbjct: 82  GAILVPAEQVHEMRLRLASQGLPKSGS-VGFELMDN-QKFGISQFNEQINYQRSLEGELE 139

Query: 141 RTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAA 198
           RTI+SIS + +ARVH+ +P    F +    P+A+V++      V    +  AI H+V++A
Sbjct: 140 RTIESISSVKSARVHLAIPKPSVFVRDKEAPSAAVLVNLYPGRVLDEGQVVAITHMVSSA 199

Query: 199 VPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNF 258
           VP + +  VT+LD  G LLT       +    L   Q I+   +  I+  LA   G  N 
Sbjct: 200 VPEMPVRGVTILDQDGNLLTQPSNGSGLDATQLKFRQQIERNTQQRIDAILAPLFGPGNA 259

Query: 259 RSAVVAELNMDTQQIREIVYDPD-SKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSD 317
           RS V A+++    +     Y P+ S  + +IR  + +  +E SQ  ++      +P    
Sbjct: 260 RSQVSADIDFSHSEQTSENYGPNGSPQQAAIRSQQSSSATEMSQGGAS-----GVPGALS 314

Query: 318 RKVPLPRS--------------LENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVV 363
            + P P S                 +D K+  +NYE++            + RLS+AVVV
Sbjct: 315 NQPPQPASAPIVAANGASSVATTPISDHKDSTTNYELDKTVRHVDQPMGGIHRLSVAVVV 374

Query: 364 NKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGT 423
           N  R+ +  G    Q      L +I ++V  A G ++ RGD++ + +  F  +   N+  
Sbjct: 375 NYLRVVDAKGHVTMQPVSADKLMQITQLVKDAMGFDASRGDSVNVVNSAFTTDLDPNADL 434

Query: 424 VQVSFMDILS--RHFATVINALVFLVGTLLVTFLGLHALRR 462
                 D+L+  +  AT +   +  V   L   +   ALRR
Sbjct: 435 PWWRTPDMLALYKQIATYLG--IGAVALFLYFVMVKPALRR 473


>gi|302383920|ref|YP_003819743.1| flagellar M-ring protein FliF [Brevundimonas subvibrioides ATCC
           15264]
 gi|302194548|gb|ADL02120.1| flagellar M-ring protein FliF [Brevundimonas subvibrioides ATCC
           15264]
          Length = 542

 Score =  177 bits (450), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 121/380 (31%), Positives = 201/380 (52%), Gaps = 15/380 (3%)

Query: 51  LYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSG 110
           LY  L++ +   I+ +L ++ I +    +GS+I V    VG+AR+ LA +GL +S S  G
Sbjct: 45  LYSNLDLREAGEITASLEQSGIPYSTRGDGSTIMVNRDQVGEARLMLAGKGLVTSGS-VG 103

Query: 111 YELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGAR 170
           YELFD  +  G T F Q+I+  RAL+GE+ARTI S+ G+ +ARV I +P    F++  A 
Sbjct: 104 YELFDTQSVLGQTEFQQQISEQRALQGELARTIMSMRGVQSARVAIALPKRELFQQDAAE 163

Query: 171 PTASVMI----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNI 226
           PTASV++    R ++    +   AIR ++A++VPNL    VTV+D T + L A + E   
Sbjct: 164 PTASVVVGLGGRKLSSDQVR---AIRAVIASSVPNLKPNKVTVVDETNQTLAAADDEAGF 220

Query: 227 LGKSLSIVQ-AIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVE 285
              +    + A + +++  I   +   +G    R  V A+++M     +E  YDPD +V 
Sbjct: 221 SSATAEEAKGATEAQLQQRIKDLVEGVVGPGAARVQVTADIDMTRSTTQEQKYDPDGQVV 280

Query: 286 RSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSI 345
           RS   +    +  T   +   T   N+P  +        S E+ +   E +NYEI+  + 
Sbjct: 281 RSTSTNGTQSQDTTGVADGGATATNNIPGGAAPATTPAGSTESANT--ETTNYEISNTTT 338

Query: 346 ATTHDNYKLERLSIAVVVNKGRLT---EVLGRSADQGKIDSYLAEINKIVSAATGINSRR 402
            T  +  ++++LS+AV V+ G+LT   E  G +    +    + +I  +V AA G N  R
Sbjct: 339 TTVKEPGEVKKLSVAVAVD-GKLTPAAEPGGEATYAPRTAEEITQIEDLVKAAMGFNEER 397

Query: 403 GDTITITSMDFLENQLFNSG 422
           GD + +T++ F  + L ++G
Sbjct: 398 GDQVRVTNVRFNRDALVSAG 417


>gi|296531738|ref|ZP_06894564.1| flagellar M-ring protein FliF [Roseomonas cervicalis ATCC 49957]
 gi|296267937|gb|EFH13738.1| flagellar M-ring protein FliF [Roseomonas cervicalis ATCC 49957]
          Length = 472

 Score =  177 bits (450), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 130/375 (34%), Positives = 201/375 (53%), Gaps = 13/375 (3%)

Query: 51  LYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSG 110
           LY  LE ++  RIS  L E  I      +G+ I VP   V + R+ LAA+GLP     +G
Sbjct: 56  LYAGLEPAEAGRISARLEELKIPVEARGDGT-ILVPMDQVARLRMQLAAEGLPRQG-GAG 113

Query: 111 YELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGAR 170
           YEL D+ +   +TSFMQ + R+RALEGE+ARTI ++ G+ AARVHIV+P+  SF +    
Sbjct: 114 YELLDQTSPMQMTSFMQRVQRLRALEGELARTIVTMQGVRAARVHIVLPERESFSRDAPP 173

Query: 171 PTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG 228
           PTASV +         +A+  AIR LVA AVP L   DV+V+D  G +L A+       G
Sbjct: 174 PTASVTVTTSAGQRLGAAQAAAIRLLVAGAVPRLRQEDVSVMDGNGVVLAADGGMGAAAG 233

Query: 229 KSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSI 288
           +   I  A +H ++  +   L   +G    R+    E+       R   +DP  +VER  
Sbjct: 234 RLGEIRVAQEHALQKAVLDLLEPLVGRGKVRAVASVEVEGARTVARAETFDPLGQVERGR 293

Query: 289 RLSKDAQRSETSQPESAVTVEQNMP--HVSDRKVPLPRSLENTDKKEEQSNYEINTKSIA 346
           +L  + + SE  + ++ VTV QN+P   V+       RS+    +  E  N+EI++K   
Sbjct: 294 QLQTEQENSEDGRGQAPVTVGQNLPNQQVNQNAT---RSVSAVQRNNETVNFEISSKVEE 350

Query: 347 TTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTI 406
           T  +   ++R+S+AVVV+   +T+  G    Q +  + L  +  +V +A G N +RGDT+
Sbjct: 351 TVREPGAVKRVSVAVVVDG--ITDAEGNV--QPRPPAELERLAALVRSAVGYNQQRGDTV 406

Query: 407 TITSMDFLENQLFNS 421
           T+ ++ FL ++   +
Sbjct: 407 TVDTLRFLPDEGLGT 421


>gi|328542763|ref|YP_004302872.1| flagellar M-ring protein [polymorphum gilvum SL003B-26A1]
 gi|326412509|gb|ADZ69572.1| Flagellar M-ring protein [Polymorphum gilvum SL003B-26A1]
          Length = 538

 Score =  177 bits (450), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 128/417 (30%), Positives = 221/417 (52%), Gaps = 18/417 (4%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           ++ L++F ++   LG TR+  + +V  + I +F    F V +P    LY  L + D + I
Sbjct: 1   MNGLVEFIRT---LGPTRVAAMGAVAAILIGVFAFIIFRVTAPQMTQLYSDLTLEDSSAI 57

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
              L    I F +  +G++I +P   V + R+ LA +GLP+  S  GYE+FD+ ++ G T
Sbjct: 58  VNQLESLGIPFELKRDGATIMIPKEQVARVRMRLAEEGLPTGGS-IGYEIFDRSDTLGAT 116

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS 183
           SF+Q I  +RA+EGE+ARTI+S+  IV+ARVH+V+P+   F++    P+AS+ I+     
Sbjct: 117 SFVQNINHLRAMEGELARTIRSLDRIVSARVHLVIPERQLFQRDRRPPSASIAIKTRGSL 176

Query: 184 VYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT--ANEMERNILGKSL-----SIVQA 236
                 AI+HLVAAAV  L    V+++D TG+LL   ++E    I+  SL      I Q 
Sbjct: 177 GQNEIRAIQHLVAAAVDGLGPERVSIVDDTGRLLATGSDESAEGIVASSLQERTFEIEQR 236

Query: 237 IQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQR 296
           ++++IE  +N    + +G    R  V AE++ +        +DP+ +V RS +  +++  
Sbjct: 237 LKNQIEEILN----SVVGPGRARVRVAAEVDFNRITETSEKFDPEGQVVRSTQSKEESST 292

Query: 297 SETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLER 356
           S + Q  + VTV   +P+ ++         E ++  EE  N+EI+        +  +++R
Sbjct: 293 SISRQ--AGVTVGNQIPN-AEADAGEGGDREGSNLAEEIVNFEISKSVRTEVVEAGRIKR 349

Query: 357 LSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           LS+AV+V+        G      +    L  I  +V +A G ++ RGD + + ++ F
Sbjct: 350 LSVAVLVDGVYSPNESGEVQYAPRTQEVLDRIAVLVRSAVGFDAARGDVVEVVNLRF 406


>gi|85713555|ref|ZP_01044545.1| flagellar M-ring protein [Nitrobacter sp. Nb-311A]
 gi|85699459|gb|EAQ37326.1| flagellar M-ring protein [Nitrobacter sp. Nb-311A]
          Length = 541

 Score =  177 bits (449), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 131/422 (31%), Positives = 210/422 (49%), Gaps = 33/422 (7%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           LL F K    LG +R++ + +V  V I  F      V +P    L+  L V D + I   
Sbjct: 4   LLAFLKG---LGASRLMAMVAVTTVLIAFFAFVIMRVTTPQMTTLFTDLSVEDSSGIIKD 60

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L    I F + ++G+ I VP   V + R+ LA  GLP      GYE+FDK ++ G TSF+
Sbjct: 61  LERQAIPFELRNDGAVIMVPKDKVTRLRMKLAEAGLPKGG-GVGYEIFDKSDALGTTSFV 119

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           Q I R+RALEGE+ARTI++I  I  ARVH+V+P+   F +   +P+AS+++R       +
Sbjct: 120 QNINRLRALEGELARTIRAIDRIQDARVHLVLPERPLFTREAPQPSASIVVRVRGGLEPQ 179

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-----------TANEMERNILGKSLSIVQ 235
              AIRHLVA+AV  L    V+++D TG+LL           T +E       +  S V+
Sbjct: 180 QIRAIRHLVASAVNGLKPQRVSIVDETGQLLADGSTTDADGVTGDERRTAFEKRMRSQVE 239

Query: 236 AIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI--VYDPDSKVERSIRLSKD 293
           AI   +             V N R+ V    + D  +I +    +DP+ +V RS +  ++
Sbjct: 240 AIVSSV-------------VGNGRARVQLSADFDYNKITQTSDTFDPEGRVLRSSQTREE 286

Query: 294 AQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYK 353
           +  S T+     VTV   +P       P  ++ + + K EE +NYEI+  +     +  +
Sbjct: 287 S--SLTADNNGQVTVNNELPGNQPSDNP-NQARDQSKKSEETNNYEISRTTKTEVSEAGR 343

Query: 354 LERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           + R+S+AV+V+     +  G+     +    L  I  +V +A G + +RGD + + ++ F
Sbjct: 344 VNRISVAVLVDGTYAKDDKGQMVYTERSKEQLDRIATLVRSAIGFDQKRGDQVEVVNLRF 403

Query: 414 LE 415
            E
Sbjct: 404 AE 405


>gi|206558926|ref|YP_002229686.1| flagellar MS-ring protein [Burkholderia cenocepacia J2315]
 gi|198034963|emb|CAR50835.1| flagellar M-ring protein FliF [Burkholderia cenocepacia J2315]
          Length = 587

 Score =  177 bits (449), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 118/390 (30%), Positives = 196/390 (50%), Gaps = 24/390 (6%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VPS+ V + R+ LAA 
Sbjct: 78  LWSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPSNQVHETRLKLAAM 137

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   S  G+EL D    FG++ F ++I   RALEGE+ RTI+SI+ +  ARVH+ +P 
Sbjct: 138 GLPKGGS-VGFELMDN-QKFGISQFAEQINYQRALEGELQRTIESINAVRGARVHLAIPK 195

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSA--EAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV +      V      +AI  +V++ VP++   +VT++D  G LLT
Sbjct: 196 PSVFVRDKEAPSASVFVDLYPGRVLDEGQVQAITRMVSSGVPDMPAKNVTIVDQDGNLLT 255

Query: 219 ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
                  +    L  VQ ++H  +  I+  LA   G  N RS V A+L+    +     Y
Sbjct: 256 QTASASGLDASQLKYVQQVEHNTQKRIDAILAPIFGAGNARSQVSADLDFSKIEQTSESY 315

Query: 279 DPDSKVER-SIRLSKDAQRSETSQ--------------PESAVTVEQNMPHVSDRKVPLP 323
            P+   ++ +IR  + +  +E +Q              P+ A     + P V+      P
Sbjct: 316 GPNGTPQQAAIRSQQTSSATELAQGGASGVPGALSNTPPQPA-----SAPIVAGNGQNAP 370

Query: 324 RSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDS 383
           ++   +D+K++ +NYE++     T      ++RLS+AVVVN   + +  G    Q    +
Sbjct: 371 QTTPVSDRKDQTTNYELDKTIRHTEQPMGSVKRLSVAVVVNYQPVADAKGHVTMQPLPPA 430

Query: 384 YLAEINKIVSAATGINSRRGDTITITSMDF 413
            LA++ ++V  A G + +RGD++ + +  F
Sbjct: 431 KLAQVEQLVKDAMGYDEKRGDSVNVVNSAF 460


>gi|107023995|ref|YP_622322.1| flagellar MS-ring protein [Burkholderia cenocepacia AU 1054]
 gi|116691082|ref|YP_836705.1| flagellar MS-ring protein [Burkholderia cenocepacia HI2424]
 gi|170734416|ref|YP_001766363.1| flagellar MS-ring protein [Burkholderia cenocepacia MC0-3]
 gi|105894184|gb|ABF77349.1| flagellar M-ring protein FliF [Burkholderia cenocepacia AU 1054]
 gi|116649171|gb|ABK09812.1| flagellar M-ring protein FliF [Burkholderia cenocepacia HI2424]
 gi|169817658|gb|ACA92241.1| flagellar M-ring protein FliF [Burkholderia cenocepacia MC0-3]
          Length = 587

 Score =  177 bits (448), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 118/390 (30%), Positives = 196/390 (50%), Gaps = 24/390 (6%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VPS  V + R+ LAA 
Sbjct: 78  LWSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPSGQVHETRLKLAAM 137

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   S  G+EL D    FG++ F ++I   RALEGE+ RTI+SI+ +  ARVH+ +P 
Sbjct: 138 GLPKGGS-VGFELMDN-QKFGISQFAEQINYQRALEGELQRTIESINAVRGARVHLAIPK 195

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSA--EAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV +      V      +AI  +V++ VP++   +VT++D  G LLT
Sbjct: 196 PSVFVRDKEAPSASVFVDLYPGRVLDEGQVQAITRMVSSGVPDMPAKNVTIVDQDGNLLT 255

Query: 219 ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
                  +    L  VQ ++H  +  I+  LA   G  N RS V A+L+    +     Y
Sbjct: 256 QTASASGLDASQLKYVQQVEHNTQKRIDAILAPIFGAGNARSQVSADLDFSKIEQTSESY 315

Query: 279 DPDSKVER-SIRLSKDAQRSETSQ--------------PESAVTVEQNMPHVSDRKVPLP 323
            P+   ++ +IR  + +  +E +Q              P+ A     + P V+      P
Sbjct: 316 GPNGTPQQAAIRSQQTSSATELAQGGASGVPGALSNTPPQPA-----SAPIVAGNGQNGP 370

Query: 324 RSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDS 383
           ++   +D+K++ +NYE++     T      ++RLS+AVVVN   + +  G    Q    +
Sbjct: 371 QTTPVSDRKDQTTNYELDKTIRHTEQPMGSVKRLSVAVVVNYQPVADAKGHVTMQPLPPA 430

Query: 384 YLAEINKIVSAATGINSRRGDTITITSMDF 413
            LA++ ++V  A G +++RGD++ + +  F
Sbjct: 431 KLAQVEQLVKDAMGYDAKRGDSVNVVNSAF 460


>gi|254246925|ref|ZP_04940246.1| Flagellar biosynthesis/type III secretory pathway lipoprotein
           [Burkholderia cenocepacia PC184]
 gi|124871701|gb|EAY63417.1| Flagellar biosynthesis/type III secretory pathway lipoprotein
           [Burkholderia cenocepacia PC184]
          Length = 587

 Score =  176 bits (447), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 118/390 (30%), Positives = 195/390 (50%), Gaps = 24/390 (6%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VPS  V + R+ LAA 
Sbjct: 78  LWSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPSGQVHETRLKLAAM 137

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   S  G+EL D    FG++ F ++I   RALEGE+ RTI+SI+ +  ARVH+ +P 
Sbjct: 138 GLPKGGS-VGFELMDN-QKFGISQFAEQINYQRALEGELQRTIESINAVRGARVHLAIPK 195

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSA--EAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV +      V      +AI  +V++ VP++   +VT++D  G LLT
Sbjct: 196 PSVFVRDKEAPSASVFVDLYPGRVLDEGQVQAITRMVSSGVPDMPAKNVTIVDQDGNLLT 255

Query: 219 ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
                  +    L  VQ ++H  +  I+  LA   G  N RS V A+L+    +     Y
Sbjct: 256 QTASASGLDASQLKYVQQVEHNTQKRIDAILAPIFGAGNARSQVSADLDFSKIEQTSESY 315

Query: 279 DPDSKVER-SIRLSKDAQRSETSQ--------------PESAVTVEQNMPHVSDRKVPLP 323
            P+   ++ +IR  + +  +E +Q              P+ A     + P V+      P
Sbjct: 316 GPNGTPQQAAIRSQQTSSATELAQGGASGVPGALSNTPPQPA-----SAPIVAGNGQNGP 370

Query: 324 RSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDS 383
           ++   +D+K++ +NYE++     T      ++RLS+AVVVN   + +  G    Q    +
Sbjct: 371 QTTPVSDRKDQTTNYELDKTIRHTEQPMGSVKRLSVAVVVNYQPVADAKGHVTMQPLPPA 430

Query: 384 YLAEINKIVSAATGINSRRGDTITITSMDF 413
            LA++ ++V  A G + +RGD++ + +  F
Sbjct: 431 KLAQVEQLVKDAMGYDEKRGDSVNVVNSAF 460


>gi|332702978|ref|ZP_08423066.1| flagellar M-ring protein FliF [Desulfovibrio africanus str. Walvis
           Bay]
 gi|332553127|gb|EGJ50171.1| flagellar M-ring protein FliF [Desulfovibrio africanus str. Walvis
           Bay]
          Length = 533

 Score =  176 bits (446), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 133/451 (29%), Positives = 226/451 (50%), Gaps = 27/451 (5%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           L++L  F+   +   R  I  LA+ ++V  +L +    ++N P Y  LY  L   D  R+
Sbjct: 9   LNKLTAFWSDRSMAQRVMIGGLAASLVVIFLLLIV---WLNQPDYKILYSNLPPEDAGRV 65

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
           +  L +  ID+++ D+G ++ VPS  V + R+ +A +GL    +  G+ELFD+V   G T
Sbjct: 66  AEQLKKQKIDYKLEDSGKTVLVPSDQVYQLRLDMAGEGL-LHGTGLGFELFDEVK-IGQT 123

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI-----R 178
            F+Q I   RAL+GE++RTI     +  ARVHIVMP    F +  + PTAS+++     R
Sbjct: 124 DFVQRINYQRALQGELSRTITEFPEVERARVHIVMPHKSLFIEEQSPPTASIILKLAEGR 183

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQ--- 235
            +N    K  EAI +LV+ +V  LD   +TV D  GKLL   + + ++ G +L  ++   
Sbjct: 184 ELN---QKQIEAIVNLVSLSVEGLDKSQITVADVAGKLLFQADSDDSVKGLTLGQLEYRT 240

Query: 236 AIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQ 295
            +Q  +E  I + L   +GV    + V A+++   + I + +YDP S V RS       Q
Sbjct: 241 TLQRNLEQRIEQLLTPVVGVGKVIARVNADVDFSQKTITKDIYDPSSAVVRS------EQ 294

Query: 296 RSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEE--QSNYEINTKSIATTHDNYK 353
           R+E  Q +    +E   P  + R      SL + D   E   +N+EIN +  +      +
Sbjct: 295 RTE-EQTKGRANIEGGEPDPNFRGDGFNGSLSSQDSNRETRTTNFEINKEQQSIVVPVGE 353

Query: 354 LERLSIAVVVNKGRL--TEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSM 411
           ++RLS+AV+V+       E  G      +    +  I ++V    G +  RGD I ++++
Sbjct: 354 IDRLSVAVIVDGTWQAPAEGEGEPVWVPRSQEEIQRITELVRNTVGFSQSRGDAIEVSNI 413

Query: 412 DFLENQLFNSGTVQVSFMDILSRHFATVINA 442
            F E  +F   ++  + ++ + R    ++N 
Sbjct: 414 SFGEPDMFGEPSLMQTMLEYMQRLGKPILNG 444


>gi|148260475|ref|YP_001234602.1| flagellar M-ring protein FliF [Acidiphilium cryptum JF-5]
 gi|146402156|gb|ABQ30683.1| flagellar M-ring protein FliF [Acidiphilium cryptum JF-5]
          Length = 520

 Score =  176 bits (445), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 121/415 (29%), Positives = 215/415 (51%), Gaps = 9/415 (2%)

Query: 9   QFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYD-NLYVKLEVSDVNRISVAL 67
           Q   +  +LG  ++  + +V  V ++  MAA      P     LY  L + D + I+  L
Sbjct: 3   QLIANLRALGPVKLGAMGAVA-VAVLGLMAALVLTGGPSPSATLYSGLGLKDASHITETL 61

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
             A+I + I + G S+ V  + + +AR+ LA   LP+ SSN G+ +FD  N    +SF+ 
Sbjct: 62  KAAHIRYAIGNGGHSVLVTPAQLDEARLLLAQHNLPAGSSN-GFAIFDHKNPLLGSSFLN 120

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR--AINPSVY 185
            I   RAL+ E+ RTI  I G+ A+RV +V+P    F    A   ASVM+    + P  +
Sbjct: 121 RIDETRALDSELERTINLIHGVEASRVQVVLPRRDEFSLNTAPAQASVMLSLAGVGPLDH 180

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT-ANEMERNILG-KSLSIVQAIQHEIEM 243
           +S EAI +LVA+AVP L   +++++D+ G LL  A   + ++L  +  ++ Q+ + ++  
Sbjct: 181 ESVEAILNLVASAVPGLKPNNISIVDNRGDLLAQAGRTDNSLLSSRDAALKQSTERQLSE 240

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            +   LAA +G +  R      ++ D  +     Y+P+ +V RS + ++ ++ S +S   
Sbjct: 241 AVRSMLAAVVGPNQVRVVTAVSMDFDRSEQTSTTYNPNGQVVRSQQQTR-SKSSRSSGTN 299

Query: 304 SAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVV 363
             V+V  N+P  +  K   P+ L+   K  + +NYEI+       H   ++ R+S+AV++
Sbjct: 300 KTVSVSNNLPGATSSKAG-PKRLDTQSKSTQTTNYEISQDVKHIVHATPQITRISVAVML 358

Query: 364 NKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQL 418
           +  + T   G+     +  + +A+I K+V  A G +  RGD + + S+ F  N+L
Sbjct: 359 DDVKTTNPKGKVIWTPRSPAQVAQIRKLVETAIGYDKSRGDVVDVQSLQFAPNEL 413


>gi|326403668|ref|YP_004283750.1| flagellar M-ring protein FliF [Acidiphilium multivorum AIU301]
 gi|325050530|dbj|BAJ80868.1| flagellar M-ring protein FliF [Acidiphilium multivorum AIU301]
          Length = 520

 Score =  176 bits (445), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 121/415 (29%), Positives = 215/415 (51%), Gaps = 9/415 (2%)

Query: 9   QFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYD-NLYVKLEVSDVNRISVAL 67
           Q   +  +LG  ++  + +V  V ++  MAA      P     LY  L + D + I+  L
Sbjct: 3   QLIANLRALGPVKLGAMGAVA-VAVLGLMAALVLTGGPSPSATLYSGLGLKDASHITETL 61

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
             A+I + I + G S+ V  + + +AR+ LA   LP+ SSN G+ +FD  N    +SF+ 
Sbjct: 62  KAAHIRYAIGNGGHSVLVTPAQLDEARLLLAQHNLPAGSSN-GFAIFDHKNPLLGSSFLN 120

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR--AINPSVY 185
            I   RAL+ E+ RTI  I G+ A+RV +V+P    F    A   ASVM+    + P  +
Sbjct: 121 RIDETRALDSELERTINLIHGVEASRVQVVLPRRDEFSLSTAPAQASVMLSLAGVGPLDH 180

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT-ANEMERNILG-KSLSIVQAIQHEIEM 243
           +S EAI +LVA+AVP L   +++++D+ G LL  A   + ++L  +  ++ Q+ + ++  
Sbjct: 181 ESVEAILNLVASAVPGLKPNNISIVDNRGDLLAQAGRTDNSLLSSRDAALKQSTERQLSE 240

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            +   LAA +G +  R      ++ D  +     Y+P+ +V RS + ++ ++ S +S   
Sbjct: 241 AVRSMLAAVVGPNQVRVVTAVSMDFDRSEQTSTTYNPNGQVVRSQQQTR-SKSSRSSGTN 299

Query: 304 SAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVV 363
             V+V  N+P  +  K   P+ L+   K  + +NYEI+       H   ++ R+S+AV++
Sbjct: 300 KTVSVSNNLPGATSSKAG-PKRLDTQSKSTQTTNYEISQDVKHIVHATPQITRISVAVML 358

Query: 364 NKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQL 418
           +  + T   G+     +  + +A+I K+V  A G +  RGD + + S+ F  N+L
Sbjct: 359 DDVKTTNPKGKVIWTPRSPAQVAQIRKLVETAIGYDKSRGDVVDVQSLQFAPNEL 413


>gi|220925883|ref|YP_002501185.1| flagellar MS-ring protein [Methylobacterium nodulans ORS 2060]
 gi|219950490|gb|ACL60882.1| flagellar M-ring protein FliF [Methylobacterium nodulans ORS 2060]
          Length = 541

 Score =  175 bits (444), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 120/419 (28%), Positives = 213/419 (50%), Gaps = 17/419 (4%)

Query: 3   ILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNR 62
           +LD + +F       G  R+  + +V L  +  F      V+ P    LY  L + D + 
Sbjct: 4   VLDLVAKF-------GPARLAAMGAVTLTLVGFFAFVILRVSRPEMGVLYADLSMQDASA 56

Query: 63  ISVALSEANIDFRI-SDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           +   L    + +    + G +I  P + + + R+ LA +GLPS+    GYE+FDK ++F 
Sbjct: 57  VIRDLDARGLRYETRGEMGQTILAPRADLARLRMDLAGKGLPSAG-GVGYEIFDKGDAFS 115

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
            T+F+Q +  +RALEGE+AR+I++I  + AAR+H+V+P+   F +    P+A+++++   
Sbjct: 116 STTFVQNVNHLRALEGELARSIRAIGRVQAARIHLVIPEKRLFARDREPPSAAIVLKLSG 175

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGK-SLSIVQA-IQH 239
                   A+RHLVA++V  L    ++++D  G+LL       +  G+  L   QA ++H
Sbjct: 176 DLDPGQVRAVRHLVASSVEGLKPDRISIVDERGRLLADGAKPEDAQGRLGLDERQANLEH 235

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
            +   +   +A  +G    R  V AEL+ +  + R   +DP+S+V RS +   + Q+S+ 
Sbjct: 236 RLRAQVEGIVAGIVGSGRARVQVAAELDANRIESRSETFDPESRVVRSTQTRSETQQSQG 295

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPR--SLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
              E+ V+V   +P   D   P  +  + E ++K EE +NYEI+  +    ++  ++ RL
Sbjct: 296 PG-ETGVSVGNELPGARD---PAQQNGTREASNKNEETTNYEISRVTRTEINEGGRIRRL 351

Query: 358 SIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLEN 416
           S+AVV++        GR     +    L  I  +V  A G +  RGD I + ++ F E 
Sbjct: 352 SVAVVIDGTYTPGPDGRPVYAPRPQDELDRITALVRTAVGYDKARGDQIEVVNLRFAEG 410


>gi|167579440|ref|ZP_02372314.1| flagellar MS-ring protein [Burkholderia thailandensis TXDOH]
          Length = 518

 Score =  174 bits (441), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 118/391 (30%), Positives = 193/391 (49%), Gaps = 27/391 (6%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 78  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 137

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++S++ + AARVH+ +P  
Sbjct: 138 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESVNAVRAARVHLAIPKP 195

Query: 162 GSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++      V    +  AI  LV+++VP++   +VT++D  G LLT 
Sbjct: 196 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAITRLVSSSVPDMPAKNVTIVDQDGNLLTQ 255

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 256 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYA 315

Query: 280 PDSKVERS-IRLSKDAQRSE----------------TSQPESAVTVEQNMPHVSDRKVPL 322
           P+   ++S IR  + +  +E                  QP SA  V  N    +    P+
Sbjct: 316 PNGTPQQSAIRSQQTSTSTELAQSGASGVPGALSNTPPQPASAPIVASNGQPAAPAATPV 375

Query: 323 PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKID 382
                 +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q    
Sbjct: 376 ------SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLTA 429

Query: 383 SYLAEINKIVSAATGINSRRGDTITITSMDF 413
             LA++ ++V  A G + +RGD++ + +  F
Sbjct: 430 DKLAQVQQLVKDAMGYDEKRGDSVNVVNSAF 460


>gi|167617536|ref|ZP_02386167.1| flagellar MS-ring protein [Burkholderia thailandensis Bt4]
          Length = 594

 Score =  174 bits (440), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 118/391 (30%), Positives = 193/391 (49%), Gaps = 27/391 (6%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 78  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 137

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++S++ + AARVH+ +P  
Sbjct: 138 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESVNAVRAARVHLAIPKP 195

Query: 162 GSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++      V    +  AI  LV+++VP++   +VT++D  G LLT 
Sbjct: 196 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAITRLVSSSVPDMPAKNVTIVDQDGNLLTQ 255

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 256 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYA 315

Query: 280 PDSKVERS-IRLSKDAQRSE----------------TSQPESAVTVEQNMPHVSDRKVPL 322
           P+   ++S IR  + +  +E                  QP SA  V  N    +    P+
Sbjct: 316 PNGTPQQSAIRSQQTSTSTELAQSGTSGVPGALSNTPPQPASAPIVASNGQPAAPAATPV 375

Query: 323 PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKID 382
                 +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q    
Sbjct: 376 ------SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLTA 429

Query: 383 SYLAEINKIVSAATGINSRRGDTITITSMDF 413
             LA++ ++V  A G + +RGD++ + +  F
Sbjct: 430 DKLAQVQQLVKDAMGYDEKRGDSVNVVNSAF 460


>gi|186477678|ref|YP_001859148.1| flagellar MS-ring protein [Burkholderia phymatum STM815]
 gi|184194137|gb|ACC72102.1| flagellar M-ring protein FliF [Burkholderia phymatum STM815]
          Length = 593

 Score =  174 bits (440), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 121/394 (30%), Positives = 199/394 (50%), Gaps = 26/394 (6%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  +   D   I  AL +AN+ ++ S+ G +I +P+  V + R+ LA+Q
Sbjct: 81  LWSRAPDYKVLYSNVSDQDGGAIVAALQQANVPYKFSEAGGAILIPADQVHEMRLRLASQ 140

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP S S  G+EL D    FG++ F ++I   RALEGE+ RTI+SIS +  ARVH+ +P 
Sbjct: 141 GLPKSGS-VGFELMDN-QKFGISQFAEQINYQRALEGELQRTIESISTVKTARVHLAIPK 198

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV++      +    +  AI H+VA+AVP++ +  VT++D  G LLT
Sbjct: 199 PTVFVRDREAPSASVLVNLYPGRMLDEGQVVAITHMVASAVPDMSVRGVTIVDQDGNLLT 258

Query: 219 -ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIV 277
            A      +    L   Q I+   +  I+  L    G  N  S+V A+++   Q++    
Sbjct: 259 QAGANGAGLDATQLKYRQQIERNTQQRIDAILGPMFGTGNAHSSVSADIDFSRQELTSEK 318

Query: 278 YDPDSKVER-SIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENT------- 329
           Y P++  ++ +IR  + +  +E SQ  ++      +P     + P P S   T       
Sbjct: 319 YAPNNDPQQAAIRSQQTSTATEMSQSGAS-----GVPGALSNQPPQPASAPITASANGAS 373

Query: 330 --------DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKI 381
                   D K+  +NYE++     T      ++RLS+AVVVN  R+ +  G +  Q   
Sbjct: 374 GVTTTPISDHKDSTTNYELSKTVSHTEAAVGGIKRLSVAVVVNYMRVFDAKGHATMQPIS 433

Query: 382 DSYLAEINKIVSAATGINSRRGDTITITSMDFLE 415
              LA+++++V  A G +  RGDT+ + S  F +
Sbjct: 434 ADKLAQVDQLVKEAMGYDQARGDTVKVISSAFQQ 467


>gi|295678025|ref|YP_003606549.1| flagellar M-ring protein FliF [Burkholderia sp. CCGE1002]
 gi|295437868|gb|ADG17038.1| flagellar M-ring protein FliF [Burkholderia sp. CCGE1002]
          Length = 598

 Score =  174 bits (440), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 131/441 (29%), Positives = 213/441 (48%), Gaps = 28/441 (6%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  L   D   I  AL +ANI +++S++G+++ VP+  V + R+ LA+Q
Sbjct: 85  LWSRAPSYKVLYSNLSDRDGGSIITALQQANIPYKLSESGTAVLVPAEQVHETRLRLASQ 144

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP S S  G+EL D    FG++ F +++   RALEGE+ RTI SIS + +ARVH+ +P 
Sbjct: 145 GLPKSGS-VGFELMDN-QKFGISQFDEQVNYQRALEGELERTIGSISSVKSARVHLAIPK 202

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV++      V    +  AI H+VA+AVP + +  VT+LD  G LLT
Sbjct: 203 PSVFVRDKEPPSASVLVNLYPGRVLDEGQVVAITHMVASAVPQMPVRGVTILDQDGNLLT 262

Query: 219 ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
                  +    L   Q I+   +  I+  LA   G  N RS V A+++    +     Y
Sbjct: 263 QPTNGSGLDATQLKFRQQIERNTQQRIDTILAPLFGAGNARSQVSADIDFSHSEQTSEKY 322

Query: 279 DPDSKVE-RSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRS------------ 325
            P++  +  +IR  + +  +E SQ  ++      +P     + P P S            
Sbjct: 323 GPNANPQDAAIRSQQTSSATEMSQGGAS-----GVPGALSNQPPQPASAPIVAGNGASSV 377

Query: 326 --LENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDS 383
                +D K+  +NYE++            + RL++AVVVN  R+ +  G    Q     
Sbjct: 378 STTPISDHKDSTTNYELDKTVRHIDQPMGGIRRLTVAVVVNYMRVVDPKGHVTMQPVSAD 437

Query: 384 YLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILS--RHFATVIN 441
            LA+I ++V  A G ++ RGD++ + +  F  +   N+        D+L+  +  AT + 
Sbjct: 438 KLAQITQLVKDAMGYDASRGDSVNVVNSAFTTDLDPNADLPWWRTPDMLALYKQIATYLG 497

Query: 442 ALVFLVGTLLVTFLGLHALRR 462
             +  V   L   +   ALRR
Sbjct: 498 --IGAVALFLYFVMVKPALRR 516


>gi|77165822|ref|YP_344347.1| flagellar FliF M-ring protein [Nitrosococcus oceani ATCC 19707]
 gi|254434642|ref|ZP_05048150.1| flagellar M-ring protein FliF [Nitrosococcus oceani AFC27]
 gi|76884136|gb|ABA58817.1| Flagellar FliF M-ring protein [Nitrosococcus oceani ATCC 19707]
 gi|207090975|gb|EDZ68246.1| flagellar M-ring protein FliF [Nitrosococcus oceani AFC27]
          Length = 567

 Score =  174 bits (440), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 126/419 (30%), Positives = 218/419 (52%), Gaps = 45/419 (10%)

Query: 22  ILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGS 81
           + I ASV LV + +FM    +  +P Y  +Y  +   +   I  AL +ANI++R+++N  
Sbjct: 45  LAIAASVALV-VGIFM----WSWAPTYQVMYGAVTGKEKGEIVAALQKANIEYRLAENTG 99

Query: 82  SISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIAR 141
           +I VP+S V + R+ LA +GLP S+ ++G+EL ++   FG + F+++    RALEGE+AR
Sbjct: 100 AIMVPASKVHEVRLQLAMEGLPRSA-DTGFELLEQNPGFGASEFLEKARYQRALEGELAR 158

Query: 142 TIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVA 196
           TI +++ +  ARVH+ +P    F +    P+ASV++     R ++P       AI HLVA
Sbjct: 159 TIGALNNVRNARVHLALPKQSVFIRNRRAPSASVVLDLYAGRTLDPG---QVAAITHLVA 215

Query: 197 AAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQA-------IQHEIEMNINKAL 249
           +++PNL+   VT++D  G LLT     R    +SL + +        ++ +    I   L
Sbjct: 216 SSIPNLESSGVTLVDQRGNLLT-----RQDRSQSLGMTEGQFEHTRRLEEKYISRIQHIL 270

Query: 250 AAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVE 309
           A  +G +  R+ VVAE++    +  +  Y+P S   RS ++S++ +R+ +  P+      
Sbjct: 271 APMIGSNKVRAQVVAEVDFTVTEQTQEYYNPGSAALRSEQMSEE-ERTGSRLPQGIPGAL 329

Query: 310 QNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLE-------------- 355
            N P    +    P ++   +  E Q      T+S   T  NY+L+              
Sbjct: 330 SNQPPADAQA---PETVPEANGDEAQIEPVPTTRSQRATR-NYELDRTISHSRLSPGSIR 385

Query: 356 RLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFL 414
           RLS+AV+V++  +T+  G  +   +    LA++  +V  A G N+ RGDTI + +  F+
Sbjct: 386 RLSVAVLVDEKAVTDAEGAVSTLPRSPQELAQVTALVKEAVGFNAERGDTINVINAPFV 444


>gi|296534177|ref|ZP_06896667.1| flagellar M-ring protein FliF [Roseomonas cervicalis ATCC 49957]
 gi|296265497|gb|EFH11632.1| flagellar M-ring protein FliF [Roseomonas cervicalis ATCC 49957]
          Length = 525

 Score =  174 bits (440), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 131/424 (30%), Positives = 210/424 (49%), Gaps = 28/424 (6%)

Query: 16  SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFR 75
           +LG  R+  LA   L+ + L         +     LY  L+  D  +I  AL  A + +R
Sbjct: 42  ALGTARLAALAFTGLLTLGLIGFLTLRTATTPMGLLYGDLDQRDAAQIVAALERARVPYR 101

Query: 76  ISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRAL 135
           +  NG+ +  P   + + R+ LA  GLP+  S  GYE+FD+ +    T F Q+I R+RAL
Sbjct: 102 LGRNGTEVLAPEEDIPRLRLSLARDGLPAGGS-VGYEIFDRQSGLTTTPFQQDINRLRAL 160

Query: 136 EGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI--RAINPSVYKSAEAIRH 193
           EGEIAR+I+ + G+ +ARVH+V+P    F +      ASV++  R I+    +  +A+ H
Sbjct: 161 EGEIARSIRGLDGVASARVHLVLPRREPFSRERGESQASVVLQMRGIHRLDREGVQAVLH 220

Query: 194 LVAAAVPNLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKA---- 248
           LVAAAVP L   ++ V+D  G+LL+   +   N L +S    + I+   EM + +A    
Sbjct: 221 LVAAAVPGLKPQNIAVVDGRGELLSRGGQAGANGLAQS---QEEIRRGQEMRMARAVEEM 277

Query: 249 LAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTV 308
           L   LG    R+    E++ D  Q  E  +DP+++V           RS++S  ES+   
Sbjct: 278 LERILGPGRVRAEATIEMDHDRVQTTEERFDPENQVP----------RSQSSVNESSRNG 327

Query: 309 EQNMPHVSDRKVPLPRSLENTD------KKEEQSNYEINTKSIATTHDNYKLERLSIAVV 362
           EQ    V+++    P + +N+       ++EE  NYEI   +  T  D   + RLS+AV+
Sbjct: 328 EQQNVSVANQLPGAPPAQQNSGPQSQEARQEETVNYEIGRTTRNTLRDQPVVRRLSVAVL 387

Query: 363 VNK-GRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNS 421
           V+      E  G +  + +    +  I+ +V  A G N  RGD + + S+ F E    + 
Sbjct: 388 VDGVWEPGEAGGAARFRERTPQEMERISALVRGAIGFNETRGDRLEVVSLRFAEPVWGSD 447

Query: 422 GTVQ 425
           G  Q
Sbjct: 448 GESQ 451


>gi|114777411|ref|ZP_01452408.1| flagellar M-ring protein FliF [Mariprofundus ferrooxydans PV-1]
 gi|114552193|gb|EAU54695.1| flagellar M-ring protein FliF [Mariprofundus ferrooxydans PV-1]
          Length = 547

 Score =  173 bits (439), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 154/546 (28%), Positives = 264/546 (48%), Gaps = 60/546 (10%)

Query: 19  RTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISD 78
           R  + I AS++L     F+    + +   Y  +Y  +E  D   +   L + +I +R+ +
Sbjct: 43  RLMLFIAASLMLAG---FIGLVLWSSEKPYRAVYAGMEEKDAATVVEMLQKEHIPYRL-E 98

Query: 79  NGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGE 138
            G ++ VP   V + R+ LA QG+ +    SGYELFDK N FGL+ F ++I   RA++GE
Sbjct: 99  GGGTVMVPEDQVYEVRMKLAGQGI-NPRGTSGYELFDKSNEFGLSDFTRKINLQRAMQGE 157

Query: 139 IARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE---AIRHLV 195
           +ARTI+ +  + AARVH+V+P   +F     + TASVM++ ++ S   S     AI++LV
Sbjct: 158 LARTIEVMPQVSAARVHLVLPKESAFADRDRKATASVMLQ-LSGSQRLSKNTVLAIQNLV 216

Query: 196 AAAVPNLDMGDVTVLDSTGKLLTANEMER-NILGKSLSIVQA-IQHEIEMNINKALAAFL 253
           A++V  +++ DVTV+D++G LL+++E E  +  G++L   Q+ ++  +E  +   L   +
Sbjct: 217 ASSVAEMNVADVTVVDASGTLLSSSEKETPSSEGQTLQEYQSKLEQRLEQRLTGMLEQIV 276

Query: 254 GVDNFRSAVVAELN---MDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ----PESAV 306
           G       V A+++   +D Q  R   Y+PD +V RS +   ++  S +S     P  A 
Sbjct: 277 GEGQSVVRVSADIDREFIDQQSTR---YNPDEQVLRSRKSIVESHTSSSSGAMGVPGLAS 333

Query: 307 TVEQNMPHVSDRKVPLPRSLENTDKKEEQ-SNYEINTKSIATTHDNYKLERLSIAVVVNK 365
               + P  S++    P    NT K+ E  +NYEI++ S         +++LS+A +V  
Sbjct: 334 NTPGSNPATSNKTAAAPSQPGNTAKRNEDVNNYEISSTSEHRVVPFGNIKKLSVAAIVGG 393

Query: 366 GRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQ 425
              T+  G      +  + LAEI K+V +A G +  RGD++T+ SM  ++    +S    
Sbjct: 394 HMQTDAKGVQTFVPRSRAELAEIQKLVESAMGYDEDRGDSVTVQSMPLMD---ISSSADT 450

Query: 426 VSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHN--IDDAKKGEVGGKSILSPP 483
            +     +R F   + A  + +  L +  LG   LR L     D     +  GK    P 
Sbjct: 451 AALDKAEARVF--YMKAARYGIAALALMLLGWFVLRPLAKRIQDSTPHDQTAGK----PA 504

Query: 484 PISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFA 543
           P++            + L  S     ++   ++S                 IE+  ER  
Sbjct: 505 PVTP-----------LHLSDSTYKRLANMEQVRSS----------------IELQPERAT 537

Query: 544 KILRKW 549
           K+LR+W
Sbjct: 538 KVLREW 543


>gi|284159411|ref|YP_440758.3| flagellar MS-ring protein [Burkholderia thailandensis E264]
 gi|83653465|gb|ABC37528.1| flagellar M-ring protein FliF [Burkholderia thailandensis E264]
          Length = 677

 Score =  173 bits (439), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 118/391 (30%), Positives = 193/391 (49%), Gaps = 27/391 (6%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 161 WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 220

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++S++ + AARVH+ +P  
Sbjct: 221 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESVNAVRAARVHLAIPKP 278

Query: 162 GSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++      V    +  AI  LV+++VP++   +VT++D  G LLT 
Sbjct: 279 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAITRLVSSSVPDMPAKNVTIVDQDGNLLTQ 338

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 339 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYA 398

Query: 280 PDSKVERS-IRLSKDAQRSE----------------TSQPESAVTVEQNMPHVSDRKVPL 322
           P+   ++S IR  + +  +E                  QP SA  V  N    +    P+
Sbjct: 399 PNGTPQQSAIRSQQTSTSTELAQSGTSGVPGALSNTPPQPASAPIVASNGQPAAPAATPV 458

Query: 323 PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKID 382
                 +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q    
Sbjct: 459 ------SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLTA 512

Query: 383 SYLAEINKIVSAATGINSRRGDTITITSMDF 413
             LA++ ++V  A G + +RGD++ + +  F
Sbjct: 513 DKLAQVQQLVKDAMGYDEKRGDSVNVVNSAF 543


>gi|167717602|ref|ZP_02400838.1| flagellar MS-ring protein [Burkholderia pseudomallei DM98]
          Length = 476

 Score =  173 bits (439), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 117/391 (29%), Positives = 193/391 (49%), Gaps = 27/391 (6%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 44  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 103

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++SI+ + AARVH+ +P  
Sbjct: 104 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESINAVRAARVHLAIPKP 161

Query: 162 GSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++      V    +  A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 162 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 221

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 222 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYG 281

Query: 280 PDSKVERS-IRLSKDAQRSETS----------------QPESAVTVEQNMPHVSDRKVPL 322
           P+   ++S IR  + +  +E +                QP SA  V  N         P+
Sbjct: 282 PNGTPQQSAIRSQQTSSSTELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 341

Query: 323 PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKID 382
                 +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q    
Sbjct: 342 ------SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLAA 395

Query: 383 SYLAEINKIVSAATGINSRRGDTITITSMDF 413
             LA++ ++V  A G + +RGD++ + +  F
Sbjct: 396 DKLAQVQQLVKDAMGYDEKRGDSVNVVNSAF 426


>gi|291617848|ref|YP_003520590.1| FliF [Pantoea ananatis LMG 20103]
 gi|291152878|gb|ADD77462.1| FliF [Pantoea ananatis LMG 20103]
          Length = 572

 Score =  173 bits (439), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 150/557 (26%), Positives = 252/557 (45%), Gaps = 74/557 (13%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P+Y  L+  L   D   I   L++ N+ +R +DNG ++ VP   V + R+ LA Q
Sbjct: 47  LWAKTPNYSVLFSNLSNEDGGAIVTQLTQMNVPYRFADNGGALMVPEDKVHELRLRLAEQ 106

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP    N G+EL DK   FG++ F +++   RALEGE+ARTI+S+  +  ARVH+ MP 
Sbjct: 107 GLPKGG-NVGFELLDK-EKFGISQFSEQVNYQRALEGELARTIESLGPVKTARVHLAMPK 164

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++       +AI H+V+++V  L  G+VTV+D +G 
Sbjct: 165 PTLFVREQKAPSASVTLTLQPGRALDEG---QIQAITHMVSSSVAGLPPGNVTVVDQSGH 221

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT ++ + R++    L     ++   +  I   L   LG  N  + V A++N DT +  
Sbjct: 222 LLTRSDAVGRDLNDAQLKYAAEVEARYQQRIEAILNPILGQGNVHAQVTAQINFDTSEQT 281

Query: 275 EIVYDPDSKVERSIRLSKDAQRSETS--------------QPESAVTVEQNMPHVSDRKV 320
           +  Y P+   + +   S+    SE S              QP  A T   N P+ +    
Sbjct: 282 DEKYQPNGDPKNASIRSQQTSTSEQSGSPYPGGVPGALSNQPAPANTAPVNAPNTNAANG 341

Query: 321 PL-----------------PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVV 363
                                S+    ++++  NYE++     T  +   ++RLS+AVVV
Sbjct: 342 QNANGQNNAANGQRTSTASASSVPTNSRRDDTVNYELDRTIRHTKMNVGDVQRLSVAVVV 401

Query: 364 NKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           N         R  D+GK     +  L +I  +   A G + +RGD++ +       N  F
Sbjct: 402 NY--------REDDKGKALALNEQQLKQIEDLTREAMGYSQQRGDSVNVV------NSQF 447

Query: 420 NSGTVQVSFMDILSRH--FATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGK 477
           N+    VS +    +   F  +I+A  +L+   LV F+      R H +   +  E G +
Sbjct: 448 NTTEPTVSELPFWQQQSFFDQLISAGKWLL-VALVAFILYRKTVRPHVLRKKEAEESGCR 506

Query: 478 SILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEI 537
           S     P  +A  +G +         + Q      R   +R+++ V  Q   R+  M E 
Sbjct: 507 SDGC--PCCTAKRSGSLQR------PAQQREMEQERKTNNRMSAEVMSQ---RIRDMSEN 555

Query: 538 NEERFAKILRKWARSEI 554
           +    A ++R+W  +E+
Sbjct: 556 DPRVVALVIREWMGNEL 572


>gi|167892353|ref|ZP_02479755.1| flagellar MS-ring protein [Burkholderia pseudomallei 7894]
          Length = 495

 Score =  173 bits (439), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 117/391 (29%), Positives = 192/391 (49%), Gaps = 27/391 (6%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 58  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 117

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++SI+ + AARVH+ +P  
Sbjct: 118 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESINAVRAARVHLAIPKP 175

Query: 162 GSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++      V    +  A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 176 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 235

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 236 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYG 295

Query: 280 PDSKVERS-IRLSKDAQRSE----------------TSQPESAVTVEQNMPHVSDRKVPL 322
           P+   ++S IR  + +  +E                  QP SA  V  N         P+
Sbjct: 296 PNGTPQQSAIRSQQTSSSTELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 355

Query: 323 PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKID 382
                 +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q    
Sbjct: 356 ------SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLAA 409

Query: 383 SYLAEINKIVSAATGINSRRGDTITITSMDF 413
             LA++ ++V  A G + +RGD++ + +  F
Sbjct: 410 DKLAQVQQLVKDAMGYDEKRGDSVNVVNSAF 440


>gi|167917106|ref|ZP_02504197.1| flagellar MS-ring protein [Burkholderia pseudomallei BCC215]
          Length = 490

 Score =  173 bits (438), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 117/391 (29%), Positives = 192/391 (49%), Gaps = 27/391 (6%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 56  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 115

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++SI+ + AARVH+ +P  
Sbjct: 116 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESINAVRAARVHLAIPKP 173

Query: 162 GSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++      V    +  A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 174 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 233

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 234 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYG 293

Query: 280 PDSKVERS-IRLSKDAQRSE----------------TSQPESAVTVEQNMPHVSDRKVPL 322
           P+   ++S IR  + +  +E                  QP SA  V  N         P+
Sbjct: 294 PNGTPQQSAIRSQQTSSSTELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 353

Query: 323 PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKID 382
                 +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q    
Sbjct: 354 ------SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLAA 407

Query: 383 SYLAEINKIVSAATGINSRRGDTITITSMDF 413
             LA++ ++V  A G + +RGD++ + +  F
Sbjct: 408 DKLAQVQQLVKDAMGYDEKRGDSVNVVNSAF 438


>gi|167822258|ref|ZP_02453729.1| flagellar MS-ring protein [Burkholderia pseudomallei 9]
          Length = 488

 Score =  173 bits (438), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 117/391 (29%), Positives = 192/391 (49%), Gaps = 27/391 (6%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 54  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 113

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++SI+ + AARVH+ +P  
Sbjct: 114 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESINAVRAARVHLAIPKP 171

Query: 162 GSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++      V    +  A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 172 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 231

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 232 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYG 291

Query: 280 PDSKVERS-IRLSKDAQRSE----------------TSQPESAVTVEQNMPHVSDRKVPL 322
           P+   ++S IR  + +  +E                  QP SA  V  N         P+
Sbjct: 292 PNGTPQQSAIRSQQTSSSTELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 351

Query: 323 PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKID 382
                 +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q    
Sbjct: 352 ------SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLAA 405

Query: 383 SYLAEINKIVSAATGINSRRGDTITITSMDF 413
             LA++ ++V  A G + +RGD++ + +  F
Sbjct: 406 DKLAQVQQLVKDAMGYDEKRGDSVNVVNSAF 436


>gi|167909065|ref|ZP_02496156.1| flagellar MS-ring protein [Burkholderia pseudomallei 112]
          Length = 573

 Score =  173 bits (438), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 117/391 (29%), Positives = 192/391 (49%), Gaps = 27/391 (6%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 56  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 115

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++SI+ + AARVH+ +P  
Sbjct: 116 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESINAVRAARVHLAIPKP 173

Query: 162 GSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++      V    +  A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 174 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 233

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 234 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYG 293

Query: 280 PDSKVERS-IRLSKDAQRSE----------------TSQPESAVTVEQNMPHVSDRKVPL 322
           P+   ++S IR  + +  +E                  QP SA  V  N         P+
Sbjct: 294 PNGTPQQSAIRSQQTSSSTELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 353

Query: 323 PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKID 382
                 +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q    
Sbjct: 354 ------SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLAA 407

Query: 383 SYLAEINKIVSAATGINSRRGDTITITSMDF 413
             LA++ ++V  A G + +RGD++ + +  F
Sbjct: 408 DKLAQVQQLVKDAMGYDEKRGDSVNVVNSAF 438


>gi|78355400|ref|YP_386849.1| flagellar M-ring protein FliF [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78217805|gb|ABB37154.1| flagellar M-ring protein FliF [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 539

 Score =  173 bits (438), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 128/450 (28%), Positives = 236/450 (52%), Gaps = 19/450 (4%)

Query: 21  RILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNG 80
           R+ I+   ++V + +F    F++N P Y  LY KL   D NR+   L    + +R+ + G
Sbjct: 23  RVFIVGLTVVV-VGIFFGLIFWINQPDYRVLYSKLTPEDANRVVTVLQAQKVRYRLDNGG 81

Query: 81  SSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIA 140
           S+I VP+  V   R+ +A +G        G+E+FD++   G T F+Q+I   RAL+GE++
Sbjct: 82  STIMVPADRVYDMRLMVAGEG-SVVGQGVGFEIFDQIK-VGQTDFVQKINYQRALQGELS 139

Query: 141 RTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVY--KSAEAIRHLVAAA 198
           RTI     + +ARVH+V+P    F +   +P+ASV+++  +      K  +A+ +LV  +
Sbjct: 140 RTIAEFPAVESARVHLVIPHRSLFIEEQMQPSASVVLKLQDGKKMDEKDVQAVVNLVTMS 199

Query: 199 VPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQ---AIQHEIEMNINKALAAFLGV 255
           V  LD G ++V D++GK+L   + E+++ G + + ++    +Q   E  I + L   +G 
Sbjct: 200 VEGLDQGKISVADTSGKILYYPKDEQSLDGMTSTQLEHKLTMQQNFERRIEELLYPVIGP 259

Query: 256 DNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHV 315
               + V A+L+   + IR+ ++DP+S V RS   +++A++  ++       V   +P  
Sbjct: 260 GKVIAKVNADLDFSQKTIRKKLFDPESSVVRSEIRTEEARKGTSN-------VNAGVPEA 312

Query: 316 SDRKVPLP--RSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG-RLTEVL 372
           + R   +    S E+++++   +NYEIN +         +L+RLS+AV+V+      E  
Sbjct: 313 NFRGDGMSGGTSTEDSNRETRNTNYEINEEEQNIIAPVGQLDRLSVAVIVDGTYEKNEET 372

Query: 373 GRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDIL 432
           G      + D  +A I ++V++A G +  RGD + ++S+ F   +     ++    MD  
Sbjct: 373 GEWTYVPRSDEEVARIRQLVASAVGFDRARGDVLEVSSISFGGPEADTYMSLAEVIMDYA 432

Query: 433 SRHFATVINA-LVFLVGTLLVTFLGLHALR 461
            R    ++NA LVFL   ++V  + L  +R
Sbjct: 433 LRLGKPLLNALLVFLFLVMVVRPVVLALIR 462


>gi|126441455|ref|YP_001057275.1| flagellar MS-ring protein [Burkholderia pseudomallei 668]
 gi|217425051|ref|ZP_03456547.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 576]
 gi|254295774|ref|ZP_04963231.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 406e]
 gi|126220948|gb|ABN84454.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 668]
 gi|157805913|gb|EDO83083.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 406e]
 gi|217392071|gb|EEC32097.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 576]
          Length = 598

 Score =  173 bits (438), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 117/391 (29%), Positives = 192/391 (49%), Gaps = 27/391 (6%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 81  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 140

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++SI+ + AARVH+ +P  
Sbjct: 141 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESINAVRAARVHLAIPKP 198

Query: 162 GSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++      V    +  A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 199 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 258

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 259 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYG 318

Query: 280 PDSKVERS-IRLSKDAQRSE----------------TSQPESAVTVEQNMPHVSDRKVPL 322
           P+   ++S IR  + +  +E                  QP SA  V  N         P+
Sbjct: 319 PNGTPQQSAIRSQQTSSSTELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 378

Query: 323 PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKID 382
                 +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q    
Sbjct: 379 ------SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLAA 432

Query: 383 SYLAEINKIVSAATGINSRRGDTITITSMDF 413
             LA++ ++V  A G + +RGD++ + +  F
Sbjct: 433 DKLAQVQQLVKDAMGYDEKRGDSVNVVNSAF 463


>gi|53717872|ref|YP_106858.1| flagellar MS-ring protein [Burkholderia pseudomallei K96243]
 gi|126453288|ref|YP_001064517.1| flagellar MS-ring protein [Burkholderia pseudomallei 1106a]
 gi|134283661|ref|ZP_01770360.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 305]
 gi|162210024|ref|YP_331831.2| flagellar MS-ring protein [Burkholderia pseudomallei 1710b]
 gi|226199798|ref|ZP_03795349.1| flagellar M-ring protein FliF [Burkholderia pseudomallei Pakistan
           9]
 gi|242317746|ref|ZP_04816762.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 1106b]
 gi|254182183|ref|ZP_04888780.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 1655]
 gi|254188113|ref|ZP_04894625.1| flagellar M-ring protein FliF [Burkholderia pseudomallei Pasteur
           52237]
 gi|254196619|ref|ZP_04903043.1| flagellar M-ring protein FliF [Burkholderia pseudomallei S13]
 gi|254259466|ref|ZP_04950520.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 1710a]
 gi|52208286|emb|CAH34218.1| flagellar M-ring protein [Burkholderia pseudomallei K96243]
 gi|126226930|gb|ABN90470.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 1106a]
 gi|134245070|gb|EBA45165.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 305]
 gi|157935793|gb|EDO91463.1| flagellar M-ring protein FliF [Burkholderia pseudomallei Pasteur
           52237]
 gi|169653362|gb|EDS86055.1| flagellar M-ring protein FliF [Burkholderia pseudomallei S13]
 gi|184212721|gb|EDU09764.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 1655]
 gi|225928149|gb|EEH24185.1| flagellar M-ring protein FliF [Burkholderia pseudomallei Pakistan
           9]
 gi|242140985|gb|EES27387.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 1106b]
 gi|254218155|gb|EET07539.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 1710a]
          Length = 598

 Score =  173 bits (438), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 117/391 (29%), Positives = 192/391 (49%), Gaps = 27/391 (6%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 81  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 140

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++SI+ + AARVH+ +P  
Sbjct: 141 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESINAVRAARVHLAIPKP 198

Query: 162 GSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++      V    +  A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 199 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 258

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 259 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYG 318

Query: 280 PDSKVERS-IRLSKDAQRSE----------------TSQPESAVTVEQNMPHVSDRKVPL 322
           P+   ++S IR  + +  +E                  QP SA  V  N         P+
Sbjct: 319 PNGTPQQSAIRSQQTSSSTELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 378

Query: 323 PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKID 382
                 +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q    
Sbjct: 379 ------SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLAA 432

Query: 383 SYLAEINKIVSAATGINSRRGDTITITSMDF 413
             LA++ ++V  A G + +RGD++ + +  F
Sbjct: 433 DKLAQVQQLVKDAMGYDEKRGDSVNVVNSAF 463


>gi|237810412|ref|YP_002894863.1| flagellar M-ring protein FliF [Burkholderia pseudomallei MSHR346]
 gi|237505247|gb|ACQ97565.1| flagellar M-ring protein FliF [Burkholderia pseudomallei MSHR346]
          Length = 598

 Score =  173 bits (438), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 117/391 (29%), Positives = 192/391 (49%), Gaps = 27/391 (6%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 81  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 140

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++SI+ + AARVH+ +P  
Sbjct: 141 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESINAVRAARVHLAIPKP 198

Query: 162 GSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++      V    +  A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 199 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 258

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 259 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYG 318

Query: 280 PDSKVERS-IRLSKDAQRSE----------------TSQPESAVTVEQNMPHVSDRKVPL 322
           P+   ++S IR  + +  +E                  QP SA  V  N         P+
Sbjct: 319 PNGTPQQSAIRSQQTSSSTELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 378

Query: 323 PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKID 382
                 +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q    
Sbjct: 379 ------SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLAA 432

Query: 383 SYLAEINKIVSAATGINSRRGDTITITSMDF 413
             LA++ ++V  A G + +RGD++ + +  F
Sbjct: 433 DKLAQVQQLVKDAMGYDEKRGDSVNVVNSAF 463


>gi|167813742|ref|ZP_02445422.1| flagellar MS-ring protein [Burkholderia pseudomallei 91]
          Length = 559

 Score =  173 bits (438), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 117/391 (29%), Positives = 192/391 (49%), Gaps = 27/391 (6%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 42  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 101

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++SI+ + AARVH+ +P  
Sbjct: 102 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESINAVRAARVHLAIPKP 159

Query: 162 GSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++      V    +  A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 160 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 219

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 220 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYG 279

Query: 280 PDSKVERS-IRLSKDAQRSE----------------TSQPESAVTVEQNMPHVSDRKVPL 322
           P+   ++S IR  + +  +E                  QP SA  V  N         P+
Sbjct: 280 PNGTPQQSAIRSQQTSSSTELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 339

Query: 323 PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKID 382
                 +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q    
Sbjct: 340 ------SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLAA 393

Query: 383 SYLAEINKIVSAATGINSRRGDTITITSMDF 413
             LA++ ++V  A G + +RGD++ + +  F
Sbjct: 394 DKLAQVQQLVKDAMGYDEKRGDSVNVVNSAF 424


>gi|76581502|gb|ABA50977.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 1710b]
          Length = 627

 Score =  173 bits (438), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 117/391 (29%), Positives = 192/391 (49%), Gaps = 27/391 (6%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 110 WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 169

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++SI+ + AARVH+ +P  
Sbjct: 170 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESINAVRAARVHLAIPKP 227

Query: 162 GSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++      V    +  A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 228 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 287

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 288 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYG 347

Query: 280 PDSKVERS-IRLSKDAQRSE----------------TSQPESAVTVEQNMPHVSDRKVPL 322
           P+   ++S IR  + +  +E                  QP SA  V  N         P+
Sbjct: 348 PNGTPQQSAIRSQQTSSSTELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 407

Query: 323 PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKID 382
                 +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q    
Sbjct: 408 ------SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLAA 461

Query: 383 SYLAEINKIVSAATGINSRRGDTITITSMDF 413
             LA++ ++V  A G + +RGD++ + +  F
Sbjct: 462 DKLAQVQQLVKDAMGYDEKRGDSVNVVNSAF 492


>gi|167900849|ref|ZP_02488054.1| flagellar MS-ring protein [Burkholderia pseudomallei NCTC 13177]
          Length = 500

 Score =  173 bits (438), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 117/391 (29%), Positives = 192/391 (49%), Gaps = 27/391 (6%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 56  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 115

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++SI+ + AARVH+ +P  
Sbjct: 116 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESINAVRAARVHLAIPKP 173

Query: 162 GSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++      V    +  A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 174 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 233

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 234 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYG 293

Query: 280 PDSKVERS-IRLSKDAQRSE----------------TSQPESAVTVEQNMPHVSDRKVPL 322
           P+   ++S IR  + +  +E                  QP SA  V  N         P+
Sbjct: 294 PNGTPQQSAIRSQQTSSSTELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 353

Query: 323 PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKID 382
                 +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q    
Sbjct: 354 ------SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLAA 407

Query: 383 SYLAEINKIVSAATGINSRRGDTITITSMDF 413
             LA++ ++V  A G + +RGD++ + +  F
Sbjct: 408 DKLAQVQQLVKDAMGYDEKRGDSVNVVNSAF 438


>gi|167843852|ref|ZP_02469360.1| flagellar MS-ring protein [Burkholderia pseudomallei B7210]
          Length = 565

 Score =  172 bits (437), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 117/391 (29%), Positives = 192/391 (49%), Gaps = 27/391 (6%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 48  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 107

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++SI+ + AARVH+ +P  
Sbjct: 108 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESINAVRAARVHLAIPKP 165

Query: 162 GSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++      V    +  A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 166 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 225

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 226 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYG 285

Query: 280 PDSKVERS-IRLSKDAQRSE----------------TSQPESAVTVEQNMPHVSDRKVPL 322
           P+   ++S IR  + +  +E                  QP SA  V  N         P+
Sbjct: 286 PNGTPQQSAIRSQQTSSSTELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 345

Query: 323 PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKID 382
                 +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q    
Sbjct: 346 ------SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLAA 399

Query: 383 SYLAEINKIVSAATGINSRRGDTITITSMDF 413
             LA++ ++V  A G + +RGD++ + +  F
Sbjct: 400 DKLAQVQQLVKDAMGYDEKRGDSVNVVNSAF 430


>gi|167736645|ref|ZP_02409419.1| flagellar MS-ring protein [Burkholderia pseudomallei 14]
          Length = 465

 Score =  172 bits (437), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 117/391 (29%), Positives = 192/391 (49%), Gaps = 27/391 (6%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 53  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 112

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++SI+ + AARVH+ +P  
Sbjct: 113 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESINAVRAARVHLAIPKP 170

Query: 162 GSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++      V    +  A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 171 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 230

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 231 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYG 290

Query: 280 PDSKVERS-IRLSKDAQRSE----------------TSQPESAVTVEQNMPHVSDRKVPL 322
           P+   ++S IR  + +  +E                  QP SA  V  N         P+
Sbjct: 291 PNGTPQQSAIRSQQTSSSTELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 350

Query: 323 PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKID 382
                 +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q    
Sbjct: 351 ------SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLAA 404

Query: 383 SYLAEINKIVSAATGINSRRGDTITITSMDF 413
             LA++ ++V  A G + +RGD++ + +  F
Sbjct: 405 DKLAQVQQLVKDAMGYDEKRGDSVNVVNSAF 435


>gi|307944136|ref|ZP_07659477.1| flagellar M-ring protein FliF [Roseibium sp. TrichSKD4]
 gi|307772482|gb|EFO31702.1| flagellar M-ring protein FliF [Roseibium sp. TrichSKD4]
          Length = 537

 Score =  172 bits (437), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 134/417 (32%), Positives = 218/417 (52%), Gaps = 18/417 (4%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVI--LVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
           ++ L++F K+   LG TR+  + +V   LV I  F+  R  V +P    LY  L + D  
Sbjct: 1   MNGLIEFIKT---LGPTRVAAMGAVAAMLVGIFAFIILR--VTAPQMTTLYSDLTLEDSG 55

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
            I   L    + + +  NG+++ VP   V + R+ LA  GLP+  S  GYE+FD+ ++ G
Sbjct: 56  AIVSRLEGMGVPYELGRNGATVMVPRERVARLRMQLAEDGLPTGGS-IGYEIFDRSDTLG 114

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
            TSF+Q I  +RALEGE+AR+I +I  I +ARVH+V+P+   F++    PT S+++    
Sbjct: 115 ATSFVQNINHLRALEGELARSIAAIDRIQSARVHLVIPERQLFQRDQRAPTGSIVLNVRG 174

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT--ANEMERNILGKSL-SIVQAIQ 238
                   A++HLVA AV  L    V+V+D TG+LL   A   E  I+G SL   V AI+
Sbjct: 175 TLGQGEIRAVQHLVATAVEGLRPESVSVVDETGRLLASGAESDEEGIIGNSLQERVFAIE 234

Query: 239 HEIEMNINKALAAFLGVDNFRSAVVAEL--NMDTQQIREIVYDPDSKVERSIRLSKDAQR 296
             ++  + + L++ +G    R  V A++  N  T+ I    +DP+ +V RS +  ++A  
Sbjct: 235 SRLKGQVEEILSSVVGPGRSRVRVAADVDFNRTTETIE--TFDPEGQVVRSTQTKEEA-- 290

Query: 297 SETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLER 356
           S +++  + VTV   +P+  D       S E T   EE  NYEI+  +     +  +++R
Sbjct: 291 SSSTERTNEVTVGNELPNGGDNNG-GEGSNEETTATEEIVNYEISRSTKTEIVEAGRVQR 349

Query: 357 LSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           LS+AV+V+        G      +    L  I  +V +A G +  RGD + + ++ F
Sbjct: 350 LSVAVLVDGTYGPNADGEVVYTPRTQETLDRIALLVRSAVGFDEGRGDIVEVVNLQF 406


>gi|134297240|ref|YP_001120975.1| flagellar MS-ring protein [Burkholderia vietnamiensis G4]
 gi|134140397|gb|ABO56140.1| flagellar M-ring protein FliF [Burkholderia vietnamiensis G4]
          Length = 587

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 117/390 (30%), Positives = 194/390 (49%), Gaps = 24/390 (6%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VPS+ V + R+ LAA 
Sbjct: 79  LWSRTPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPSNQVHETRLKLAAM 138

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   S  G+EL D    FG++ F +++   RALEGE+ RTI+SI+ +  ARVH+ +P 
Sbjct: 139 GLPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTIESINAVRGARVHLAIPK 196

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSA--EAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV I      V      +AI  +V++ VP++   +VT++D  G LLT
Sbjct: 197 PSVFVRDKEAPSASVFIDLYPGRVLDEGQVQAITRMVSSGVPDMPAKNVTIVDQDGNLLT 256

Query: 219 ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
                  +    L  VQ ++   +  I+  LA   G  N RS V A+++    +     Y
Sbjct: 257 QPASASGLDASQLKYVQQVERNTQKRIDSILAPIFGTGNARSQVSADIDFSKLEQTSESY 316

Query: 279 DPDSKVER-SIRLSKDAQRSETSQ--------------PESAVTVEQNMPHVSDRKVPLP 323
            P+   ++ +IR  + +  +E +Q              P+ A     + P V+      P
Sbjct: 317 GPNGTPQQAAIRSQQTSSATELAQGGASGVPGALSNTPPQPA-----SAPIVAGNGQSGP 371

Query: 324 RSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDS 383
           +S   +D+K++ +NYE++            ++RLS+AVVVN   + +  G    Q    +
Sbjct: 372 QSTPVSDRKDQTTNYELDKTIRHVEQPMGNVKRLSVAVVVNYQPVADAKGHVTMQPLPPA 431

Query: 384 YLAEINKIVSAATGINSRRGDTITITSMDF 413
            LA+I ++V  A G + +RGD++ + +  F
Sbjct: 432 KLAQIEQLVKDAMGYDEKRGDSVNVVNSAF 461


>gi|254251157|ref|ZP_04944475.1| Flagellar biosynthesis/type III secretory pathway lipoprotein
           [Burkholderia dolosa AUO158]
 gi|124893766|gb|EAY67646.1| Flagellar biosynthesis/type III secretory pathway lipoprotein
           [Burkholderia dolosa AUO158]
          Length = 588

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 117/390 (30%), Positives = 194/390 (49%), Gaps = 24/390 (6%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VPSS V + R+ LAA 
Sbjct: 79  LWSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPSSQVHETRLKLAAM 138

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   S  G+EL D    FG++ F ++I   RALEGE+ RTI+SI+ +  ARVH+ +P 
Sbjct: 139 GLPKGGS-VGFELMDN-QKFGISQFAEQINYQRALEGELQRTIESINAVRGARVHLAIPK 196

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSA--EAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV +      V      +AI  +V++ VP++   +VT++D  G LLT
Sbjct: 197 PSVFVRDKEAPSASVFVDLYPGRVLDEGQVQAITRMVSSGVPDMPAKNVTIVDQDGNLLT 256

Query: 219 ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
                  +    L  VQ ++   +  I+  LA   G  N RS V A+++    +     Y
Sbjct: 257 QTASATGLDASQLKYVQQVERNTQKRIDAILAPIFGAGNARSQVSADIDFSKLEQTSESY 316

Query: 279 DPDSKVER-SIRLSKDAQRSETSQ--------------PESAVTVEQNMPHVSDRKVPLP 323
            P+   ++ +IR  + +  +E +Q              P+ A     + P V+      P
Sbjct: 317 APNGTPQQAAIRSQQTSTSTELAQSGASGVPGALSNTPPQPA-----SAPIVAGNGQNGP 371

Query: 324 RSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDS 383
           ++   +D+K++ +NYE++            ++RLS+AVVVN   + +  G    Q    +
Sbjct: 372 QTTPVSDRKDQTTNYELDKTIRHVEQPMGSVKRLSVAVVVNYQPVADAKGHVTMQPLPPA 431

Query: 384 YLAEINKIVSAATGINSRRGDTITITSMDF 413
            LA+I ++V  A G + +RGD++ + +  F
Sbjct: 432 KLAQIEQLVKDAMGYDQKRGDSVNVVNSAF 461


>gi|237653561|ref|YP_002889875.1| flagellar MS-ring protein [Thauera sp. MZ1T]
 gi|237624808|gb|ACR01498.1| flagellar M-ring protein FliF [Thauera sp. MZ1T]
          Length = 571

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 133/449 (29%), Positives = 213/449 (47%), Gaps = 44/449 (9%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L+  D  +I   L + NI +R+S  G +I VP + V + R+ LAA 
Sbjct: 59  LWNRAPEYAVLFSNLDERDGGQIIAELQQRNIPYRMSPTGHAILVPQAQVHETRLRLAAD 118

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP  S  +G+EL D     G++ F +++   RALEGE+ RT+Q+I  + +ARVH+ MP 
Sbjct: 119 GLPKGSL-AGFELMDG-QKLGISQFNEQVNYQRALEGELTRTVQAIDAVASARVHLAMPK 176

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
             +F +   RPTASVM+     R ++P        I HLV+++VP +    V ++D  GK
Sbjct: 177 QTAFLRDDQRPTASVMVNLRGGRILSPD---QVAGIVHLVSSSVPRMHAEGVKIVDQNGK 233

Query: 216 LLT--ANEMERNIL-GKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQ 272
           LLT  A+ + R  L    L  V+ ++      I+K LA  +G  N+ + V A+++ +  +
Sbjct: 234 LLTEQADPLLRAGLDATQLEYVRLLEQGFIERIDKILAPLVGKGNYGAQVAADVDFNQVE 293

Query: 273 IREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKK 332
                Y P+   +++IR     Q SE   P+      Q +P     + P+P +   T+ +
Sbjct: 294 QTAETYKPNPTPDQAIR---SQQTSEAFNPQPGA---QGVPGALTNQPPVPATAPITNPQ 347

Query: 333 EEQS---------------NYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSAD 377
                              NYE++           +++RLS+AVVVN   L    G   +
Sbjct: 348 VAGGGGAQGLASGNRSAVLNYELDRNIQHVKQAVGQIKRLSVAVVVNNRTLPGPDGTPTN 407

Query: 378 QGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMD----ILS 433
               D  +A I  +V  A G N+ RGDTI + S  F ++    SG     + D     L 
Sbjct: 408 VPLPDEEIARITNLVREAVGYNADRGDTINVASGAFADD---GSGAAPPPWKDPEIVALG 464

Query: 434 RHFATVINALVFLVGTLLVTFLGLHALRR 462
           +     +N L+ L+  L   F  +  L R
Sbjct: 465 KEG---LNWLLVLIAILFAYFGVIRPLLR 490


>gi|327399353|ref|YP_004340222.1| flagellar M-ring protein FliF [Hippea maritima DSM 10411]
 gi|327181982|gb|AEA34163.1| flagellar M-ring protein FliF [Hippea maritima DSM 10411]
          Length = 550

 Score =  172 bits (435), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 135/438 (30%), Positives = 224/438 (51%), Gaps = 43/438 (9%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASV-ILVPIMLFM--AARFFVNSPHYDNLYVKLEVSDV 60
           L+Q+ +F+   T   + RI++ +SV +LV  +LF+  A+     +P + NL  K    D 
Sbjct: 7   LEQVKKFY--NTMNRQQRIILFSSVGVLVAGILFILIASSKVAYAPLFTNLNAK----DA 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           + I   L++  + +++ + G+ I VP  MV   R+ L A GLP      G+E+FDK N F
Sbjct: 61  SDIVTYLNQHGVKYKLINGGTVIEVPKDMVYSLRLDLVAAGLPKHGV-VGFEIFDKQN-F 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
             T+F++ I  +RALEGE+ RTI +I+ I +A+V+I +P    F +    PTAS+++   
Sbjct: 119 STTNFVENINYIRALEGELTRTIANINEIKSAKVNIAIPKPTIFTESQQPPTASIVLDLY 178

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL-GKSLSIVQAIQH 239
            P   +   AI+ LVA+AVP L   DVT++DS G LL+ N  +  +L    L   Q I+ 
Sbjct: 179 KPLTRQQIVAIQKLVASAVPGLSYKDVTIVDSDGNLLSVNIPDEQLLTANELKYKQFIEQ 238

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
             +  I   LA  LG D F  +V  EL++   + + ++YDP+S V     +S++ + S +
Sbjct: 239 RYKSRIKSMLAPILGKDKFVVSVDVELDLSKIKKKSVIYDPNSVV-----VSEENEESTS 293

Query: 300 SQPESAVTVEQNMPHV-----SDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKL 354
           + P S       +P V     +            + K +  +NY++      T     K+
Sbjct: 294 TTPTSG-----GVPGVISNIDNKTNAAAASGTAKSSKSKTITNYDVGRTETITEGPLIKI 348

Query: 355 ERLSIAVVVN---------KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDT 405
           +++S AVVV+         KG++     +S  Q  I +    I + V +A G +++RGD 
Sbjct: 349 KKISAAVVVDGIYEPVKNKKGKVVSYKFKSLPQNTIST----IQQAVMSAIGYDNKRGDK 404

Query: 406 ITITSMDFL---ENQLFN 420
           +T+T M F    E Q+ N
Sbjct: 405 VTVTCMKFAMSGEKQMGN 422


>gi|18182538|gb|AAL65160.1|AF453480_2 flagellar MS ring protein [Burkholderia cepacia]
          Length = 587

 Score =  172 bits (435), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 115/385 (29%), Positives = 191/385 (49%), Gaps = 14/385 (3%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VPS+ V + R+ LAA 
Sbjct: 78  LWSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPSNQVHETRLKLAAM 137

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   S  G+EL D    FG++ F ++I   RALEGE+ RTI+SI+ +  ARVH+ +P 
Sbjct: 138 GLPKGGS-VGFELMDN-QKFGISQFAEQINYQRALEGELQRTIESINAVRGARVHLAIPK 195

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSA--EAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV +      V      +AI  +V++ VP++   +VT++D  G LLT
Sbjct: 196 PSVFVRDKEAPSASVFVDLYPGRVLDEGQVQAITRMVSSGVPDMPAKNVTIVDQDGNLLT 255

Query: 219 ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
                  +    L  VQ ++H  +  I+  LA   G  N RS V A+L+    +     Y
Sbjct: 256 QTASASGLDASQLKYVQQVEHNTQKRIDAILAPIFGAGNARSQVSADLDFSKIEQTSESY 315

Query: 279 DPDSKVER-SIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPL---------PRSLEN 328
            P+   ++ +IR  + +  +E +Q        +       R             P++   
Sbjct: 316 GPNGTPQQAAIRSQQTSSATELAQAARRACRARCRTRRRSRPPRRSSPGNGQNAPQTTPV 375

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEI 388
           +D+K++ +NYE++     T      ++RLS+AVVVN   + +  G    Q    + LA++
Sbjct: 376 SDRKDQTTNYELDKTIRHTEQPMGSVKRLSVAVVVNYQPVADAKGHVTMQPLPPAKLAQV 435

Query: 389 NKIVSAATGINSRRGDTITITSMDF 413
            ++V  A G + +RGD++ + +  F
Sbjct: 436 EQLVKDAMGYDEKRGDSVNVVNSAF 460


>gi|222053602|ref|YP_002535964.1| flagellar M-ring protein FliF [Geobacter sp. FRC-32]
 gi|221562891|gb|ACM18863.1| flagellar M-ring protein FliF [Geobacter sp. FRC-32]
          Length = 522

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 139/475 (29%), Positives = 233/475 (49%), Gaps = 34/475 (7%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           L +LL  F    SL  ++ LI+A V    ++ F A  F  N   Y  L+  L   D   I
Sbjct: 5   LKKLLDPF---LSLPTSKRLIVAGVAACSLLAFAALIFVANRTDYRPLFANLTTEDAGEI 61

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
              L +  + ++IS +G +I VPS  V + R+ LA +GLP      G+E+FD+ N FG+T
Sbjct: 62  VKKLKDQKVAYQISADGKAILVPSDKVYELRLSLAGEGLPQGG-GIGFEIFDRKN-FGMT 119

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS 183
            F+Q++   RAL+GE++RTI  ++G+  ARVH+V+P+   F+     PTASV+++  +  
Sbjct: 120 EFVQKLNYQRALQGELSRTIAQLAGVEQARVHLVIPEKSLFKDSEKPPTASVVLKMKSNR 179

Query: 184 VYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEI 241
             +  E   + HLV++A+  +D  +VTVLDS GK+L+      +  GK  S +Q  Q   
Sbjct: 180 TLRENEVQGVVHLVSSAIEGMDTENVTVLDSRGKVLSRT-GPSDATGKLTSTMQETQRNY 238

Query: 242 EMNINKALAAFLG--VDNFRSAVVAELNMDTQQIR--EIVYDPDSKVERSIRLSKDAQRS 297
           E N+ + L + L   V + RS        D +Q+   E  YDP++   RS       QRS
Sbjct: 239 EKNLEERLQSLLDKVVGSGRSVARVSATFDFKQVEKYEEKYDPETAAVRS------EQRS 292

Query: 298 ETSQPESAVTVEQNMPHVS---DRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKL 354
           E  +   A  +   +P V     R  P   +     K +E  NYE++  +         L
Sbjct: 293 E--EKAGATNIAAGVPGVQTNMGRTAPGAGTTGGGSKSDETLNYEVSRTTARIIEPVGSL 350

Query: 355 ERLSIAVVVNKGRLTEVLGRSAD------QGKIDSYLAEINKIVSAATGINSRRGDTITI 408
            ++S+A++V+ G+        A       Q +    L +I  +V ++ G N+ RGD +T+
Sbjct: 351 TKVSVAILVD-GKYEAPAAAKAGAAKAKYQPRTPDELQKIESLVKSSVGFNAERGDQVTV 409

Query: 409 TSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL 463
            ++ F E    + G+ + ++ +  +    T++  L+   G   + F  +  L R+
Sbjct: 410 ANIPFQETG--DMGSAEDAWWN--APIVMTLLKNLLIAGGFFAIIFFVIKPLMRM 460


>gi|170751440|ref|YP_001757700.1| flagellar MS-ring protein [Methylobacterium radiotolerans JCM 2831]
 gi|170657962|gb|ACB27017.1| flagellar M-ring protein FliF [Methylobacterium radiotolerans JCM
           2831]
          Length = 525

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 145/542 (26%), Positives = 255/542 (47%), Gaps = 30/542 (5%)

Query: 25  LASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRI-SDNGSSI 83
           +A+V L  I  F      V+ P    L+  L + D   +   L    I +    D G +I
Sbjct: 1   MAAVTLTLIGFFAFIILRVSRPDMGVLFSDLSMQDSASVVRELDSRGIRYETRGDAGQTI 60

Query: 84  SVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTI 143
             P   + K R+ LA +GLP+     GYE+FDK ++F  T+F+Q +  +RALEGE+AR+I
Sbjct: 61  LAPRPDLAKLRMDLAGKGLPTQG-GVGYEIFDKGDAFSSTNFVQNVNHLRALEGELARSI 119

Query: 144 QSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLD 203
           ++I  + AARVH+V+P+   F +    P+A+++++ +         AIRHLVA+AV  L 
Sbjct: 120 RAIGRVQAARVHLVLPERRLFERDRESPSAAIVLKLMGDLDAGQVRAIRHLVASAVEGLK 179

Query: 204 MGDVTVLDSTGKLLT--ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSA 261
              ++++D  G+LL   A +   ++         A++  +   I   +A  +G    R  
Sbjct: 180 PERISIVDERGRLLADGARDAATDVASGFEDRQVALERRLRGQIEDVVAGIVGPGRARVQ 239

Query: 262 VVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHV-SDRKV 320
           V AEL+++  + R   +DP+S+V RS +   ++  + T   E  V+V   +P      K 
Sbjct: 240 VNAELDLNRVESRSETFDPESRVVRSAQTRTES--AVTGNAEGQVSVGNELPGANGGDKA 297

Query: 321 PLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGK 380
           P P+  + T+K EE +NYEI+  +     +  +++RLS+AVV++        G+     +
Sbjct: 298 PTPK--DATNKNEETTNYEISRVTKTEIAEGGRIKRLSVAVVLDGVYAAAPDGKQTYSPR 355

Query: 381 IDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVI 440
             + +  I  +V  A G +  RGD I + ++ F E       T       +L+     V+
Sbjct: 356 TPAEIERITALVRGAVGFDKARGDQIEVVNLRFAEAPSVPQFTEPTLIESLLAPTKDDVL 415

Query: 441 NALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVT-TGL-MPNDN 498
                 V  LL   + L  +R L             + +L+P P + A+T +GL +P D 
Sbjct: 416 RMAELAVLALLTLIVLLTVVRPLV------------RQVLAPVPEAPALTASGLAIPGDA 463

Query: 499 IALDSSNQDIFSHSRNLQS-------RINSYVSKQSDLRLLHMIEINEERFAKILRKWAR 551
             +      +    R+  +       +IN  V  ++  R++ M+  +     ++LR W +
Sbjct: 464 AVVAGPGGTVTVIDRDSPTARLMEFAKINGQVQAETVQRVVDMVRASPSETVEVLRTWIQ 523

Query: 552 SE 553
            E
Sbjct: 524 EE 525


>gi|329849956|ref|ZP_08264802.1| flagellar M-ring protein FliF [Asticcacaulis biprosthecum C19]
 gi|328841867|gb|EGF91437.1| flagellar M-ring protein FliF [Asticcacaulis biprosthecum C19]
          Length = 554

 Score =  171 bits (434), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 155/531 (29%), Positives = 248/531 (46%), Gaps = 57/531 (10%)

Query: 51  LYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSG 110
           LY  L++ + + I+ ALS+  I +    +GS+I V    V +AR+ LA++GLP+ +S  G
Sbjct: 45  LYSNLDLKEASEITTALSQGGIKYEAKGDGSTIMVNRDQVAEARMMLASKGLPTQAS-VG 103

Query: 111 YELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGAR 170
           YE+FD   + G T  +Q I   RALEGE+ARTI+++ GI +ARVH+VMP    F     +
Sbjct: 104 YEIFDDAPALGQTEAVQNINNQRALEGELARTIRTLRGISSARVHLVMPKRELFEDAAGQ 163

Query: 171 PTASVMIRAINPSVYKSAE-AIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGK 229
           PTASV++     S+   +  AIR++VA AVPNL   +VT++D    LL A     + +G 
Sbjct: 164 PTASVVLGLSGGSLSSESVAAIRNVVATAVPNLKADNVTIVDDRNHLLAAGGDSDSAMGV 223

Query: 230 SLSIVQAIQHEIEMNINKA----LAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVE 285
           + S   A + EIE ++ K     +   +G    R  V AE++       ++ Y+PD +V 
Sbjct: 224 AGS---ARKSEIEDSVRKRVMEIVEGVVGPGAARVMVTAEIDQTATTREQVEYNPDGQVV 280

Query: 286 RSIRLSKDAQRSETSQPESA--VTVEQNMPHVSDRKVP-LPRSLENTDKKEEQSNYEINT 342
           RS   S ++    T+ P SA   T   N+P    ++ P L  S  ++ +  E +N+EI+T
Sbjct: 281 RST--STNSGTETTADPNSAGQTTATANIPGT--QQAPNLSTSGNSSQQDSEVTNFEIST 336

Query: 343 KSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSY-------LAEINKIVSAA 395
                     ++++L++AVVV+      V   SAD     +Y       +  I ++V AA
Sbjct: 337 TKTTEVKAPGEIKKLAVAVVVDG-----VETPSADGKAPPAYAPRSAEDMQRIQELVQAA 391

Query: 396 TGINSRRGDTITITSMDFLENQLFNSGT-VQVSFMDILSRHFATVINALVFLVGTLLVTF 454
            G +  RGD + ++++ F     F +GT  +    D         I   V  +  LLV F
Sbjct: 392 VGYDQTRGDQVRVSNIRFSRGD-FAAGTDAKPPLFDFDKNDIMRAIEVAVLFIVALLVIF 450

Query: 455 LGLHALRR------------LHNIDDAKKGEVGGKSILSPPPISSA----VTTGLMPNDN 498
           L    L +            L   +   +  + G ++  P     A      TGL+P   
Sbjct: 451 LIARPLLKFINGGGAAGGNFLGTANGGSQAALAGAAVTGPSISYQAADNIAATGLVPTQE 510

Query: 499 IALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKW 549
                         R   +RI   V   S  ++   ++ + E    ILR W
Sbjct: 511 -----------QEQRIDIARIEGQVKASSVKKVSEFVDRHPEESVSILRSW 550


>gi|220932525|ref|YP_002509433.1| flagellar M-ring protein FliF [Halothermothrix orenii H 168]
 gi|219993835|gb|ACL70438.1| flagellar M-ring protein FliF [Halothermothrix orenii H 168]
          Length = 519

 Score =  171 bits (432), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 134/424 (31%), Positives = 211/424 (49%), Gaps = 34/424 (8%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           D + QF +  ++L +   +++ S + V ++  +      +SP Y  L+  L   D + I 
Sbjct: 7   DYIEQFKELWSNLNKRAKVVIISGVGVDLLTLILIIAMGSSPDYQPLFSNLNPRDADAII 66

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L E  I +R++DNG +I VPS  V K R+ +A +GLPS     G+E+F++ N FG T 
Sbjct: 67  EKLDEQGIPYRLTDNGQTILVPSQHVYKTRLDMAGEGLPSQGV-VGFEIFNQSN-FGTTD 124

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-----A 179
           F +++   RAL GE++R+IQ++  I  A+V I  P    F +      ASV+++      
Sbjct: 125 FERKVNFYRALGGELSRSIQAMEAIEYAKVQITAPKESLFIEEEQPAEASVLLKFVPGHK 184

Query: 180 INPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQ-AIQ 238
           ++P   K   AI +LVA++V  LD   VT++D++G LL+ N  +++     L++ Q  IQ
Sbjct: 185 LSPDQVK---AISNLVASSVQGLDPDKVTIVDTSGNLLSRN-TDKDFYNSQLTMNQFEIQ 240

Query: 239 HEIEMNINKALAAF----LGVDNFRSAVVAELNMDTQQIREIVYDP---DSKVERSIRLS 291
            +   ++   L AF    LG DNF   V A LN D +Q+    Y P   D  + RS +  
Sbjct: 241 RKFAESLENDLRAFLFKVLGPDNFTVQVKAWLNFDKRQVESKTYSPVVGDEGIVRSQQEH 300

Query: 292 KDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDN 351
           +++   E            N+P    + V    S    +  +  +NYEIN K     +  
Sbjct: 301 EESYEGENPVATGVPGTTSNIPQY--QSVEEENSGGTYESSDVITNYEINEKIEKHVYSP 358

Query: 352 YKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSM 411
             +ERLS+AV+VN       L R          L +I   V AA G +  RGD +T+TSM
Sbjct: 359 GSVERLSVAVIVNSS-----LERDE--------LQKIRNAVQAAIGYDPERGDMVTVTSM 405

Query: 412 DFLE 415
           DF E
Sbjct: 406 DFDE 409


>gi|189426353|ref|YP_001953530.1| flagellar M-ring protein FliF [Geobacter lovleyi SZ]
 gi|189422612|gb|ACD97010.1| flagellar M-ring protein FliF [Geobacter lovleyi SZ]
          Length = 530

 Score =  171 bits (432), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 138/466 (29%), Positives = 221/466 (47%), Gaps = 31/466 (6%)

Query: 16  SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFR 75
           +L   + L++  V+L  ++ F       N   Y  L+  L   D   I   L EA   ++
Sbjct: 14  ALAPGKRLLVGGVVLACLLSFALLIMLANRTDYRPLFTNLASEDAGEIVKKLKEAKTPYQ 73

Query: 76  ISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRAL 135
           I+ +G  I VP+  V + R+ LA++GLP      G+E+FD+ N FG+T F+Q++   RAL
Sbjct: 74  ITPDGKGIMVPADKVYELRLSLASEGLPQGG-GVGFEIFDRKN-FGMTEFVQKLNYQRAL 131

Query: 136 EGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRH 193
           +GE+ARTI  ISG+  ARVH+V+P+   F++    PTASV+++       +  E   + H
Sbjct: 132 QGELARTITQISGVEQARVHLVIPEKTLFKEAEKPPTASVVLKMKGNKNLRDNEVQGVVH 191

Query: 194 LVAAAVPNLDMGDVTVLDSTGKLLT--ANEMERNILGKSLSIVQAIQHEIEMNINKALAA 251
           LV++++  ++  +VTVLDS GK+L+   N M  +   K+ S +Q  Q   E N+ + L  
Sbjct: 192 LVSSSIEGMNADNVTVLDSRGKILSKGGNGMA-DASAKATSAMQETQRGYERNVEERLQT 250

Query: 252 FLG--VDNFRSAVVAELNMDTQQIREI--VYDPDSKVERSIRLSKDAQRSETSQPESAVT 307
            L   V   +S        D +Q+  +   +DP++   RS       QRSE     SAV+
Sbjct: 251 LLDRVVGGGKSVARVSATFDFKQVERVEEKFDPETIAVRS------EQRSEEKAGGSAVS 304

Query: 308 VEQNMPHVS---DRKVPLPRSLENTDKKEEQS-NYEINTKSIATTHDNYKLERLSIAVVV 363
               +P V     R  P          K +++ NYE++  +  T      L ++S+A++V
Sbjct: 305 T--GVPGVQTNLGRTAPGAGGAAGGGSKNDETLNYEVSRSTSRTVEPVGTLSKVSVAILV 362

Query: 364 NKGRLTEVLGRSADQGKID------SYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           +    T   G+    GK          L +I  +V  A G N  RGD I+I ++ F +  
Sbjct: 363 DGKYETGAPGKDGAAGKAKYVPRSPDELQKIEALVKGAVGFNQERGDQISIQNIAFQDAG 422

Query: 418 LFNSGTVQVSFM--DILSRHFATVINALVFLVGTLLVTFLGLHALR 461
                T    +         F  ++ AL FL   L V    L+ LR
Sbjct: 423 EAAGSTESAKWWMNPFFLTLFKNLMIALGFLALMLFVVKPMLNTLR 468


>gi|172062015|ref|YP_001809667.1| flagellar MS-ring protein [Burkholderia ambifaria MC40-6]
 gi|171994532|gb|ACB65451.1| flagellar M-ring protein FliF [Burkholderia ambifaria MC40-6]
          Length = 587

 Score =  170 bits (431), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 114/386 (29%), Positives = 192/386 (49%), Gaps = 16/386 (4%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VPS+ V + R+ LAA 
Sbjct: 79  LWSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPSNQVHETRLKLAAL 138

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   S  G+EL D    FG++ F +++   RALEGE+ RTI+SI+ +  ARVH+ +P 
Sbjct: 139 GLPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTIESINAVRGARVHLAIPK 196

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSA--EAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV +      V      +AI  +V++ VP++   +VT++D  G LLT
Sbjct: 197 PSVFVRDKEAPSASVFVDLYPGRVLDEGQVQAITRMVSSGVPDMPAKNVTIVDQDGNLLT 256

Query: 219 ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
                  +    L  VQ ++H  +  I+  LA   G  N RS V A+++    +     Y
Sbjct: 257 QTASASGLDASQLKYVQQVEHNTQKRIDAILAPIFGTGNARSQVSADIDFSKLEQTSESY 316

Query: 279 DPDSKVER-SIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLP----------RSLE 327
            P+   ++ +IR  + +  +E +Q   A  V   + +   +    P          +S  
Sbjct: 317 GPNGTPQQAAIRSQQTSSATELAQ-GGASGVPGALSNTPPQPASAPIVAGNGQNGAQSTP 375

Query: 328 NTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAE 387
            +D+K++ +NYE++            ++RLS+AVVVN   + +  G    Q      LA+
Sbjct: 376 VSDRKDQTTNYELDKTIRHVEQPMGNVKRLSVAVVVNYQPVADAKGHVTMQPLPPPKLAQ 435

Query: 388 INKIVSAATGINSRRGDTITITSMDF 413
           + ++V  A G + +RGD++ + +  F
Sbjct: 436 VEQLVKDAMGYDEKRGDSVNVVNSAF 461


>gi|254418232|ref|ZP_05031956.1| flagellar M-ring protein FliF [Brevundimonas sp. BAL3]
 gi|196184409|gb|EDX79385.1| flagellar M-ring protein FliF [Brevundimonas sp. BAL3]
          Length = 545

 Score =  170 bits (431), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 152/543 (27%), Positives = 250/543 (46%), Gaps = 48/543 (8%)

Query: 27  SVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVP 86
           + +LV +ML M       +P    LY  L++ +   I+ AL +A I +    +GS++ V 
Sbjct: 27  TAVLVAVMLRMG-----QAPDA-LLYSNLDLREAGEITTALQQAGIKYTSKGDGSTVMVN 80

Query: 87  SSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSI 146
              VG AR+ +A +GL +S S  GYE+FD  +  G T F Q++   RAL+GE++RTI S+
Sbjct: 81  RDDVGTARMLIAGKGLVTSGS-VGYEIFDNQSVLGQTEFQQQLNEQRALQGELSRTIMSM 139

Query: 147 SGIVAARVHIVMPDMGSFRKIGARPTASVMI----RAINPSVYKSAEAIRHLVAAAVPNL 202
            GI AARVHI MP    F      PTA+V++    R + P   +   AIR+LVA++VPNL
Sbjct: 140 RGITAARVHITMPRREMFTAAAGDPTAAVLVGLGGRDLTPDQVR---AIRNLVASSVPNL 196

Query: 203 DMGDVTVLDSTGKLLTANEMERNILGKSLSIVQA-IQHEIEMNINKALAAFLGVDNFRSA 261
               VTV D   + L A   +      S +  +   + +++  I   +   +G+   R  
Sbjct: 197 KPDRVTVADQNNRTLAAGSDDGTFSSASAAETKGNTEAQLQSRIKDIVEGVVGIGAARVQ 256

Query: 262 VVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVP 321
           V A+++      +E  +DPD +V RS   +       T Q +  VT   N+P       P
Sbjct: 257 VTADIDQSRSTTQEQKFDPDGQVVRSTTANGSQSSDTTGQNDGGVTAANNIPG----GAP 312

Query: 322 LPRSLENTDKKE--EQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVL---GRSA 376
              +       E  E +NYEI+  +  TT +  ++++L++AV V+ G+ T      G   
Sbjct: 313 PATTPAGATSAENAETTNYEISNTTTTTTKEPGEVKKLAVAVAVD-GKWTPAADGKGEPT 371

Query: 377 DQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG-TVQVSFMDILSRH 435
              +    +A+I  +V+AA GI+  RGD I + ++ F  +     G   + S +D     
Sbjct: 372 YAPRTAEEIAQIKSLVAAAAGIDEARGDKIEVINVRFNHDTGIAGGLEGKSSLLDFSRTD 431

Query: 436 FATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMP 495
              +I   +  V  LL+ F  L  L +                +    P+++ VTT ++ 
Sbjct: 432 VMRLIELGILAVVALLLIFFVLRPLLKTAGGAAPGAVAAAPAGL----PVAT-VTTTVIG 486

Query: 496 NDN----IALDSSNQ-----DIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKIL 546
            D     + L + N+     DI        +RI   V   S  ++   ++ + +  A IL
Sbjct: 487 ADGQPQLVQLPAPNEMDQKIDI--------ARIEGQVKASSVKKVADFVQAHPDEAAGIL 538

Query: 547 RKW 549
           R W
Sbjct: 539 RNW 541


>gi|167835057|ref|ZP_02461940.1| flagellar MS-ring protein [Burkholderia thailandensis MSMB43]
          Length = 486

 Score =  170 bits (430), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 115/391 (29%), Positives = 191/391 (48%), Gaps = 27/391 (6%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 46  WSRAPDYRVLYSNLSDRDGGAIITALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 105

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++SI+ + AARVH+ +P  
Sbjct: 106 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESINAVRAARVHLAIPKP 163

Query: 162 GSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++      V    +  A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 164 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 223

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N R+ V A+++    +     Y 
Sbjct: 224 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARAQVSADVDFSKIEQTSESYG 283

Query: 280 PDSKVERS-IRLSKDAQRSE----------------TSQPESAVTVEQNMPHVSDRKVPL 322
           P+   ++S IR  + +  +E                  QP SA  V  N         P+
Sbjct: 284 PNGTPQQSAIRSQQTSTATELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 343

Query: 323 PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKID 382
                 +D+K+  +NYE++            ++RLS+AVVVN     +  GR   Q    
Sbjct: 344 ------SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPAADAKGRVTMQPLAA 397

Query: 383 SYLAEINKIVSAATGINSRRGDTITITSMDF 413
             LA++ ++V  A G + +RGD++ + +  F
Sbjct: 398 DKLAQVQQLVKDAMGYDEKRGDSVNVVNSAF 428


>gi|221215779|ref|ZP_03588738.1| flagellar M-ring protein FliF [Burkholderia multivorans CGD1]
 gi|221164315|gb|EED96802.1| flagellar M-ring protein FliF [Burkholderia multivorans CGD1]
          Length = 587

 Score =  169 bits (429), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 114/390 (29%), Positives = 195/390 (50%), Gaps = 24/390 (6%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA 
Sbjct: 79  LWSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPAAQVHETRLKLAAL 138

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D    FG++ F +++   RALEGE+ RTI+SI+ +  ARVH+ +P 
Sbjct: 139 GLPKGGA-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTIESINAVRGARVHLAIPK 196

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSA--EAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV +      V      +AI  +V++ VP++   +VT++D  G LLT
Sbjct: 197 PSVFVRDREAPSASVFVDLYPGRVLDEGQVQAITRMVSSGVPDMPAKNVTIVDQDGNLLT 256

Query: 219 ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
                  +    L  VQ ++   +  I+  LA   G  N RS V A+++    +     Y
Sbjct: 257 QPASATGLDASQLKYVQQVERNTQKRIDAILAPIFGAGNARSQVSADIDFSKLEQTSESY 316

Query: 279 DPD-SKVERSIRLSKDAQRSETSQ--------------PESAVTVEQNMPHVSDRKVPLP 323
            P+ S  + +IR  + +  +E +Q              P+ A     + P V+      P
Sbjct: 317 GPNGSPQQAAIRSQQTSTSTELAQSGASGVPGALSNTPPQPA-----SAPIVAGNGANAP 371

Query: 324 RSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDS 383
           ++   +D+K++ +NYE++            ++RLS+AVVVN   + +  G    Q    +
Sbjct: 372 QTTPVSDRKDQTTNYELDKTIRHVEQPMGTVKRLSVAVVVNYQPVADAKGHVTMQPLPPA 431

Query: 384 YLAEINKIVSAATGINSRRGDTITITSMDF 413
            LA+I ++V  A G +++RGD++ + +  F
Sbjct: 432 KLAQIEQLVKDAMGYDAKRGDSVNVVNSAF 461


>gi|254445735|ref|ZP_05059211.1| flagellar M-ring protein FliF [Verrucomicrobiae bacterium DG1235]
 gi|198260043|gb|EDY84351.1| flagellar M-ring protein FliF [Verrucomicrobiae bacterium DG1235]
          Length = 525

 Score =  169 bits (429), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 141/471 (29%), Positives = 235/471 (49%), Gaps = 25/471 (5%)

Query: 9   QFFKSGTSLG-RTRI-LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           QF +   SLG   RI LILAS ++V  M+ M    +   P    LY KL   +  +I   
Sbjct: 4   QFKEIWQSLGANQRISLILASGLVVLAMIGMM--IWAAQPDMQLLYGKLSAEEAGKIVAK 61

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L +  + F     G+SI V +S V + R+ LA +G+P+  S  G+ELFD+  SFG++ F+
Sbjct: 62  LEQKGVAFETGSGGNSIYVEASQVHRIRMELATEGIPAGGSGPGFELFDE-GSFGISDFV 120

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPD--MGSFRKIGARPTASVMIRAINPSV 184
           Q    +RA++GE+ARTI    G+ +ARV +VMP+  + + R+   RPTASV +     S 
Sbjct: 121 QRTNFLRAVQGELARTISQFDGVESARVMVVMPENRLLASREGQDRPTASVFVDGGGLST 180

Query: 185 YKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLS-----IVQAIQH 239
             +  +IRHLVA A+  L + DV V+DS G +L+  E+  + +G  +S       +++++
Sbjct: 181 -GTVNSIRHLVANAIQRLSINDVVVVDSMGTVLS-EELRSDGIGSGISNDVIKYRKSLEN 238

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQ--RS 297
                +   L   LG +     V  ++   + Q  E  +DP+S+V RS    +D+Q  R 
Sbjct: 239 YFTGKVQSMLDRVLGPNQSEVRVAVDIETASVQTTEKTFDPESQVARSTVSDEDSQVERE 298

Query: 298 ETSQPESAVTVEQNMPHVSDRKVPLPRSL-ENTDK-KEEQSNYEINTKSIATTHDNYKLE 355
            + +   A  V  N P           +L E  DK K    N+EIN + +++  +   ++
Sbjct: 299 TSGEGAGATGVSSNTPAAGGAGQTAFSTLKEREDKNKTRTENFEINERIVSSVQNPGSIK 358

Query: 356 RLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDT----ITITSM 411
           RL+ +++V K R+ +V G+     +    L E++ IV  A GI    G T    +T+  M
Sbjct: 359 RLTASLLVAK-RMEDVRGQMNFVDRTPEQLEELSDIVVTALGIQLAPGQTAADFVTVKEM 417

Query: 412 DFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRR 462
            F  +   N G + +     + R+     N +  ++G  ++ F  +  L+R
Sbjct: 418 AFAVDPFENHGEL-LKEDATIQRYIELGKNGIGAVLGIGVIIFF-MQMLKR 466


>gi|320354317|ref|YP_004195656.1| flagellar M-ring protein FliF [Desulfobulbus propionicus DSM 2032]
 gi|320122819|gb|ADW18365.1| flagellar M-ring protein FliF [Desulfobulbus propionicus DSM 2032]
          Length = 550

 Score =  169 bits (429), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 135/455 (29%), Positives = 220/455 (48%), Gaps = 25/455 (5%)

Query: 21  RILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNG 80
           R + LA+V  + + LF        +  Y  LY  L  SD + +   L   NI +++++NG
Sbjct: 30  RKIALAAVTAITLGLFAFIIVQARTADYQLLYGNLAESDASSVVEWLKGQNIPYKLANNG 89

Query: 81  SSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIA 140
            +I +P+  V + R+ LA+ GLP      G+E+FDK  SF LT F+Q++   RAL+GE+A
Sbjct: 90  HNILIPAKDVYETRLSLASLGLPQGG-GVGFEIFDK-QSFALTDFVQKVNYSRALQGELA 147

Query: 141 RTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSA--EAIRHLVAAA 198
           RTI S+  +  ARVH+ +P+   F+      TASV+I+         A  E + HLV+++
Sbjct: 148 RTIASLGPVETARVHLALPEKRLFKDQQKPATASVIIKLAPGKRLSEAQIEGVVHLVSSS 207

Query: 199 VPNLDMGDVTVLDSTGKLLT---ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGV 255
           +  LD G VTV+D  G +L+      +  N+    L     ++  +E      L   LG 
Sbjct: 208 IEGLDPGQVTVIDQNGNVLSRIGEKGLSGNLSPDMLEFQMQVEQRLEDRAQALLDKSLGA 267

Query: 256 DNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ--PESAVTVEQNMP 313
            N    V A L+    +  E  +DP+  V RS +LS++   SE +   P     +E N  
Sbjct: 268 KNAMVRVSATLDFAQTEKTEETFDPEEPVIRSEQLSEEKSGSEITGGVPGVQSNLEGNTA 327

Query: 314 HVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLG 373
             +    P  RS   T       NYEI+     TT     + +LS++V+V       V G
Sbjct: 328 QTAGATPPSSRSQRTT-------NYEISKVVSKTTQPVGTISKLSVSVLVAD---KVVPG 377

Query: 374 RSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFM 429
           +  +  K     ++ L  +  +V++A GI++ RGD I +TSM FLE+     G  +    
Sbjct: 378 KDKEPAKTEPRSETELKTLQTMVASALGIDTARGDKIEVTSMPFLESA--EDGGQEGMAA 435

Query: 430 DILSRHFATVINALVFLVGTLLVTFLGLHALRRLH 464
           ++L ++   +   L+ L   L+  F+    ++ LH
Sbjct: 436 NLLYQYLPFIRYGLLILGAVLIYLFMIRPLMKTLH 470


>gi|259417522|ref|ZP_05741441.1| flagellar MS-ring protein [Silicibacter sp. TrichCH4B]
 gi|259346428|gb|EEW58242.1| flagellar MS-ring protein [Silicibacter sp. TrichCH4B]
          Length = 571

 Score =  169 bits (428), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 167/564 (29%), Positives = 252/564 (44%), Gaps = 45/564 (7%)

Query: 19  RTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISD 78
           R R++ + + + V I  F       N P    LY  LE S    +  AL ++ +D+ +  
Sbjct: 27  RKRMMAIGATLAV-IFTFFLMSMVANKPSMQLLYAGLESSSAGDVVSALEQSGVDYEV-- 83

Query: 79  NGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGE 138
            G SI VPS+   + R+ LA+QGLP++    GYEL D ++ FG TS M +    RA EGE
Sbjct: 84  RGGSIYVPSNKRDELRMTLASQGLPANGGK-GYELLDSLSGFGTTSQMFDAAYWRAKEGE 142

Query: 139 IARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN-PSVYKSAEAIRHLVAA 197
           +ARTI +   +  ARVHI       F++    PTASV +  +  P     A AIR LVA+
Sbjct: 143 LARTIVANPHVSQARVHIANTGSNPFQRT-IEPTASVSVTPMGTPITPAQANAIRFLVAS 201

Query: 198 AVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDN 257
           AV  L + +V V+D+ G L+ + E        +    Q ++  +     + + A +G  N
Sbjct: 202 AVAGLAVDNVAVIDANGALIGSPEAAAAAGAGTDDRSQTLRERVL----RLVEARVGHGN 257

Query: 258 FRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESA-VTVEQNMPHVS 316
               +  E   DT+ IRE + DP S+V  S  +    +R+++SQ ++  VTV  N+P   
Sbjct: 258 AVVEISVETVTDTESIREKLVDPQSRVAISTDVE---ERTDSSQNQAGEVTVASNIPDGD 314

Query: 317 DRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSA 376
                  R+  NT+   E+ NYEI+            ++RL++AV++N        G++ 
Sbjct: 315 AGNGEGSRA--NTNATRERVNYEISETEKEIVRGPGAIKRLTVAVLINGVTTPTADGQAT 372

Query: 377 DQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHF 436
            + + D  L  + +++SAA G ++ RGD IT+ SMD L N       V  S  D L    
Sbjct: 373 FEPRPDEELDALRELISAAVGFDAERGDVITLKSMD-LPNVEPEGTAVTSSMFDNLYFDV 431

Query: 437 ATVINALVFLVGTLLVTFLGLHALRRLHNIDDA-------KKGEVGGKSILSPPPISSAV 489
            ++I      V  L+   LGL  +R +   + A         G   G   L   P     
Sbjct: 432 MSIIQMAALAVVALI---LGLFVVRPILAGNGASVQALPSPDGMAAGG--LPELPNMGGG 486

Query: 490 TTGLMPN----DNIAL----DSSNQDIFSHSRNLQSRINSY--------VSKQSDLRLLH 533
             G M N     NIAL    DS     F     L    +          +S     RL  
Sbjct: 487 DAGFMTNPDLGSNIALDGEIDSGGDGQFQPLGGLPGMGDGLATFGGGGGMSDDPVDRLRS 546

Query: 534 MIEINEERFAKILRKWARSEIEDR 557
           MI   +E   +ILR W     E+R
Sbjct: 547 MIGERQEETVQILRGWLEENNEER 570


>gi|238028887|ref|YP_002913118.1| flagellar MS-ring protein [Burkholderia glumae BGR1]
 gi|237878081|gb|ACR30414.1| Flagellar M-ring protein FliF [Burkholderia glumae BGR1]
          Length = 599

 Score =  169 bits (428), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 119/389 (30%), Positives = 194/389 (49%), Gaps = 24/389 (6%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +ANI ++ +D G +I VP+S V + R+ LAA G
Sbjct: 84  WSRAPDYRVLYSNLSDRDGGAIITALQQANIPYQFADAGGAILVPASQVHETRLRLAAMG 143

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RTI SI+ + +ARVH+ +P  
Sbjct: 144 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELERTIASINAVRSARVHLAIPKP 201

Query: 162 GSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV +      V    +  AI  +VA+ VP++   +VT++D  G LL+ 
Sbjct: 202 SVFVRDREAPSASVFVDLYPGRVLDDGQVLAITRMVASGVPDMPAKNVTIVDQDGNLLSQ 261

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ ++H  +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 262 QPSSSGLDANQLKYVQQVEHNTQKRIDAILAPMFGAGNTRSQVSADIDFTRSEQTSESYA 321

Query: 280 PD-SKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENT--------- 329
           P+ ++ + +IR    +Q++ +S  ESA +    +P       P P S   T         
Sbjct: 322 PNGTQQQAAIR----SQQTSSSV-ESAQSGAGGVPGALSNTPPQPASAPITGASGAAGTP 376

Query: 330 -----DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSY 384
                D+K+  +NYE++     T      ++RLS+AVVVN   + +  G    Q      
Sbjct: 377 PTPISDRKDSTTNYELDKTVRHTEAPTGGIKRLSVAVVVNNLPVVDAKGHVTMQPLTADK 436

Query: 385 LAEINKIVSAATGINSRRGDTITITSMDF 413
           L ++ ++V  A G +++RGD++ + +  F
Sbjct: 437 LKQVEQLVKDAMGYDAKRGDSVNVVNSVF 465


>gi|221201939|ref|ZP_03574976.1| flagellar M-ring protein FliF [Burkholderia multivorans CGD2M]
 gi|221207554|ref|ZP_03580562.1| flagellar M-ring protein FliF [Burkholderia multivorans CGD2]
 gi|221172400|gb|EEE04839.1| flagellar M-ring protein FliF [Burkholderia multivorans CGD2]
 gi|221178359|gb|EEE10769.1| flagellar M-ring protein FliF [Burkholderia multivorans CGD2M]
          Length = 587

 Score =  169 bits (428), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 114/390 (29%), Positives = 195/390 (50%), Gaps = 24/390 (6%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA 
Sbjct: 79  LWSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPAAQVHETRLKLAAL 138

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D    FG++ F +++   RALEGE+ RTI+SI+ +  ARVH+ +P 
Sbjct: 139 GLPKGGA-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTIESINAVRGARVHLAIPK 196

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSA--EAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV +      V      +AI  +V++ VP++   +VT++D  G LLT
Sbjct: 197 PSVFVRDREAPSASVFVDLYPGRVLDEGQVQAITRMVSSGVPDMPAKNVTIVDQDGNLLT 256

Query: 219 ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
                  +    L  VQ ++   +  I+  LA   G  N RS V A+++    +     Y
Sbjct: 257 QPASATGLDASQLKYVQQVERNTQKRIDAILAPIFGAGNARSQVSADIDFSKLEQTSESY 316

Query: 279 DPD-SKVERSIRLSKDAQRSETSQ--------------PESAVTVEQNMPHVSDRKVPLP 323
            P+ S  + +IR  + +  +E +Q              P+ A     + P V+      P
Sbjct: 317 GPNGSPQQAAIRSQQTSTSTELAQSGASGVPGALSNTPPQPA-----SAPIVAGNGANAP 371

Query: 324 RSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDS 383
           ++   +D+K++ +NYE++            ++RLS+AVVVN   + +  G    Q    +
Sbjct: 372 QTTPVSDRKDQTTNYELDKTIRHVEQPMGTVKRLSVAVVVNYQPVADAKGHVTMQPLPPA 431

Query: 384 YLAEINKIVSAATGINSRRGDTITITSMDF 413
            LA+I ++V  A G +++RGD++ + +  F
Sbjct: 432 KLAQIEQLVKDAMGYDAKRGDSVNVMNSAF 461


>gi|167588531|ref|ZP_02380919.1| flagellar MS-ring protein [Burkholderia ubonensis Bu]
          Length = 487

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 114/390 (29%), Positives = 195/390 (50%), Gaps = 24/390 (6%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA 
Sbjct: 52  LWTRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAL 111

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   S  G+EL D    FG++ F ++I   RALEGE+ RTI+S++ + AARVH+ +P 
Sbjct: 112 GLPKGGS-VGFELMDN-QKFGISQFAEQINYQRALEGELQRTIESVNAVKAARVHLAIPK 169

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV +      V    +  AI  +V++ VP++   +VT++D  G LLT
Sbjct: 170 PSVFVRDKEAPSASVFVDLYPGRVLDEGQVLAITRMVSSGVPDMPAKNVTIVDQDGNLLT 229

Query: 219 ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
                  +    L  VQ ++   +  I+  LA   G  N RS V A+++    +     Y
Sbjct: 230 QPASATGLDASQLKYVQQVERNTQKRIDAILAPIFGTGNARSQVSADIDFSRLEQTSESY 289

Query: 279 DPDSKVERS-IRLSKDAQRSETSQ--------------PESAVTVEQNMPHVSDRKVPLP 323
            P+   +++ IR  + +  +E +Q              P+ A     + P V+      P
Sbjct: 290 GPNGTPQQTAIRSQQTSTATELAQGGASGVPGALSNTPPQPA-----SAPIVAGNGQNGP 344

Query: 324 RSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDS 383
           ++   +D+K+  +NYE++            ++RLS+AVVVN   + +  G    Q    +
Sbjct: 345 QATPVSDRKDSTTNYELDKTIRHVEQPMGSVKRLSVAVVVNYQPVADSKGHVTMQPLPPA 404

Query: 384 YLAEINKIVSAATGINSRRGDTITITSMDF 413
            LA++ ++V  A G +++RGD++ + +  F
Sbjct: 405 KLAQVEQLVKDAMGYDAKRGDSVNVVNSTF 434


>gi|161526230|ref|YP_001581242.1| flagellar MS-ring protein [Burkholderia multivorans ATCC 17616]
 gi|189349056|ref|YP_001944684.1| flagellar MS-ring protein [Burkholderia multivorans ATCC 17616]
 gi|160343659|gb|ABX16745.1| flagellar M-ring protein FliF [Burkholderia multivorans ATCC 17616]
 gi|189333078|dbj|BAG42148.1| flagellar M-ring protein [Burkholderia multivorans ATCC 17616]
          Length = 587

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 114/390 (29%), Positives = 195/390 (50%), Gaps = 24/390 (6%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA 
Sbjct: 79  LWSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPAAQVHETRLKLAAL 138

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D    FG++ F +++   RALEGE+ RTI+SI+ +  ARVH+ +P 
Sbjct: 139 GLPKGGA-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTIESINAVRGARVHLAIPK 196

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSA--EAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV +      V      +AI  +V++ VP++   +VT++D  G LLT
Sbjct: 197 PSVFVRDREAPSASVFVDLYPGRVLDEGQVQAITRMVSSGVPDMPAKNVTIVDQDGNLLT 256

Query: 219 ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
                  +    L  VQ ++   +  I+  LA   G  N RS V A+++    +     Y
Sbjct: 257 QPASATGLDASQLKYVQQVERNTQKRIDAILAPIFGAGNARSQVSADIDFSKLEQTSESY 316

Query: 279 DPD-SKVERSIRLSKDAQRSETSQ--------------PESAVTVEQNMPHVSDRKVPLP 323
            P+ S  + +IR  + +  +E +Q              P+ A     + P V+      P
Sbjct: 317 GPNGSPQQAAIRSQQTSTSTELAQSGASGVPGALSNTPPQPA-----SAPIVAGNGANAP 371

Query: 324 RSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDS 383
           ++   +D+K++ +NYE++            ++RLS+AVVVN   + +  G    Q    +
Sbjct: 372 QTTPVSDRKDQTTNYELDKTIRHVEQPMGTVKRLSVAVVVNYQPVADAKGHVTMQPLPPA 431

Query: 384 YLAEINKIVSAATGINSRRGDTITITSMDF 413
            LA+I ++V  A G +++RGD++ + +  F
Sbjct: 432 KLAQIEQLVKDAMGYDAKRGDSVNVMNSAF 461


>gi|313895975|ref|ZP_07829529.1| flagellar M-ring protein FliF [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312975400|gb|EFR40861.1| flagellar M-ring protein FliF [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 526

 Score =  169 bits (427), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 128/459 (27%), Positives = 227/459 (49%), Gaps = 33/459 (7%)

Query: 19  RTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISD 78
           R R ++L S + +  ++F  + ++ + P    L+  +E  D   ++  L EA I + + D
Sbjct: 18  RQRYIMLGSALAILALIFGLSFWYGSKPDMVPLFTDMETKDAGEVANQLREAKISYEVQD 77

Query: 79  --NGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALE 136
             NG++I VP++ V +AR++LA QGLP    N G+E+FD  +  G+T F   +  ++AL+
Sbjct: 78  GKNGTTILVPTTNVHEARLNLATQGLPRG--NKGFEIFDD-SKLGVTEFQNRVNYLQALQ 134

Query: 137 GEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS---VYKSAEAIRH 193
           GE+ RTI+ I  +  ARVHIV+P+   ++K     TAS+M+R + PS     K  + I +
Sbjct: 135 GELTRTIEQIDAVEKARVHIVLPEDSLYKKEEKPATASIMLR-LKPSTELTKKEIKGIVN 193

Query: 194 LVAAAVPNLDMGDVTVLDSTGKLLT--ANEMERNILGKSLS---IVQAIQHEIEMNINKA 248
           L A +V  L   ++T++D TGK+L    ++ E+++  K+L+   + + +Q  IE  +   
Sbjct: 194 LAAHSVKGLTPENITIVDDTGKILNDPDDQDEKSVGVKTLTQLDMTRKVQDNIEKKVQSL 253

Query: 249 LAAFLGVDNFRSAVVAELNMDTQQIREIVYDP---DSKVERSIRLSKDAQRSETSQPESA 305
           L   LG     + V  EL+ D +   +  + P   D+ + RS +   +     ++ P   
Sbjct: 254 LDQTLGEGRAVARVSVELDFDDRLTDKQTFTPVVDDAGIIRSQQDISENYTGSSTNPGGP 313

Query: 306 VTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNK 365
             V+ N+P   +++       E   KKE   NYEIN +          + RL++AV+VN 
Sbjct: 314 AGVQSNVPGYVEQESNANAQYE---KKESTKNYEINEERQHVIASPGSIRRLTVAVLVND 370

Query: 366 GRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQ 425
                       Q + +S L    + VS+A GIN  RGDTI++  + F +         +
Sbjct: 371 ---------DVTQPQQESIL----RTVSSAAGINQARGDTISVEPLPFSKEAAERRAAEE 417

Query: 426 VSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLH 464
            +  D   R F   +  ++ ++  ++   L     +RL 
Sbjct: 418 QAEKDRQDRIFYAQVGIVLLIIALIVGGILMYRRKKRLE 456


>gi|289548426|ref|YP_003473414.1| flagellar M-ring protein FliF [Thermocrinis albus DSM 14484]
 gi|289182043|gb|ADC89287.1| flagellar M-ring protein FliF [Thermocrinis albus DSM 14484]
          Length = 496

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 129/405 (31%), Positives = 205/405 (50%), Gaps = 45/405 (11%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LIL+  +   ++  +      +S  Y  LY  L   D++ +   L +  + +++  +G S
Sbjct: 23  LILSGAVAAGLISLLLMVLLASSARYVPLYSGLSQEDMSAVLSELEKEGVPYKLGGDGRS 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           + VP   V   R+ LAA+G+PS     GYE+FDK N F ++ F  ++   RA+EGE+A+T
Sbjct: 83  VLVPEDKVRDIRLKLAAKGIPSKGV-VGYEIFDKSN-FAVSDFQNQVNFKRAVEGELAKT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE---AIRHLVAAAV 199
           I  I G+  A+V+I MP    F +   +PTASV++R + P    S E   AIR+LVA +V
Sbjct: 141 IMRIQGVEEAKVNIGMPQRSIFVREEEQPTASVLVR-LKPGYELSPEQVKAIRNLVALSV 199

Query: 200 PNLDMGDVTVLDSTGKLLTA---NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVD 256
           P LD  +V V+D  G+ LT+    EM  ++  + L I +  + ++E  + K L   LGV 
Sbjct: 200 PRLDPKNVVVIDDRGRDLTSLLGEEM--DLTERELRIKREYEEQVEKKLQKILEEALGVG 257

Query: 257 NFRSAVVAELNMDTQQIREIVYDPD--------SKVERSIRLSKDAQRSETSQPESAVTV 308
           N +  V A++++  ++ +E +YDPD         K ER +  +        S    A  V
Sbjct: 258 NVKVRVSADIDLTRRESKEEIYDPDMTAVVSQQKKKERVLGGTLGGVPGTASNIPPATGV 317

Query: 309 EQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRL 368
                 +S+R              E  +NYE++ K I T     K+ RLS+ VVVN  +L
Sbjct: 318 GAGGQTLSER-------------TETITNYEVSKKQIYTEEPLVKVRRLSVGVVVN-SQL 363

Query: 369 TEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
             V         +DS    I ++V  A GI+ RRGDTI++ ++ F
Sbjct: 364 KNV--------NLDS----IRELVQTAAGIDQRRGDTISVVAVPF 396


>gi|292669732|ref|ZP_06603158.1| flagellar M-ring protein FliF [Selenomonas noxia ATCC 43541]
 gi|292648529|gb|EFF66501.1| flagellar M-ring protein FliF [Selenomonas noxia ATCC 43541]
          Length = 526

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 120/408 (29%), Positives = 208/408 (50%), Gaps = 33/408 (8%)

Query: 19  RTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISD 78
           R R ++L S + + +++F  + ++ + P    L+  +E  D   ++  L E+ I + I +
Sbjct: 18  RQRYIMLGSALAILVLIFGLSFWYGSKPDMVPLFTDMETKDAGEVAKQLRESKISYEIQE 77

Query: 79  N--GSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALE 136
           N  G++I VP++ V +AR++LA QGLP    N G+E+FD  +  G+T F   +  ++AL+
Sbjct: 78  NKSGTTILVPTTNVHEARLNLATQGLPRG--NKGFEIFDD-SKLGVTEFQNRVNYLQALQ 134

Query: 137 GEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS---VYKSAEAIRH 193
           GE+ RTI+ I  +  ARVHIV+P+   ++K     TAS+M+R + P+     K  + I +
Sbjct: 135 GELTRTIEQIEAVEKARVHIVLPEDSLYKKEEKPATASIMLR-LKPNAELTKKEIKGIVN 193

Query: 194 LVAAAVPNLDMGDVTVLDSTGKLLT-ANEMERNILG----KSLSIVQAIQHEIEMNINKA 248
           L A +V  L   ++T++D TGK+L   ++ + N +G      L + + +Q  IE  +   
Sbjct: 194 LAAHSVKGLMPENITIVDDTGKILNDPDDQDENAIGVKTLTQLDMTRKVQDNIEKKVQSL 253

Query: 249 LAAFLGVDNFRSAVVAELNMDTQQIREIVYDP---DSKVERSIRLSKDAQRSETSQPESA 305
           L   LG     + V  EL+ D +      + P   D+ + RS +   ++    ++ P   
Sbjct: 254 LDQTLGEGRAFARVSVELDFDDRLTDRQTFTPVVDDAGIIRSQQDISESYVGNSTNPGGP 313

Query: 306 VTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNK 365
             V+ N+P   +++       E   KKE   NYEIN +          + RL++AV+VN 
Sbjct: 314 AGVQSNVPGYVEQEANANAEYE---KKESTKNYEINEERQHVIASPGSIRRLTVAVLVND 370

Query: 366 GRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
                       Q + +S L    + VS+A GIN  RGDTI++  + F
Sbjct: 371 ---------DVTQPQQESIL----RTVSSAAGINPTRGDTISVEPLPF 405


>gi|330818622|ref|YP_004362327.1| Flagellar M-ring protein FliF [Burkholderia gladioli BSR3]
 gi|327371015|gb|AEA62371.1| Flagellar M-ring protein FliF [Burkholderia gladioli BSR3]
          Length = 599

 Score =  168 bits (425), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 114/391 (29%), Positives = 192/391 (49%), Gaps = 24/391 (6%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL ++NI ++ +D G +I VP+S+V + R+ LA+ G
Sbjct: 86  WSRAPDYKVLYSNLSDRDGGAIIAALQQSNIPYQFTDAGGAILVPASLVHETRLKLASMG 145

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RTI SI+ + AARVH+ +P  
Sbjct: 146 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELERTIASINAVRAARVHLAIPKP 203

Query: 162 GSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV +      V    +  AI  +VA+ VP++   +VT++D  G LL+ 
Sbjct: 204 SVFVREREAPSASVFVDLYPGRVLDDGQVLAITRMVASGVPDMPAKNVTIVDQDGNLLSQ 263

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
            +    +    L  VQ ++   +  I+  LA   G  N R+ V A+++    +     + 
Sbjct: 264 QQSAAGLDANQLKYVQQVERNTQKRIDAILAPMFGAGNTRAQVSADVDFSRAEQTSESFS 323

Query: 280 PD-SKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENT--------- 329
           P+ ++ + +IR  + +  +E SQ  +       +P       P P S   T         
Sbjct: 324 PNGTQQQAAIRSQQTSSSTEMSQSGAG-----GVPGALSNTPPQPASAPITGASGAAGTP 378

Query: 330 -----DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSY 384
                D+K+  +NYE+N            ++RLS+AVVVN   + +  G    Q      
Sbjct: 379 PTPISDRKDSTTNYELNKTVSHVEQATGGIKRLSVAVVVNNLPVADAKGHVTMQPLSADK 438

Query: 385 LAEINKIVSAATGINSRRGDTITITSMDFLE 415
           L ++ ++V  A G +++RGD++ + +  F E
Sbjct: 439 LRQVEQLVKDAMGFDAKRGDSVNVVNSQFTE 469


>gi|302878299|ref|YP_003846863.1| flagellar M-ring protein FliF [Gallionella capsiferriformans ES-2]
 gi|302581088|gb|ADL55099.1| flagellar M-ring protein FliF [Gallionella capsiferriformans ES-2]
          Length = 566

 Score =  168 bits (425), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 127/408 (31%), Positives = 207/408 (50%), Gaps = 39/408 (9%)

Query: 33  IMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGK 92
           I L + A  +  +P Y  LY  L   D   I  +L + NI ++ +D G ++ +P+  V +
Sbjct: 37  IALIVGAWMWGQTPDYRILYSNLSDRDGGAIIESLQQLNIPYKFADGGGALMIPADQVHE 96

Query: 93  ARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAA 152
           AR+ LA+QGLP   +  G+EL +    FG+T F +++   RALEGE+AR++QSI  + +A
Sbjct: 97  ARLKLASQGLPKGGT-VGFELMEN-QKFGITQFAEQVNYQRALEGELARSVQSIGAVASA 154

Query: 153 RVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVL 210
           RVH+ +P    F K   +P+ASV++      +  SA+  AI HL++++VP++   +VT++
Sbjct: 155 RVHLAIPKPSVFIKEQQKPSASVVLTLHGGRLLDSAQVTAIVHLISSSVPDMSAKNVTIV 214

Query: 211 DSTGKLLTANEMERNILG---KSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELN 267
           D  G LL++ + + N LG     L  VQ I+      I   L   LG +N  + V A ++
Sbjct: 215 DQDGSLLSSLQ-DSNGLGLDANQLKYVQQIEQNYIKRIEDILTPLLGANNVHAQVTANID 273

Query: 268 MD-TQQIREIVYDPD-SKVERSIRLSKDAQRSET----------------SQPESAVT-- 307
              T+Q  E  Y P+ +  + S+R     Q SET                +QP    T  
Sbjct: 274 FARTEQTAE-TYKPNQNPADSSVR---SLQNSETLNGSGLNASGVPGALSNQPPVPATAP 329

Query: 308 VEQNMPHVSDRKVPLPRSLENTDK--KEEQSNYEINTKSIATTHDNYKLERLSIAVVVNK 365
           +    P  +D     P +    D   KE   NYE++     T      ++RLS+AVVVN 
Sbjct: 330 IVSAPPGATD-----PANAPKIDNLHKENTINYEVDRTISHTILPVGMIKRLSVAVVVNN 384

Query: 366 GRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
            + T+  G+ + +   D+  A+I+ +V  A G +  RGD++ I +  F
Sbjct: 385 RKATDPKGKVSSKPLTDAEKAQIDNLVKDAVGFDKNRGDSLNIQNAAF 432


>gi|238755308|ref|ZP_04616651.1| Flagellar M-ring protein [Yersinia ruckeri ATCC 29473]
 gi|238706444|gb|EEP98818.1| Flagellar M-ring protein [Yersinia ruckeri ATCC 29473]
          Length = 574

 Score =  168 bits (425), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 151/552 (27%), Positives = 256/552 (46%), Gaps = 73/552 (13%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  SP Y  LY  L   D   I   L++ NI +R ++NG ++ +P+  V + R+ LA Q
Sbjct: 48  LWAKSPDYRVLYSNLSDRDGGAIVTQLTQLNIPYRFAENGGALLIPADKVHETRLRLAQQ 107

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F ++I   RALEGE++RTI+++  ++  RVH+ MP 
Sbjct: 108 GLPKGGA-VGFELLDQ-EKFGISQFSEQINYQRALEGELSRTIETLGPVLNVRVHLAMPK 165

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        AI ++V+++V  L  G+VTV+D TG+
Sbjct: 166 PSLFVREQKSPSASVTLTLQPGRALDDG---QINAIVYMVSSSVAGLPPGNVTVVDQTGR 222

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT ++   R++    L     ++   +  I   LA  +G  N  + V A+++  T++  
Sbjct: 223 LLTQSDSAGRDLNAAQLKFTNEVEVRFQRRIESILAPMVGNGNVHAQVTAQVDFATREQT 282

Query: 275 EIVYDPDSKVE----RSIRLSKDAQRSET----------SQPES--AVTVEQNMPHVSDR 318
           +  Y P+ + E    RS +LS+  Q   T          +QP +  A  +E      +  
Sbjct: 283 DEEYKPNQRPEQGAVRSQQLSQSEQVGGTPIGGVPGALSNQPSATPAAPIETPAAPGATG 342

Query: 319 KVPL-----------------PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAV 361
                                  ++  + +++E +NYE++     T      ++RLS+AV
Sbjct: 343 AAANTATATPATRNTSAGTAGKNAVPGSSRRDETTNYEVDRTIRHTQQQAGMVQRLSVAV 402

Query: 362 VVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           VVN       LG     GK        LA+I  +   A G +++RGDT+ + +  F E +
Sbjct: 403 VVN------YLGIDKKSGKPIALSKDQLAQIEALTREAMGFSTQRGDTLNVVNTPFTEAE 456

Query: 418 LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGK 477
             NS    + F    S  F  V+NA  +L+  L+   L    +R L     AKK EV   
Sbjct: 457 ETNSA---LPFWKSQS-FFDQVLNAGRYLLILLVAWILWRKLVRPLM----AKKMEVN-- 506

Query: 478 SILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEI 537
                P I++A T         +   SN D  +  +  Q R+++ V  Q   R+  + + 
Sbjct: 507 -----PVIAAAKTVAQTAEAAESAKQSN-DELAQRKKSQQRVSAEVQAQ---RIRELADK 557

Query: 538 NEERFAKILRKW 549
           +    A ++R+W
Sbjct: 558 DPRVVALVIRQW 569


>gi|67641495|ref|ZP_00440272.1| flagellar M-ring protein FliF [Burkholderia mallei GB8 horse 4]
 gi|121601133|ref|YP_994240.1| flagellar MS-ring protein [Burkholderia mallei SAVP1]
 gi|124383455|ref|YP_001028106.1| flagellar MS-ring protein [Burkholderia mallei NCTC 10229]
 gi|126448962|ref|YP_001082916.1| flagellar MS-ring protein [Burkholderia mallei NCTC 10247]
 gi|161579508|ref|YP_104753.2| flagellar MS-ring protein [Burkholderia mallei ATCC 23344]
 gi|167004331|ref|ZP_02270091.1| flagellar M-ring protein FliF [Burkholderia mallei PRL-20]
 gi|254175223|ref|ZP_04881884.1| flagellar M-ring protein FliF [Burkholderia mallei ATCC 10399]
 gi|254201855|ref|ZP_04908219.1| flagellar M-ring protein FliF [Burkholderia mallei FMH]
 gi|254207184|ref|ZP_04913535.1| flagellar M-ring protein FliF [Burkholderia mallei JHU]
 gi|254359688|ref|ZP_04975959.1| flagellar M-ring protein FliF [Burkholderia mallei 2002721280]
 gi|121229943|gb|ABM52461.1| flagellar M-ring protein FliF [Burkholderia mallei SAVP1]
 gi|124291475|gb|ABN00744.1| flagellar M-ring protein FliF [Burkholderia mallei NCTC 10229]
 gi|126241832|gb|ABO04925.1| flagellar M-ring protein FliF [Burkholderia mallei NCTC 10247]
 gi|147747749|gb|EDK54825.1| flagellar M-ring protein FliF [Burkholderia mallei FMH]
 gi|147752726|gb|EDK59792.1| flagellar M-ring protein FliF [Burkholderia mallei JHU]
 gi|148028902|gb|EDK86834.1| flagellar M-ring protein FliF [Burkholderia mallei 2002721280]
 gi|160696268|gb|EDP86238.1| flagellar M-ring protein FliF [Burkholderia mallei ATCC 10399]
 gi|238522438|gb|EEP85882.1| flagellar M-ring protein FliF [Burkholderia mallei GB8 horse 4]
 gi|243060331|gb|EES42517.1| flagellar M-ring protein FliF [Burkholderia mallei PRL-20]
          Length = 598

 Score =  167 bits (424), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 115/391 (29%), Positives = 191/391 (48%), Gaps = 27/391 (6%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 81  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 140

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++S + + AARV++ +P  
Sbjct: 141 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESSNAVRAARVYLAIPKP 198

Query: 162 GSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++      V    +  A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 199 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 258

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 259 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYG 318

Query: 280 PDSKVERS-IRLSKDAQRSE----------------TSQPESAVTVEQNMPHVSDRKVPL 322
           P+   ++S IR  + +  +E                  QP SA  V  N         P+
Sbjct: 319 PNGTPQQSAIRSQQTSSSTELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 378

Query: 323 PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKID 382
                 +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q    
Sbjct: 379 ------SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLAA 432

Query: 383 SYLAEINKIVSAATGINSRRGDTITITSMDF 413
             LA++ ++V  A G + +RGD++ + +  F
Sbjct: 433 DKLAQVQQLVKDAMGYDEKRGDSVNVVNSAF 463


>gi|284007155|emb|CBA72437.1| flagellar M-ring protein FliF [Arsenophonus nasoniae]
          Length = 554

 Score =  167 bits (424), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 125/417 (29%), Positives = 204/417 (48%), Gaps = 42/417 (10%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A  +   I  F+AA F++    Y  +Y  L   D   I   LS+ NI +++S +GS 
Sbjct: 30  LIVAGALA--ITFFIAAMFWLQGADYRPVYTNLSDKDGGEIVTQLSQMNIPYQLSADGSM 87

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           + VP+  V + R+ LA QGLP    N+G+EL D+   FGL+ F ++I   RALEGE+A+T
Sbjct: 88  VKVPADQVHEVRLKLAQQGLP-KGGNAGFELLDQ-EKFGLSQFSEQINYQRALEGELAKT 145

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I+S+  +  ARVH+ +P    F +    PTASV +   N       +  AI H+++++V 
Sbjct: 146 IESLGVVQRARVHLAIPKPSLFVREQKNPTASVTLNLQNGRKLDEGQIAAIVHMISSSVS 205

Query: 201 NLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L   +VT++D  G LLT  + + R++    L+ VQ+I++  +  I   +   +G  N  
Sbjct: 206 GLASSNVTIVDQLGNLLTQPDGISRDLNLTQLNYVQSIENRYKQRIESIIMPLVGRGNVH 265

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE--------------TSQPESA 305
           + V A++N    +     Y P+     S   SK   RSE              ++QP  A
Sbjct: 266 AQVTAQINFARTEETAEEYKPNQPPNESAVRSKQTSRSEQNGQLLVGGVPGALSNQPTPA 325

Query: 306 VTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNK 365
                + P+  D+  P P +  +  + +E +NYEI+ +   T H    L+RLS+A++VN 
Sbjct: 326 PKAPIDKPN--DKNAPQPINNNHNSRVDETTNYEIDRRIRHTQHQIGNLQRLSVAIIVN- 382

Query: 366 GRLTEVLGRSADQGK---------IDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
                     AD  K          D  L +I  +   A   + +RGD++ + +  F
Sbjct: 383 ---------YADSDKKENDDSLPLTDEKLTQIKTLAQEAMEFSEQRGDSLYVVNAPF 430


>gi|315497627|ref|YP_004086431.1| flagellar m-ring protein flif [Asticcacaulis excentricus CB 48]
 gi|315415639|gb|ADU12280.1| flagellar M-ring protein FliF [Asticcacaulis excentricus CB 48]
          Length = 561

 Score =  167 bits (424), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 132/413 (31%), Positives = 212/413 (51%), Gaps = 28/413 (6%)

Query: 51  LYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSG 110
           LY  L++ + + I+ AL +A I ++   +GS++ V    VG+ R+ LA++GLP++ S  G
Sbjct: 41  LYSNLDLKEASEITAALDQAGIKYQAKGDGSTLMVDRDTVGETRLMLASKGLPTAGS-VG 99

Query: 111 YELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGAR 170
           YELFDK  + G T F+Q +   RALEGE+ARTI ++ GI +ARVH+VMP    F++  A 
Sbjct: 100 YELFDKAPALGQTEFVQNLNNQRALEGELARTIATLKGINSARVHLVMPKRELFQEEAAA 159

Query: 171 PTASVMIRAINPSVY-KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGK 229
           PTASV++   N  +  +   AIR+LVA AVPNL    VT++D   +LL A   + N+LG 
Sbjct: 160 PTASVVVGLSNTELSGEQVRAIRNLVAGAVPNLKANAVTLVDDKNRLLAAGGEDDNLLGA 219

Query: 230 SLSIVQA-IQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSI 288
             +  +  I+  +   +   +   +G    R  V A++++++    +  YDPD +V RS 
Sbjct: 220 GGAERKTEIEETLRKRVKDIVEGVVGPGAARVTVTADIDLNSLTREQTQYDPDGQVVRST 279

Query: 289 RLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLEN-TDKKEEQSNYEI-NTKSIA 346
           R       S  +     VT + N+P       P   +  N ++   E +NYEI NTK+  
Sbjct: 280 RTDTSTDSSTDNANNGTVTAQANIP--GGAAAPGQGTTGNQSETTGELTNYEISNTKTTE 337

Query: 347 TTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSY-------LAEINKIVSAATGIN 399
                  +++L++AVVV+ G  T     +AD     +Y       + +I ++V AA G  
Sbjct: 338 VIAPG-AIKKLAVAVVVD-GTWTP----AADGKSPPTYAPRSAQDMQQIEELVRAAIGYT 391

Query: 400 SR-------RGDTITITSMDFLENQLFNSGTVQVSFM-DILSRHFATVINALV 444
            +       R D + +T++ F  +     GT   + M D       T I  L+
Sbjct: 392 DQTATNPNGRKDELKVTNIRFARDAAGLGGTTASAGMFDFTKDDIVTAIQWLI 444


>gi|298530643|ref|ZP_07018045.1| flagellar M-ring protein FliF [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298510017|gb|EFI33921.1| flagellar M-ring protein FliF [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 532

 Score =  167 bits (424), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 125/425 (29%), Positives = 220/425 (51%), Gaps = 23/425 (5%)

Query: 21  RILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNG 80
           RIL+ A + L  I  F    FF+  P Y  L   L   D +R+   L   N+ +++ D+G
Sbjct: 24  RILV-AGLGLSVIAAFAFLMFFITRPDYRVLSSDLYPEDASRVVEILESENVRYQLEDDG 82

Query: 81  SSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIA 140
           ++I VP+  V K R+ ++ +G+       G+ELFD     G T F+Q +   RAL+GE+A
Sbjct: 83  TTILVPADQVHKMRLAISGEGV-LRGEGMGFELFDDTG-IGQTDFVQNVNYQRALQGELA 140

Query: 141 RTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSA--EAIRHLVAAA 198
           RTI   S +  ARVH+VMP+   F +    P+AS++++  +    +S+  ++I +LV   
Sbjct: 141 RTISEFSEVEHARVHLVMPERSLFIEEETPPSASIVLQLRSGQRLESSQIQSIVNLVVTG 200

Query: 199 VPNLDMGDVTVLDSTGKLLTANEMERNIL-GKSLSIVQA---IQHEIEMNINKALAAFLG 254
           V  +D   VT+ D++G++L   E ++++L G S + ++     Q ++E  I   L  F G
Sbjct: 201 VEGMDSDRVTISDTSGRVLY--EPQKDLLDGMSSTQLEYQLNFQRDLERRIEHMLTPFAG 258

Query: 255 VDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPH 314
                + V A+L+ D +  R+ ++DPD  V RS       QRS T +      +E+ +P 
Sbjct: 259 PGRVIAKVNADLDFDRRTTRQEIFDPDGSVVRS------EQRS-TEESSGGTFMEEGVPE 311

Query: 315 VS-DRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLG 373
               +    P + + T + +  +N+EI+ +          ++RLS+AV+V+   +T+  G
Sbjct: 312 PDFQQGFEGPATTQETSRSDRTTNFEISREEHNIVASVGSVDRLSVAVLVDGQHVTDDAG 371

Query: 374 RSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILS 433
               +   D  +  I ++V  A G +  RGD+I ++S+DF   ++    T+    MD L+
Sbjct: 372 EMVYEPLADEEMQRIQQLVERAVGFDQERGDSIEVSSVDFGAPEVEPEPTL----MDNLA 427

Query: 434 RHFAT 438
           ++F T
Sbjct: 428 QYFQT 432


>gi|119899006|ref|YP_934219.1| flagellar MS-ring protein [Azoarcus sp. BH72]
 gi|119671419|emb|CAL95332.1| flagellar M-ring protein [Azoarcus sp. BH72]
          Length = 562

 Score =  167 bits (424), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 119/396 (30%), Positives = 191/396 (48%), Gaps = 23/396 (5%)

Query: 36  FMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARI 95
            + A  +   P Y  L+  L+  D  ++  AL + N+ +R+S NG SI VP   V + R+
Sbjct: 49  IVGALMWNRQPDYGVLFSNLDERDGGQVIAALQQQNVPYRMSPNGLSILVPQEQVHELRL 108

Query: 96  HLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVH 155
            LAA GLP      G+EL D     G++ F +++   RALEGE++RTIQSI+ + AARVH
Sbjct: 109 RLAAAGLPRGGL-VGFELMD-TQKLGVSQFNEQVNYQRALEGELSRTIQSIAAVAAARVH 166

Query: 156 IVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE---AIRHLVAAAVPNLDMGDVTVLDS 212
           + MP   +F +   +PTASVM+  + P     A     I HLV+++VP +    V ++D 
Sbjct: 167 LAMPKQTAFLRDDQKPTASVMV-TLRPGRVLDANQVAGIVHLVSSSVPRMVESGVNIIDQ 225

Query: 213 TGKLLTANE---MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMD 269
            G+LLT       +  +    L  V+ ++      I   L   +G +NFR+ V A+++ +
Sbjct: 226 NGELLTTKNDPLRQTGLDATQLEYVKEVEAGFIRRIENILQPMVGKNNFRAQVAADVDFN 285

Query: 270 TQQIREIVYDPDSKVERSIRLSKDAQRSE------------TSQPESAVTVEQNMPHVSD 317
             +     + P+   +++IR  +  + +             ++QP    T     P V  
Sbjct: 286 QVEQTAETFKPNPSPDQAIRSQQTTEETNRQPGPQGVPGALSNQPPVPATAPITTPPVGP 345

Query: 318 RKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSAD 377
            +    ++   T  +    NYE++           +L+RLS+AVVVN    T   G++  
Sbjct: 346 NQAGAAQT--GTTSRSAVLNYEVDRTIQHVKQSLGQLKRLSVAVVVNHRTETLPNGQTQT 403

Query: 378 QGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
               D  +A IN +V  A G N  RGDTI + S  F
Sbjct: 404 VPLTDEEVARINNLVREAVGYNPARGDTINVASSPF 439


>gi|52428288|gb|AAU48881.1| flagellar M-ring protein FliF [Burkholderia mallei ATCC 23344]
          Length = 543

 Score =  167 bits (424), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 115/391 (29%), Positives = 191/391 (48%), Gaps = 27/391 (6%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 26  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 85

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++S + + AARV++ +P  
Sbjct: 86  LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESSNAVRAARVYLAIPKP 143

Query: 162 GSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++      V    +  A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 144 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 203

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 204 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYG 263

Query: 280 PDSKVERS-IRLSKDAQRSE----------------TSQPESAVTVEQNMPHVSDRKVPL 322
           P+   ++S IR  + +  +E                  QP SA  V  N         P+
Sbjct: 264 PNGTPQQSAIRSQQTSSSTELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 323

Query: 323 PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKID 382
                 +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q    
Sbjct: 324 ------SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLAA 377

Query: 383 SYLAEINKIVSAATGINSRRGDTITITSMDF 413
             LA++ ++V  A G + +RGD++ + +  F
Sbjct: 378 DKLAQVQQLVKDAMGYDEKRGDSVNVVNSAF 408


>gi|167568365|ref|ZP_02361239.1| flagellar MS-ring protein [Burkholderia oklahomensis C6786]
          Length = 554

 Score =  167 bits (424), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 114/391 (29%), Positives = 191/391 (48%), Gaps = 27/391 (6%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G ++ VP++ V + R+ LA+ G
Sbjct: 37  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAVLVPANQVHETRLKLASMG 96

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RTI+SI+ + +ARVH+ +P  
Sbjct: 97  LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTIESINTVRSARVHLAIPKP 154

Query: 162 GSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++      V    +  A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 155 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 214

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 215 TASASGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYG 274

Query: 280 PDSKVERS-IRLSKDAQRSE----------------TSQPESAVTVEQNMPHVSDRKVPL 322
           P+   +++ IR  + +  +E                  QP SA  V  N         P+
Sbjct: 275 PNGAPQQTAIRSQQTSTATELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 334

Query: 323 PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKID 382
                 +D+K+  +NYE++            ++RLS+AVVVN     +  GR   Q    
Sbjct: 335 ------SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPAADAKGRVTMQPLTA 388

Query: 383 SYLAEINKIVSAATGINSRRGDTITITSMDF 413
             LA+I ++V  A G + +RGD++ + +  F
Sbjct: 389 EKLAQIQQLVKDAMGYDEKRGDSVNVVNSAF 419


>gi|310764888|gb|ADP09838.1| Flagellar basal-body M-ring protein [Erwinia sp. Ejp617]
          Length = 561

 Score =  167 bits (424), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 128/452 (28%), Positives = 218/452 (48%), Gaps = 46/452 (10%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
           F+   P Y  L+  +   D   I   LS+ N+ +RI   G +I VP + V + R+ +A Q
Sbjct: 47  FWAKEPGYRVLFNNVSDEDGGAIVSQLSQMNVPYRIDTPGGAIMVPEAQVHEVRMKMAQQ 106

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   S  G+EL D+   FG++ F +++   RALEGE+ARTI+++  I  ARVH+ +P 
Sbjct: 107 GLPKGGS-VGFELLDQ-EKFGISQFSEQVNFQRALEGELARTIENLGPIQHARVHLAVPK 164

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +   +PTASV +           +  AI HL+++AV  L  G+VT++D  G LLT
Sbjct: 165 PSMFVRDQKQPTASVNVTLAQGRTLDDGQVTAITHLISSAVSGLPAGNVTLVDQRGNLLT 224

Query: 219 ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
            +     +    +     I+ + +  I + LA  +G  N R+ V A+L+   Q+  +  Y
Sbjct: 225 QSGTGA-LQSSQVKYTNEIEADYQQRIQRLLAPLVGDSNVRTQVTAQLDFTQQERTDEQY 283

Query: 279 DPDSKVER-SIRLSKDAQRSE-------------TSQPESAVTVEQNMP---------HV 315
            P+++ E+ +IR  + +Q ++             ++QP +  T     P         + 
Sbjct: 284 QPNAEREKMAIRSRQSSQAAQGNGRGAGGVPGALSNQPPTPATAPLTKPLNAPAANGKNA 343

Query: 316 SDRKVPLPRSLEN--TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLG 373
           ++ K P    +     ++ +E +NYE++   I T      ++RLS+AVV+N        G
Sbjct: 344 NNEKTPAAGEVAQPYNNRNDETTNYELDRTLIHTKTSVGHIQRLSVAVVINH----MAQG 399

Query: 374 RSADQGKIDSY-LAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDIL 432
                G + +  LA IN +V  A G + +RGD+I I +  F       +G  +     + 
Sbjct: 400 AEGKPGPLPAAELARINTLVKEAIGYSEQRGDSINIVNSPF-------NGVAEEVMPPLW 452

Query: 433 SRH-FATVINALVFLVGTLLVTFLGLHALRRL 463
            +H F T+   ++ L   L++  +G    RRL
Sbjct: 453 QQHSFQTL---MMTLARYLVIAIIGWVMWRRL 481


>gi|94987299|ref|YP_595232.1| flagellar biosynthesis/type III secretory pathway lipoprotein
           [Lawsonia intracellularis PHE/MN1-00]
 gi|94731548|emb|CAJ54911.1| Flagellar biosynthesis/type III secretory pathway lipoprotein
           [Lawsonia intracellularis PHE/MN1-00]
          Length = 554

 Score =  167 bits (423), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 126/408 (30%), Positives = 208/408 (50%), Gaps = 23/408 (5%)

Query: 21  RILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNG 80
           ++ I  S + V  ++F+   F++N   Y  LY  L   D N I   L    + ++++DNG
Sbjct: 24  KLFIGGSAVFV-TLIFIGLMFWINRTDYKVLYSNLGPEDANHIIKTLQADKVSYQLADNG 82

Query: 81  SSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIA 140
            +I VP+S V   RI +A +G     S  G+E+FD VN  G T F+Q I   RAL+GE++
Sbjct: 83  KTILVPASSVYDLRIKIAGEG-GMVGSGIGFEIFDAVN-VGQTDFVQRINYQRALQGELS 140

Query: 141 RTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV---YKSAEAIRHLVAA 197
           RTI     + +ARVH+V+P    F +   +P+ASV+++  NPS     K  + + +++  
Sbjct: 141 RTISEFPNVESARVHLVIPQRSLFIEEQQKPSASVVLKLKNPSRKMDQKEVQGMVNMLVM 200

Query: 198 AVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQ-----AIQHEIEMNINKALAAF 252
           AV  LD   V++ DS GK L     E N+ G  LS+ Q      ++  +E  I++ L   
Sbjct: 201 AVEGLDKEHVSITDSLGKPLYFPN-EDNLAG--LSVTQREYKLKVEQGLERRIDELLIPL 257

Query: 253 LGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNM 312
           +G     + V  +L+ + + IR  +YDP+S V RS + S++  R +++       +E   
Sbjct: 258 MGQGKVIAKVNVDLDFNQKTIRREIYDPNSSVIRSEQRSEETNRGQSN-------LESGS 310

Query: 313 PHVSDRKVPLPRSLENTDKKEE--QSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTE 370
           P V+ R      ++   +   E   +NYEIN +      +  ++ R+++AVVV+   + E
Sbjct: 311 PDVNFRGDGPNGAMSTQEGTRETRTTNYEINREEQNIVGEVGQINRMTVAVVVDGTYVKE 370

Query: 371 VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQL 418
             G      +    L  I  +VS A G +  RGDTI ++S+ F E  L
Sbjct: 371 PNGEYKFVPRSQEELNRIRLLVSHAIGFDRARGDTIEVSSIPFDEADL 418


>gi|329888114|ref|ZP_08266712.1| flagellar M-ring protein FliF [Brevundimonas diminuta ATCC 11568]
 gi|328846670|gb|EGF96232.1| flagellar M-ring protein FliF [Brevundimonas diminuta ATCC 11568]
          Length = 545

 Score =  167 bits (423), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 118/373 (31%), Positives = 192/373 (51%), Gaps = 19/373 (5%)

Query: 51  LYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSG 110
           LY  L++ + + IS AL +A I +    +GS+I V    VG AR+ LA +GL +S S  G
Sbjct: 45  LYSNLDLREASEISAALDQAGIKYSSKGDGSTIFVSRDEVGTARLMLAGKGLVTSGS-VG 103

Query: 111 YELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGAR 170
           YE+FD  +  G T F Q +   RAL+GE+ARTI S+ GI +ARVHI MP    F+     
Sbjct: 104 YEIFDNQSVLGQTEFQQNLNEQRALQGELARTIMSMRGISSARVHITMPRREMFQAAAID 163

Query: 171 PTASVMIRAINPSV-YKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGK 229
           PTA+V++      +      AIR++VA++VPNL    VTV D   + L A   +      
Sbjct: 164 PTAAVVVGLSGRDLSADQVRAIRNVVASSVPNLKPDKVTVTDQANRTLAAGSEDTGFTSA 223

Query: 230 SLSIVQA-IQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSI 288
           +    +A  + +++  I   +   +G    R  V A+++      +E  +DPD +V RS 
Sbjct: 224 TAEASKASTEAQMQARIKDIVEGVVGAGAARVQVTADIDHSRSTTQEQKFDPDGQVVRST 283

Query: 289 RLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKE-EQSNYEINTKSIAT 347
             +    +  T Q +  VT   N+P     + P    + +T+ +  E +NYEI+  +  T
Sbjct: 284 STNGSQSQDTTGQQDGGVTATNNIPG---GQAPNTTPIGSTNSENTETTNYEISNTTTTT 340

Query: 348 THDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLA-------EINKIVSAATGINS 400
             +  ++++LS++V V+ G+ T     +AD     +Y A       +I  +V+AA GI+ 
Sbjct: 341 VKEPGEVKKLSVSVAVD-GKYTP----AADGKGEPTYAARTAEEVQQIKALVAAAVGIDE 395

Query: 401 RRGDTITITSMDF 413
            RGD + + ++ F
Sbjct: 396 TRGDKLEVVNVRF 408


>gi|325981191|ref|YP_004293593.1| flagellar M-ring protein FliF [Nitrosomonas sp. AL212]
 gi|325530710|gb|ADZ25431.1| flagellar M-ring protein FliF [Nitrosomonas sp. AL212]
          Length = 571

 Score =  167 bits (423), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 143/489 (29%), Positives = 232/489 (47%), Gaps = 64/489 (13%)

Query: 15  TSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDF 74
           +SL   + L L +     I L + A  +  +P Y  LY  L   D   I  AL + N+ +
Sbjct: 23  SSLSNQKKLGLITSAAAVIALLVGALMWSQAPEYRALYNNLSDHDGAAIISALQQMNVPY 82

Query: 75  RISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRA 134
             S++G +I +P   V + R+ LA QGLP      G+EL +    FG + F++++   RA
Sbjct: 83  TFSESGGTILIPEKQVHEVRLKLAGQGLPKGGL-VGFELMEN-QKFGSSQFLEQVNYQRA 140

Query: 135 LEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE---AI 191
           LEGE+AR++QS+S + +ARVH+ +     F +   +P+ SV++  + P    S E   AI
Sbjct: 141 LEGELARSVQSLSAVQSARVHLAIAKPSVFSREKQQPSVSVLLN-LYPGRVLSIEQVSAI 199

Query: 192 RHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN---ILGKSLSIVQAIQHEIEMNINKA 248
            HL+A++VPNL + +VTV+D  G LL++   ++       K L+ +Q ++      I   
Sbjct: 200 VHLMASSVPNLPVKNVTVVDQNGNLLSSQNDKKEDSRFDAKQLAYIQELEENYIRRIETI 259

Query: 249 LAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS-------- 300
           L    G  N R+ V A+++    +  E  Y P++    + R S  +Q++  S        
Sbjct: 260 LTPITGATNVRAQVTADVDFSRIERAEETYRPNNT--EADRASIRSQQTHESMSIGSKFD 317

Query: 301 ----------QPESAVT-VE-----------QNMPHVSDRKVPLPRSLENTDKKEEQS-N 337
                      PE A+  +E           +     +D   PLP     TDKK+E + N
Sbjct: 318 GGIPGALTNRPPEPAIAPIEAGGKKPAGDKAEGDEEETDSTPPLP-----TDKKKESTIN 372

Query: 338 YEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATG 397
           YE++     T      ++RLS AVVVN  +  +  G    +      + EIN +V  A G
Sbjct: 373 YEVDKTVQHTQQSTGNIKRLSAAVVVNYRKKVDESGAITYEPLSAEEIKEINNLVREAMG 432

Query: 398 INSRRGDTITITSMDFLENQLFNSGT---VQVSFMD-----ILSRHFAT---VINALVFL 446
            N RRGD++T+T      N LF   T   ++V F       +L++ FA    +I  ++F 
Sbjct: 433 YNERRGDSLTVT------NGLFTGETETVLEVPFWKDPDVIMLAKDFAKQLLIIGVVLFF 486

Query: 447 VGTLLVTFL 455
           +  +L  FL
Sbjct: 487 LLKILRPFL 495


>gi|320529385|ref|ZP_08030473.1| flagellar M-ring protein FliF [Selenomonas artemidis F0399]
 gi|320138351|gb|EFW30245.1| flagellar M-ring protein FliF [Selenomonas artemidis F0399]
          Length = 526

 Score =  167 bits (423), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 127/459 (27%), Positives = 226/459 (49%), Gaps = 33/459 (7%)

Query: 19  RTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISD 78
           R R ++L S + +  ++F  + ++ + P    L+  +E  D   ++  L EA I + + D
Sbjct: 18  RQRYIMLGSALAILALIFGLSFWYGSKPDMVPLFTDMETKDAGEVANQLREAKISYEVQD 77

Query: 79  --NGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALE 136
             NG++I VP++ V +AR++LA QGLP    N G+E+FD  +  G+T F   +  ++AL+
Sbjct: 78  GKNGTTILVPTTNVHEARLNLATQGLPRG--NKGFEIFDD-SKLGVTEFQNRVNYLQALQ 134

Query: 137 GEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS---VYKSAEAIRH 193
           GE+ RTI+ I  +  ARVHIV+P+   ++K     TAS+M+R + P      K  + I +
Sbjct: 135 GELTRTIEQIDAVEKARVHIVLPEDSLYKKEEKPATASIMLR-LKPGTELTKKEIKGIVN 193

Query: 194 LVAAAVPNLDMGDVTVLDSTGKLLT--ANEMERNILGKSLS---IVQAIQHEIEMNINKA 248
           L A +V  L   ++T++D TGK+L    ++ E+++  K+L+   + + +Q  IE  +   
Sbjct: 194 LAAHSVKGLTPENITIVDDTGKILNDPDDQDEKSVGVKTLTQLDMTRKVQDNIEKKVQSL 253

Query: 249 LAAFLGVDNFRSAVVAELNMDTQQIREIVYDP---DSKVERSIRLSKDAQRSETSQPESA 305
           L   LG     + V  EL+ D +   +  + P   D+ + RS +   +     ++ P   
Sbjct: 254 LDQTLGEGRAVARVSVELDFDDRLTDKQTFTPVVDDAGIIRSQQDISENYTGSSTNPGGP 313

Query: 306 VTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNK 365
             V+ N+P   +++       E   KKE   NYEIN +          + RL++AV+VN 
Sbjct: 314 AGVQSNVPGYVEQESNANAQYE---KKESTKNYEINEERQHVIASPGSIRRLTVAVLVND 370

Query: 366 GRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQ 425
                       Q + +S L    + VS+A GIN  RGDTI++  + F +         +
Sbjct: 371 ---------DVTQPQQESIL----RTVSSAAGINQARGDTISVEPLPFSKEAAERRAAEE 417

Query: 426 VSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLH 464
            +  D   R F   +  ++ ++  ++   L     +RL 
Sbjct: 418 QAEKDRQDRIFYAQVGIVLLIIALIVGGILMYRRKKRLE 456


>gi|171321708|ref|ZP_02910625.1| flagellar M-ring protein FliF [Burkholderia ambifaria MEX-5]
 gi|171093009|gb|EDT38241.1| flagellar M-ring protein FliF [Burkholderia ambifaria MEX-5]
          Length = 587

 Score =  167 bits (423), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 114/386 (29%), Positives = 191/386 (49%), Gaps = 16/386 (4%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VPS+ V + R+ LAA 
Sbjct: 79  LWSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPSNQVHETRLKLAAL 138

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   S  G+EL D    FG++ F +++   RALEGE+ RTI+SI+ +  ARVH+ +P 
Sbjct: 139 GLPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTIESINAVRGARVHLAIPK 196

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSA--EAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV +      V      +AI  +V++ VP++   +VT++D  G LLT
Sbjct: 197 PSVFVRDKEAPSASVFVDLYPGRVLDEGQVQAITRMVSSGVPDMPAKNVTIVDQDGNLLT 256

Query: 219 ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
                  +    L  VQ ++   +  I+  LA   G  N RS V A+++    +     Y
Sbjct: 257 QTASASGLDASQLKYVQQVERNTQKRIDAILAPIFGTGNARSQVSADIDFSKLEQTSESY 316

Query: 279 DPDSKVER-SIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLP----------RSLE 327
            P+   ++ +IR  + +  +E +Q   A  V   + +   +    P          +S  
Sbjct: 317 APNGTPQQAAIRSQQTSSATELAQ-GGASGVPGALSNTPPQPASAPIVAGNGQNGAQSTP 375

Query: 328 NTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAE 387
            +D+K++ +NYE++            ++RLS+AVVVN   + +  G    Q      LA+
Sbjct: 376 VSDRKDQTTNYELDKTIRHVEQPMGNVKRLSVAVVVNYQPVADAKGHVTMQPLPPPKLAQ 435

Query: 388 INKIVSAATGINSRRGDTITITSMDF 413
           I ++V  A G + +RGD++ + +  F
Sbjct: 436 IEQLVKDAMGYDEKRGDSVNVVNSAF 461


>gi|115353160|ref|YP_774999.1| flagellar MS-ring protein [Burkholderia ambifaria AMMD]
 gi|115283148|gb|ABI88665.1| flagellar M-ring protein FliF [Burkholderia ambifaria AMMD]
          Length = 587

 Score =  167 bits (422), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 113/386 (29%), Positives = 191/386 (49%), Gaps = 16/386 (4%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VPS+ V + R+ LAA 
Sbjct: 79  LWSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPSNQVHETRLKLAAL 138

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   S  G+EL D    FG++ F +++   RALEGE+ RTI+SI+ +  ARVH+ +P 
Sbjct: 139 GLPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTIESINAVRGARVHLAIPK 196

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSA--EAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV +      V      +AI  +V++ VP++   +VT++D  G LLT
Sbjct: 197 PSVFVRDKEAPSASVFVDLYPGRVLDEGQVQAITRMVSSGVPDMPAKNVTIVDQDGNLLT 256

Query: 219 ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
                  +    L  VQ ++   +  I+  LA   G  N RS V A+++    +     Y
Sbjct: 257 QTASASGLDASQLKYVQQVERNTQKRIDSILAPIFGTGNARSQVSADIDFSKLEQTSESY 316

Query: 279 DPDSKVER-SIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLP----------RSLE 327
            P+   ++ +IR  + +  +E +Q   A  V   + +   +    P          +S  
Sbjct: 317 SPNGTPQQAAIRSQQTSSATELAQ-GGASGVPGALSNTPPQPASAPIVAGNGQNGAQSTP 375

Query: 328 NTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAE 387
            +D+K++ +NYE++            ++RLS+AVVVN   + +  G    Q      LA+
Sbjct: 376 VSDRKDQTTNYELDKTIRHVEQPMGNVKRLSVAVVVNYQPVADAKGHVTMQPLPPPKLAQ 435

Query: 388 INKIVSAATGINSRRGDTITITSMDF 413
           + ++V  A G + +RGD++ + +  F
Sbjct: 436 VEQLVKDAMGYDEKRGDSVNVVNSAF 461


>gi|170700811|ref|ZP_02891802.1| flagellar M-ring protein FliF [Burkholderia ambifaria IOP40-10]
 gi|170134298|gb|EDT02635.1| flagellar M-ring protein FliF [Burkholderia ambifaria IOP40-10]
          Length = 587

 Score =  167 bits (422), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 114/386 (29%), Positives = 191/386 (49%), Gaps = 16/386 (4%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VPS+ V + R+ LAA 
Sbjct: 79  LWSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPSNQVHETRLKLAAL 138

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   S  G+EL D    FG++ F +++   RALEGE+ RTI+SI+ +  ARVH+ +P 
Sbjct: 139 GLPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTIESINAVRGARVHLAIPK 196

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSA--EAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV +      V      +AI  +V++ VP++   +VT++D  G LLT
Sbjct: 197 PSVFVRDKEAPSASVFVDLYPGRVLDEGQVQAITRMVSSGVPDMPAKNVTIVDQDGNLLT 256

Query: 219 ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
                  +    L  VQ ++   +  I+  LA   G  N RS V A+++    +     Y
Sbjct: 257 QTASASGLDASQLKYVQQVEGNTQKRIDAILAPIFGTGNARSQVSADIDFSKLEQTSESY 316

Query: 279 DPDSKVER-SIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLP----------RSLE 327
            P+   ++ +IR  + +  +E +Q   A  V   + +   +    P          +S  
Sbjct: 317 GPNGTPQQAAIRSQQTSSATELAQ-GGASGVPGALSNTPPQPASAPIVAGNGQNGAQSTP 375

Query: 328 NTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAE 387
            +D+K++ +NYE++            ++RLS+AVVVN   + +  G    Q      LA+
Sbjct: 376 VSDRKDQTTNYELDKTIRHVEQPMGNVKRLSVAVVVNYQPVADAKGHVTMQPLPPPKLAQ 435

Query: 388 INKIVSAATGINSRRGDTITITSMDF 413
           I ++V  A G + +RGD++ + +  F
Sbjct: 436 IEQLVKDAMGYDEKRGDSVNVVNSAF 461


>gi|167561148|ref|ZP_02354064.1| flagellar MS-ring protein [Burkholderia oklahomensis EO147]
          Length = 490

 Score =  166 bits (421), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 114/391 (29%), Positives = 191/391 (48%), Gaps = 27/391 (6%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G ++ VP++ V + R+ LA+ G
Sbjct: 50  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAVLVPANQVHETRLKLASIG 109

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RTI+SI+ + +ARVH+ +P  
Sbjct: 110 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTIESINTVRSARVHLAIPKP 167

Query: 162 GSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++      V    +  A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 168 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 227

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 228 TASASGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYG 287

Query: 280 PDSKVERS-IRLSKDAQRSE----------------TSQPESAVTVEQNMPHVSDRKVPL 322
           P+   +++ IR  + +  +E                  QP SA  V  N         P+
Sbjct: 288 PNGAPQQTAIRSQQTSTATELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 347

Query: 323 PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKID 382
                 +D+K+  +NYE++            ++RLS+AVVVN     +  GR   Q    
Sbjct: 348 ------SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPAADAKGRVTMQPLTA 401

Query: 383 SYLAEINKIVSAATGINSRRGDTITITSMDF 413
             LA+I ++V  A G + +RGD++ + +  F
Sbjct: 402 EKLAQIQQLVKDAMGYDEKRGDSVNVVNSAF 432


>gi|114330758|ref|YP_746980.1| flagellar M-ring protein FliF [Nitrosomonas eutropha C91]
 gi|114307772|gb|ABI59015.1| flagellar M-ring protein FliF [Nitrosomonas eutropha C91]
          Length = 547

 Score =  166 bits (421), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 121/394 (30%), Positives = 200/394 (50%), Gaps = 28/394 (7%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  L   +   I  AL + N+ ++ S++  SI VP + V + R+HLA Q
Sbjct: 48  LWSQTPDYRVLYANLSEQEGGAIIDALQKMNVPYQFSESSGSILVPVNQVHEVRLHLAGQ 107

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP  +  SG+E+ +    FG + F++++   RALEGE+AR+IQS+S +  ARVH+ +  
Sbjct: 108 GLPKGNL-SGFEILEN-QKFGSSQFLEQVNYQRALEGELARSIQSLSAVQGARVHLAIAR 165

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +   +P+ SV++     R ++P   +   AI HLV++++P+L + +VTV+D  G 
Sbjct: 166 PSVFTRERQQPSVSVLLNLHHGRMLSP---EQVSAIVHLVSSSIPDLTVKNVTVVDQQGN 222

Query: 216 LLTA---NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQ 272
           LL+    N+ME  +    L  VQ ++      I   L    G DN  + V A+++    +
Sbjct: 223 LLSGQKENQMETGLDPGQLKYVQDMEQNFVRRIEAILTPVTGQDNVHAQVTADIDFSRIE 282

Query: 273 IREIVYDPDSKVERSIRLSKDAQRSET---SQPESAV--TVEQNMPHVSDRKVPLPRSLE 327
             E  Y P++  E S  + +  Q+SE+   SQP+  V   +    P  +   V      E
Sbjct: 283 RSEETYRPNNNPEESAAV-RSQQKSESVSISQPDGGVPGALSNRPPAPAQAPVETKEGQE 341

Query: 328 NT-------DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVN-KGRLTEVLGRSADQG 379
            T        +KE  +NYE++           ++ RLS AVVVN + R+ E  G   ++ 
Sbjct: 342 ETAQTTPTDTRKESTTNYEVDKTISHIRQSTGQINRLSAAVVVNYRTRMNEE-GNPINEP 400

Query: 380 KIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
                + +I  +V  A G +  RGDT+T+T+  F
Sbjct: 401 LSGEEIEKITALVKQAIGFSEARGDTLTVTNSQF 434


>gi|238927418|ref|ZP_04659178.1| flagellar M-ring protein FliF [Selenomonas flueggei ATCC 43531]
 gi|238884700|gb|EEQ48338.1| flagellar M-ring protein FliF [Selenomonas flueggei ATCC 43531]
          Length = 526

 Score =  166 bits (421), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 128/459 (27%), Positives = 224/459 (48%), Gaps = 33/459 (7%)

Query: 19  RTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISD 78
           R R ++L S +++  ++F  + ++ + P    L+  +E  D   ++  L E+ I + I +
Sbjct: 18  RQRYIMLGSALVILALIFGLSFWYGSKPDMVPLFTDMETKDAGEVANQLRESKISYEIQE 77

Query: 79  N--GSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALE 136
           N  G++I VP++ V +AR++LA QGLP    N G+E+FD  +  G+T F   +  ++AL+
Sbjct: 78  NKSGTTILVPTANVHEARLNLAVQGLPRG--NKGFEIFDD-SKLGVTEFQNRVNYLQALQ 134

Query: 137 GEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS---VYKSAEAIRH 193
           GE+ RTI+ I  +  ARVHIV+P+   ++K     TAS+M+R + P+     K  + I +
Sbjct: 135 GELTRTIEQIEAVDKARVHIVLPEDSLYKKEEKPATASIMLR-LKPNTELTKKEIKGIVN 193

Query: 194 LVAAAVPNLDMGDVTVLDSTGKLLT-ANEMERNILG----KSLSIVQAIQHEIEMNINKA 248
           L A +V  L   ++T++D TGK+L   ++ +   LG      L + + +Q  IE  I   
Sbjct: 194 LAAHSVKGLTPENITIVDDTGKILNDPDDQDEKGLGVKTITQLDMTRKMQDSIEKKIQTL 253

Query: 249 LAAFLGVDNFRSAVVAELNMDTQQIREIVYDP---DSKVERSIRLSKDAQRSETSQPESA 305
           L   LG     + V  EL+ D +      + P   DS + RS +   ++    ++ P   
Sbjct: 254 LDQTLGEGRAFARVSLELDFDDRLTDRQTFTPVVDDSGIVRSQQDISESYTGSSTNPGGP 313

Query: 306 VTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNK 365
             V+ N+P   +++     + E   KKE   NYEIN +          + R+++AV+VN 
Sbjct: 314 AGVQSNVPGYVEQESNANAAYE---KKESTKNYEINEERQHVIASPGSIRRMTVAVLVND 370

Query: 366 GRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQ 425
                       Q + +S L    + VS+A GIN  RGDTI++  + F            
Sbjct: 371 ---------DVTQPQQESIL----RTVSSAAGINQARGDTISVEPLPFSTEAAERRAAEL 417

Query: 426 VSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLH 464
            +  D   R F   + A++ ++  ++   L     +RL 
Sbjct: 418 QAEKDRQDRIFYMQVGAVLLIIALIVAAVLMYRRKKRLE 456


>gi|83859389|ref|ZP_00952910.1| flagellar M-ring protein [Oceanicaulis alexandrii HTCC2633]
 gi|83852836|gb|EAP90689.1| flagellar M-ring protein [Oceanicaulis alexandrii HTCC2633]
          Length = 551

 Score =  166 bits (421), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 169/569 (29%), Positives = 274/569 (48%), Gaps = 47/569 (8%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFF---VNSPHYDNLYVKLEVS 58
           AIL+QL +F      +GR     LA+++ +      A  FF   +NS     L+  L  +
Sbjct: 3   AILEQLSRF-----GVGR-----LAAILGLTAGAAAALVFFTMSMNSNGQALLFSGLGPA 52

Query: 59  DVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVN 118
           D   +S  L +A I + + + GS++ V +  V +AR+ +A+ G  S  S  GYE+FD+ +
Sbjct: 53  DAAAVSQRLDQAGISYELQEGGSAVYVSTDQVDEARMRVASGGALSFGS-VGYEIFDETD 111

Query: 119 SFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR 178
           + G TSF+Q +   RALEGE+AR+I +++ + AARVH+V+P+   F +    P+ASV+I 
Sbjct: 112 ALGTTSFVQNVNAKRALEGELARSINTLNTVSAARVHLVLPERRLFSREQQEPSASVVIS 171

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA-NEMERNILGKSLSIVQ-A 236
                       IR+LVA AVP L    +T+ D  G+LL A ++ E ++LG  L   Q A
Sbjct: 172 VRGELPSAQINTIRNLVATAVPGLQANRITLADDQGRLLAAPSDAEGDVLGAMLDDRQNA 231

Query: 237 IQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQR 296
           I+ +++  I   +   +G    R AV AE+N ++Q    + YDPD +VE S R + + +R
Sbjct: 232 IERDLQQKIRDLVEGIVGSGGVRVAVTAEINRESQTRTRLEYDPDGQVEVS-RRAIEERR 290

Query: 297 SETSQPESAVTVEQNMPHV---SDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYK 353
           SE       V+V +N P     ++ + PL  + E++  +    N +  T SI    D   
Sbjct: 291 SEPVN-SGGVSVSENTPDAEAGANGETPLLATSESSTTERNYQNTQEETVSIIQAGD--- 346

Query: 354 LERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINS----RRGDTI-TI 408
           LERL+++VVV++  +    G  + + + ++ L +I  +V+AA G  +      GD I  +
Sbjct: 347 LERLAVSVVVDEVAVVGEDGTLSFEPRSEAELTQIRNLVAAAVGFPTDTTLTDGDQILQV 406

Query: 409 TSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDD 468
           TSM F    L   GT       +    F  +    V  V  LLV  L    L        
Sbjct: 407 TSMRFNRPDL-TLGTPAPEGFSLARLDFMRIAEIAVLFVTALLVILLVARPL-------- 457

Query: 469 AKKGEVGGKSILSPPPISSAVTTGLMPNDNIA--LDSSNQDIFSHSRNLQ------SRIN 520
             +G VG  S   P    +    G    DN+   L +S+  +     +        ++I 
Sbjct: 458 -VQGAVGNVSAARPALAGAGSGGGKALPDNVQALLGNSDGTVMLPEGDPSDDHIDVAQIE 516

Query: 521 SYVSKQSDLRLLHMIEINEERFAKILRKW 549
             V K S  ++  ++E + +    ILR W
Sbjct: 517 GQVKKSSVRKVAALVEQHPDESMSILRTW 545


>gi|161485650|ref|NP_419721.2| flagellar MS-ring protein [Caulobacter crescentus CB15]
 gi|221233887|ref|YP_002516323.1| flagellar MS-ring protein [Caulobacter crescentus NA1000]
 gi|220963059|gb|ACL94415.1| flagellar M-ring protein FliF [Caulobacter crescentus NA1000]
          Length = 554

 Score =  166 bits (420), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 140/531 (26%), Positives = 255/531 (48%), Gaps = 38/531 (7%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            F+     + LY  L++ + + ++ AL +A I +    +GS+I VP   V  AR+ +A +
Sbjct: 35  MFMGKEPSELLYSNLDLKEASEVTQALDQAGIKYETKGDGSTIMVPRDKVASARLMVAGK 94

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GL SS S  GYE+FD  N+ G T F+Q++ R RAL+GE+ RTI+++ G+ + RVH+V+P 
Sbjct: 95  GLVSSGS-IGYEIFDTNNALGQTDFVQQLNRQRALQGELERTIKAMQGVNSVRVHLVLPK 153

Query: 161 MGSFRKIGARPTASVMI--RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +   +P+A+V I   +  PS      AI++LV+++VPN+    V V+D  GK L+
Sbjct: 154 RQLFEEDAEQPSAAVTIGVGSREPS-SDMVRAIQNLVSSSVPNMKAEKVAVIDQHGKTLS 212

Query: 219 ANEMERNILGKSLSIVQAIQHEIEMNINKA----LAAFLGVDNFRSAVVAELNMDTQQIR 274
           A   E ++ GK   + Q  + E+E  I K     +   LG    R  V AEL+++    +
Sbjct: 213 APSDE-SLAGK---MAQDRKSEVEARIAKTVKDMIEGVLGPGKARVNVTAELDLNRVTTQ 268

Query: 275 EIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEE 334
           E  +DPD +V RS   ++ + +   +   + VT   N+P          +    T + + 
Sbjct: 269 EERFDPDGQVIRSESTTEASSQENKNDDNAGVTAAANVPGGQGANG-FQQLGSRTGQNDA 327

Query: 335 QSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSY-------LAE 387
            +NYEI+     T  +   ++++++AV ++      V    A  GK  +Y       + +
Sbjct: 328 VTNYEISKSVTTTVQEPGTIKKIAVAVAIDG-----VSAPMAADGKPGAYTPRTAQEIQQ 382

Query: 388 INKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLV 447
           I ++V  A G ++ RGD + +T++ F + +  + G  +   +    ++   ++ A    V
Sbjct: 383 IEELVKTAVGFDAERGDQVRVTNIKFPQPE--DQGLEEQGLLAGFDKN--DIMRAAELGV 438

Query: 448 GTLLVTFLGLHALRR-LHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQ 506
             ++   + L A+R  + N+     G++        PP++  VT        + +D S +
Sbjct: 439 LAVVALLILLFAVRPFIKNLSAPAPGQIALAGPSGGPPVTRLVTLADGTQQQVVVDQSGE 498

Query: 507 DIFSHSRNLQ--------SRINSYVSKQSDLRLLHMIEINEERFAKILRKW 549
            I      +         ++I   V   S  R+   +E + +    ILR W
Sbjct: 499 PIALAGPPVSDIDQRIDIAKIEGQVKASSIKRVSEFVEKHPDESVAILRNW 549


>gi|316935488|ref|YP_004110470.1| flagellar M-ring protein FliF [Rhodopseudomonas palustris DX-1]
 gi|315603202|gb|ADU45737.1| flagellar M-ring protein FliF [Rhodopseudomonas palustris DX-1]
          Length = 537

 Score =  166 bits (419), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 152/555 (27%), Positives = 255/555 (45%), Gaps = 33/555 (5%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           +  LL F K G    R   +I  +V LV    F+  R  V+ P    LY  L V D + I
Sbjct: 1   MQNLLSFLK-GLGAARLMAMIAVTVALVGFFAFVIMR--VSQPQMTTLYTDLSVEDSSSI 57

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
              L    I F + + G+ + VP   V + R+ LA +G        GYE+FDK ++ G T
Sbjct: 58  IKELERQGIPFEMRNEGAILLVPKDKVTRLRMKLA-EGGLPKGGGVGYEIFDKSDALGTT 116

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS 183
           SF+Q I  +RALEGE++RTI++I  + AARVH+V+P    F +    P+AS+++R     
Sbjct: 117 SFVQNINHLRALEGELSRTIRAIDRVQAARVHLVLPARPLFSREAPEPSASIVLRVRGAL 176

Query: 184 VYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-----TANEMERNILGKSLSIVQAIQ 238
             +   AIRHLVA+AV  L    V+++D  G+LL     +  +ME     +  +   A +
Sbjct: 177 EPQQVRAIRHLVASAVNGLKPQRVSIVDEAGQLLADGSASGEQMEGATSDERRA---AFE 233

Query: 239 HEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE 298
             +   I   +++ +G    R  V A+ + +        +DP+ +V RS +  +++  + 
Sbjct: 234 KRMRHQIEGIVSSVVGSGRARVQVSADFDYNKITQTSDTFDPEGRVLRSSQTREES--AA 291

Query: 299 TSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLS 358
           TS  +  VTV   +P  +  +    R +  + K EE +NYEI+  +     +  ++ RLS
Sbjct: 292 TSAADGQVTVNNELPGANQGQGAGARDV--SKKSEETNNYEISRVTKTEVTEAGRVNRLS 349

Query: 359 IAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQL 418
           +AV+V+     +  G      +    L  I  +V +A G + +RGD I + ++ F E   
Sbjct: 350 VAVLVDGAYTKDDKGELVYAERSKEQLDRIAALVRSAIGFDQKRGDQIEVVNLKFAEAPQ 409

Query: 419 FNSGTVQVSFMDILSRHFATVIN----ALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEV 474
                     M +       ++N     ++FL+G L+V F+ +  L +   +   +  E 
Sbjct: 410 IEKLPEPAGLMGMFQFTKDDIMNMIQLGVMFLLG-LVVLFMVIRPLVK-RVLAAEQTPEA 467

Query: 475 GGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHM 534
            G           A+  G +P   I +D         S    +++   V  QS  R+  +
Sbjct: 468 AGL---------PALADGTVP--QIGVDGQPVAPGMPSMIDIAQVQGQVHAQSVHRVGEL 516

Query: 535 IEINEERFAKILRKW 549
            E N    A I+R+W
Sbjct: 517 AERNPNETAAIVRQW 531


>gi|86748397|ref|YP_484893.1| flagellar MS-ring protein [Rhodopseudomonas palustris HaA2]
 gi|86571425|gb|ABD05982.1| flagellar M-ring protein FliF [Rhodopseudomonas palustris HaA2]
          Length = 532

 Score =  166 bits (419), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 150/557 (26%), Positives = 256/557 (45%), Gaps = 41/557 (7%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           +  LL F K    LG  R++ + +V +  +  F      V+ P    LY  L V D + I
Sbjct: 1   MQSLLGFLKG---LGAARVMAMIAVTMALLGFFAFVIMRVSQPQMTTLYTDLSVEDSSSI 57

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
              L    I F + ++G+ + VP   V + R+ LA +G        GYE+FDK ++ G T
Sbjct: 58  IKELERQAIPFEMRNDGAILMVPKDKVTRLRMKLA-EGGLPKGGGVGYEIFDKSDALGTT 116

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS 183
           SF+Q I  +RALEGE++RTI++I  + AARVH+V+P+   F +    P+AS+++R     
Sbjct: 117 SFVQNINHLRALEGELSRTIRAIDRVQAARVHLVLPERPLFSRETPEPSASIVLRVRGAL 176

Query: 184 VYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEM 243
             +   AIRHLVA+AV  L    V+++D  G+LL       N    +    +    E  M
Sbjct: 177 EPQQVRAIRHLVASAVNGLKPQRVSIVDEGGQLLADGSASANAADGAAGDERRTSFEKRM 236

Query: 244 --NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
              I   +++ +G    R  V A+ + +        +DP+ +V RS +  ++  +++TS 
Sbjct: 237 RNEIEGIVSSVVGSGRARVQVTADFDYNKITQTSDKFDPEGRVLRSSQTREE--QAQTSA 294

Query: 302 PESAVTVEQNMPHVSDRKVPLPRSLENTDKK-EEQSNYEINTKSIATTHDNYKLERLSIA 360
            +  VTV   +P     + P      +  KK EE +NYEI+  +     +  ++ RLS+A
Sbjct: 295 ADGQVTVNNELP---GNQAPGGAGARDQSKKSEETNNYEISRVTKTEVTEAGRVNRLSVA 351

Query: 361 VVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN 420
           V+V+     +  G      +    L  I  +V +A G + +RGD I + ++ F E     
Sbjct: 352 VLVDGSYTKDEKGELVYAERPKEQLDRIAALVRSAIGFDQKRGDQIEVVNLRFAEAPQVE 411

Query: 421 S--------GTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKG 472
                    G +Q +  DI++     +I   V  V  L+V F+ +  L            
Sbjct: 412 KLPEPAGLLGMLQFTKDDIMN-----MIQLGVMFVLGLVVLFMVIRPLV----------- 455

Query: 473 EVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLL 532
               K +L+  P S A     + + ++    S+    +   ++ +++   V  QS  R+ 
Sbjct: 456 ----KRVLASDPASEASGLPALADGSLPQIGSDGQAGTSMIDI-AQVQGQVHAQSVHRVG 510

Query: 533 HMIEINEERFAKILRKW 549
            + E N    A I+R+W
Sbjct: 511 ELAERNPNETAAIVRQW 527


>gi|114319870|ref|YP_741553.1| flagellar M-ring protein FliF [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226264|gb|ABI56063.1| flagellar M-ring protein FliF [Alkalilimnicola ehrlichii MLHE-1]
          Length = 580

 Score =  166 bits (419), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 132/437 (30%), Positives = 218/437 (49%), Gaps = 44/437 (10%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           +DQL   F    ++ R   L LA V+L  +   +    +   P Y  L+ +L+  D   +
Sbjct: 38  MDQLEGLFGGRQNVMR---LGLAVVLLFTVAAGVLLYLWAQEPSYRTLFSELDDQDAAAV 94

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
              L E  I +R+ +   ++ VPS  V  AR+ LAA+GLP  +   G+E+  + ++FG +
Sbjct: 95  IEQLEEQGIPYRLDERTGAVRVPSDQVHPARLQLAAEGLPRGT-GFGFEMLQEDSAFGTS 153

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI-----R 178
            FM+     RALE E+AR+I ++  + AARVH+ +P    F +   +P ASV++     R
Sbjct: 154 EFMEGARFDRALETELARSIGTLRQVDAARVHLALPRESVFVRDRRQPRASVVVNLAQGR 213

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSL-SIVQAI 237
            +N    +  +AI H+VA++VP+L   +V+V+D  G+LLT +E      G+ L S     
Sbjct: 214 RLN---DEQVDAIVHMVASSVPDLAHENVSVVDERGRLLTRDE------GRGLASTAGQF 264

Query: 238 QHEIEMN------INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLS 291
           Q++ ++       I   LA  +G +  R+ V A L+   QQ  E +YDPDS+V RS  L 
Sbjct: 265 QYKTQVEETYVRRIEDLLAPLVGRNRVRAQVNASLDFSEQQRTEELYDPDSRVIRSEAL- 323

Query: 292 KDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKE----------EQSNYEIN 341
              Q   T Q   A      +P     + P    L+  +  E          E  NYEI 
Sbjct: 324 ---QGRRTQQGADAAM---GVPGALTNQPPGAGQLDGEEAPENPPPVDISSSETRNYEI- 376

Query: 342 TKSIATTHDNY-KLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINS 400
           ++++    D    ++R+S+AVVV++   T+  G +  +   D  +  IN +V  A G ++
Sbjct: 377 SRTLRQVRDPIGSIQRVSVAVVVDERITTDEEGNTVREPLSDEEMDRINALVQEAVGFDA 436

Query: 401 RRGDTITITSMDFLENQ 417
            RGD++ + +  FLE +
Sbjct: 437 ARGDSVNVVNAAFLEEE 453


>gi|304438472|ref|ZP_07398412.1| flagellar M-ring protein FliF [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304368555|gb|EFM22240.1| flagellar M-ring protein FliF [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 526

 Score =  165 bits (418), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 125/459 (27%), Positives = 225/459 (49%), Gaps = 33/459 (7%)

Query: 19  RTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISD 78
           R R ++L S + + +++F  + ++ + P    L+  +E  D   ++  L E+ I + I +
Sbjct: 18  RQRYIMLGSALAILVLVFGLSFWYGSKPDMVPLFTDMETKDAGEVANQLRESKISYEIQE 77

Query: 79  N--GSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALE 136
           N  G++I VP++ V +AR++LA QGLP    N G+E+FD  +  G+T F   +  ++AL+
Sbjct: 78  NKSGTTILVPTANVHEARLNLAVQGLPHG--NKGFEIFDD-SKLGVTEFQNRVNYLQALQ 134

Query: 137 GEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS---VYKSAEAIRH 193
           GE+ RTI+ I  +  ARVHIV+P+   ++K     TAS+M+R + P      K  + I +
Sbjct: 135 GELTRTIEQIEAVDKARVHIVLPEDSLYKKEEKPATASIMLR-LKPHAELTKKEIKGIVN 193

Query: 194 LVAAAVPNLDMGDVTVLDSTGKLLT--ANEMERNILGKS---LSIVQAIQHEIEMNINKA 248
           L A ++  L   ++T++D TGK+L    ++ E+ +  K+   L + + +Q  IE  +   
Sbjct: 194 LAAHSIKGLTPENITIVDDTGKILNDPDDQDEKGLGAKTITQLEMTRKVQDNIEKKVQTL 253

Query: 249 LAAFLGVDNFRSAVVAELNMDTQQIREIVYDP---DSKVERSIRLSKDAQRSETSQPESA 305
           L   LG     + V  EL+ D +      + P   D+ + RS +   ++    ++ P   
Sbjct: 254 LDQTLGEGRAFARVSVELDFDDRLTDRQTFTPVVDDAGIIRSQQDISESYNGSSTNPGGP 313

Query: 306 VTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNK 365
             V+ N+P   +++     + E   KKE   NYEIN +          + R+++AV+VN 
Sbjct: 314 AGVQSNVPGYVEQESNANAAYE---KKESTKNYEINEERQHVIASPGSIRRMTVAVLVND 370

Query: 366 GRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQ 425
                       Q + +S L    + VS+A GIN  RGDTI++  + F            
Sbjct: 371 ---------DVTQPQQESIL----RTVSSAAGINQTRGDTISVEPLPFSTEAADRRAAEL 417

Query: 426 VSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLH 464
            +  D   R F   + A++ ++  ++   L     +RL 
Sbjct: 418 QAEKDRQDRIFYMQVGAVLLIIALIVAAILMYRRKKRLE 456


>gi|300693364|ref|YP_003749337.1| flif: flagellar biosynthesis protein, m-ring protein, belongs to
           the flif family [Ralstonia solanacearum PSI07]
 gi|299075401|emb|CBJ34696.1| FliF: Flagellar biosynthesis protein, M-ring protein, Belongs to
           the fliF family [Ralstonia solanacearum PSI07]
          Length = 611

 Score =  165 bits (418), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 141/482 (29%), Positives = 234/482 (48%), Gaps = 76/482 (15%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P+Y  LY  +  SD   I  AL + N+ +R +D GS+I VP + V +AR+ LAAQ
Sbjct: 66  LWSRTPNYGVLYSNVADSDGGAIIAALQQMNVPYRFADGGSAIMVPEANVHEARLKLAAQ 125

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP     +G+EL +    FG + F +++   RALEGE+ARTIQ++  + +ARVH+ +  
Sbjct: 126 GLPKGGL-AGFELMEN-QKFGTSQFAEQVNYQRALEGELARTIQAMQEVQSARVHLALSK 183

Query: 161 MGSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +  A+P+ASV+++ + P         +AI HLV+++VPNL + +VTV+D +G+LL
Sbjct: 184 PSVFVREQAKPSASVLLK-LYPGRMLDRSQVQAIGHLVSSSVPNLPLANVTVVDQSGRLL 242

Query: 218 TANEMERNILG---KSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMD-TQQI 273
           +++  + N  G     L+ V+ I+      I   L   LG DN R+ V A++++D T+Q+
Sbjct: 243 SSS-FQDNASGLDPTQLNYVRDIEQGYIKRIEAILGPVLGEDNVRAQVTADVDLDNTEQM 301

Query: 274 REIV---YDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLE--- 327
            E      DP + V RS   S+  Q    +Q         N P  + R +P   +     
Sbjct: 302 AETYRPNQDPSNGVVRSTHTSESTQNKAGAQ-GGVPGALSNQPPSAPRMLPTAPAPASQQ 360

Query: 328 -----------------------------NTDKKEEQSNYEINTKSIATTHDNYKLERLS 358
                                         +  ++   NYE++     T      + RLS
Sbjct: 361 AAAGQNGQNGQNGQQQAAAATGQTAANGVESSARDTTINYEVDKTVRRTRAAVGTVRRLS 420

Query: 359 IAVVVN---KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLE 415
           +AVVVN    G+  + L         D+ + ++N +V  A G +++RGD++ + +  F  
Sbjct: 421 VAVVVNYRADGKAWKPLS--------DAEMVKLNALVKDAVGYDAKRGDSVNVVNSQF-- 470

Query: 416 NQLFNSGTVQVSFMDI-LSR-----HFATVINALVF---LVGTLLVTFLGLHALRRLHNI 466
                SGT+ V+  D+ L +     H+A  I A  +    +G L++ F  +  L R  N 
Sbjct: 471 -----SGTLPVAKDDLPLWKQPEMIHYA--IQAAKYGALAIGFLILVFAVIRPLIRSMNK 523

Query: 467 DD 468
            D
Sbjct: 524 KD 525


>gi|311279120|ref|YP_003941351.1| flagellar M-ring protein FliF [Enterobacter cloacae SCF1]
 gi|308748315|gb|ADO48067.1| flagellar M-ring protein FliF [Enterobacter cloacae SCF1]
          Length = 556

 Score =  165 bits (418), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 122/401 (30%), Positives = 199/401 (49%), Gaps = 41/401 (10%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  SP Y  L+  L   D   I   L + NI +R +D+G +I VP+  V + R+ LA QG
Sbjct: 45  WAKSPDYRTLFSNLSDQDGGAIVTQLQQMNIPYRFADSGGAIEVPADKVHELRLRLAQQG 104

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  +  ARVH+ MP  
Sbjct: 105 LPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKGARVHLAMPKP 162

Query: 162 GSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKL 216
             F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D  G L
Sbjct: 163 SLFVREQKLPSASVTLNLEPGRALDEG---QIAAVVHLVSSAVAGLPPGNVTLVDQAGHL 219

Query: 217 LT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           LT +N   R++    L     ++  I+  I   L+  +G  N  + V A+LN D ++  E
Sbjct: 220 LTQSNTGARDLNDAQLKYASDVEGRIQRRIETILSPIVGNGNVHAQVTAQLNFDNKEQTE 279

Query: 276 IVYDPDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMP-HVSDRKVPLPRSLENTDK 331
             Y P+    +++  S+    SE   +  P        N P    +  +  P + +N  +
Sbjct: 280 EQYRPNGDSSQAVLRSRQVNESEQIGSPYPGGVPGALSNSPAPAPNAPISTPPANQNNGQ 339

Query: 332 KE----------------EQSNYEINTKSIATTHDNY-KLERLSIAVVVNKGRLTE--VL 372
           ++                E SNYE++ ++I  T  N   ++RLS+AVVVN   L +   L
Sbjct: 340 QQTTSTTNASGPRNTSRNETSNYEVD-RTIRHTKTNIGDVQRLSVAVVVNYKNLPDGKPL 398

Query: 373 GRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
             +ADQ      + +I  +   A G + +RGDT+ + +  F
Sbjct: 399 PLTADQ------MKQIEDLTREAMGYSDKRGDTLNVVNSQF 433


>gi|163783983|ref|ZP_02178948.1| Flagellar M-ring protein [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880743|gb|EDP74282.1| Flagellar M-ring protein [Hydrogenivirga sp. 128-5-R1-1]
          Length = 522

 Score =  165 bits (418), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 119/393 (30%), Positives = 208/393 (52%), Gaps = 32/393 (8%)

Query: 41  FFVNS----PHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIH 96
           FF+ S     +Y  LY  L   D  ++   L E  I +++  NGS I VP   V   R+ 
Sbjct: 39  FFIYSLSSKENYAVLYTNLSPEDAGQVLTVLQEEKIPYKVEGNGSIILVPKDKVYDVRLK 98

Query: 97  LAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHI 156
           LA++G+PS S+  G+E+FD+    G+T F + I  +RALEGE+ RTI+ ++ ++ A+V+I
Sbjct: 99  LASKGIPSGST-VGFEIFDE-PKMGITQFQENINYIRALEGELERTIRQLNAVIDAKVNI 156

Query: 157 VMPDMGSFRKIGARPTASVMIRAINPS---VYKSAEAIRHLVAAAVPNLDMGDVTVLDST 213
            MP    F +   +P ASV+I+ + P      +  +AI  LV+ AVP L   +VTV D+ 
Sbjct: 157 AMPKESIFAREEDQPKASVLIK-LAPGKDLTPEQVKAIVFLVSRAVPKLKPENVTVADNR 215

Query: 214 GKLLT--ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQ 271
           G++L+    E E     K+L + + ++ +IE N+   L+  LG D  +  V A + ++T 
Sbjct: 216 GRVLSDVLEETETAKADKTLQLKRKLERQIERNVQSMLSKALGSD--KVVVRATVEVETG 273

Query: 272 QI--REIVYDPDSKV---ERSIRLS-KDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRS 325
           Q+  ++ +YDPD      ER I+   K  Q+SE   P ++  V   M    D      R 
Sbjct: 274 QLHQKDELYDPDKVAIVSERRIKEEVKTKQKSEIGPPGTSTNVPPIMDTGQD------RY 327

Query: 326 LENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQG-----K 380
           L    K++   NY+++   I  +   +K++++S+ V+++ G+  E+  ++ +       +
Sbjct: 328 LVEKKKEDRTRNYDVSKSIINKSQPIFKIKKVSVGVLID-GKYQEIKDKNGNVSYKFIPR 386

Query: 381 IDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
               L +  +++ +A G + +RGD +TI S+ F
Sbjct: 387 SKEELKQYEELIKSAIGFDPKRGDKVTIVSVPF 419


>gi|91978309|ref|YP_570968.1| flagellar MS-ring protein [Rhodopseudomonas palustris BisB5]
 gi|91684765|gb|ABE41067.1| flagellar M-ring protein FliF [Rhodopseudomonas palustris BisB5]
          Length = 532

 Score =  165 bits (418), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 125/414 (30%), Positives = 203/414 (49%), Gaps = 10/414 (2%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           +  LL F K    LG  R++ + +V +  +  F      V+ P    LY  L V D + I
Sbjct: 1   MQSLLGFLKG---LGAARVMAMIAVTVALLGFFAFVIMRVSQPQMTTLYTDLSVEDSSSI 57

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
              L    I F + + G+++ VP   V + R+ LA +G        GYE+FDK ++ G T
Sbjct: 58  IKELERQAIPFEMRNEGTTLMVPKDKVTRLRMKLA-EGGLPKGGGVGYEIFDKSDALGTT 116

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS 183
           SF+Q I  +RALEGE+ARTI++I  I  ARVH+V+P+   F +    P+AS+++R     
Sbjct: 117 SFVQNINHLRALEGELARTIRAIDRIQQARVHLVLPERPLFSRETPEPSASIVLRVRGAL 176

Query: 184 VYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEM 243
             +   AIRHLVA+AV  L    V+++D  G+LL       N    +    +    E  M
Sbjct: 177 EPQQVRAIRHLVASAVNGLKPQRVSIVDEGGQLLADGSASANAADGAAGDERRTSFEKRM 236

Query: 244 --NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
              I   +++ +G    R  V A+ + +        +DP+ +V RS +  ++  +S+TS 
Sbjct: 237 RNEIEGIVSSVVGSGRARVQVTADFDYNKITQTSDKFDPEGRVLRSSQTREE--QSQTSA 294

Query: 302 PESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAV 361
            +  VTV   +P    +    PR  + + K EE +NYEI+  +     +  ++ RLS+AV
Sbjct: 295 ADGQVTVNNELPGNQGQAGTGPR--DQSKKSEETNNYEISRITKTEVTEAGRVNRLSVAV 352

Query: 362 VVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLE 415
           +V+        G      +    L  I  +V +A G + +RGD I + ++ F E
Sbjct: 353 LVDGIYTKNEKGELVYAERPKEQLDRIAALVRSAIGFDQKRGDQIEVVNLKFAE 406


>gi|462109|sp|Q04954|FLIF_CAUCR RecName: Full=Flagellar M-ring protein
 gi|144247|gb|AAA66325.1| flagellar M-ring protein [Caulobacter crescentus CB15]
 gi|13422171|gb|AAK22889.1| flagellar M-ring protein [Caulobacter crescentus CB15]
          Length = 536

 Score =  165 bits (417), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 140/531 (26%), Positives = 255/531 (48%), Gaps = 38/531 (7%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            F+     + LY  L++ + + ++ AL +A I +    +GS+I VP   V  AR+ +A +
Sbjct: 17  MFMGKEPSELLYSNLDLKEASEVTQALDQAGIKYETKGDGSTIMVPRDKVASARLMVAGK 76

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GL SS S  GYE+FD  N+ G T F+Q++ R RAL+GE+ RTI+++ G+ + RVH+V+P 
Sbjct: 77  GLVSSGS-IGYEIFDTNNALGQTDFVQQLNRQRALQGELERTIKAMQGVNSVRVHLVLPK 135

Query: 161 MGSFRKIGARPTASVMI--RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +   +P+A+V I   +  PS      AI++LV+++VPN+    V V+D  GK L+
Sbjct: 136 RQLFEEDAEQPSAAVTIGVGSREPS-SDMVRAIQNLVSSSVPNMKAEKVAVIDQHGKTLS 194

Query: 219 ANEMERNILGKSLSIVQAIQHEIEMNINKA----LAAFLGVDNFRSAVVAELNMDTQQIR 274
           A   E ++ GK   + Q  + E+E  I K     +   LG    R  V AEL+++    +
Sbjct: 195 APSDE-SLAGK---MAQDRKSEVEARIAKTVKDMIEGVLGPGKARVNVTAELDLNRVTTQ 250

Query: 275 EIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEE 334
           E  +DPD +V RS   ++ + +   +   + VT   N+P          +    T + + 
Sbjct: 251 EERFDPDGQVIRSESTTEASSQENKNDDNAGVTAAANVPGGQGANG-FQQLGSRTGQNDA 309

Query: 335 QSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSY-------LAE 387
            +NYEI+     T  +   ++++++AV ++      V    A  GK  +Y       + +
Sbjct: 310 VTNYEISKSVTTTVQEPGTIKKIAVAVAIDG-----VSAPMAADGKPGAYTPRTAQEIQQ 364

Query: 388 INKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLV 447
           I ++V  A G ++ RGD + +T++ F + +  + G  +   +    ++   ++ A    V
Sbjct: 365 IEELVKTAVGFDAERGDQVRVTNIKFPQPE--DQGLEEQGLLAGFDKN--DIMRAAELGV 420

Query: 448 GTLLVTFLGLHALRR-LHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQ 506
             ++   + L A+R  + N+     G++        PP++  VT        + +D S +
Sbjct: 421 LAVVALLILLFAVRPFIKNLSAPAPGQIALAGPSGGPPVTRLVTLADGTQQQVVVDQSGE 480

Query: 507 DIFSHSRNLQ--------SRINSYVSKQSDLRLLHMIEINEERFAKILRKW 549
            I      +         ++I   V   S  R+   +E + +    ILR W
Sbjct: 481 PIALAGPPVSDIDQRIDIAKIEGQVKASSIKRVSEFVEKHPDESVAILRNW 531


>gi|327394264|dbj|BAK11686.1| flagellar M-ring protein FliF [Pantoea ananatis AJ13355]
          Length = 572

 Score =  165 bits (417), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 132/467 (28%), Positives = 216/467 (46%), Gaps = 63/467 (13%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P+Y  L+  L   D   I   L++ N+ +R +DNG ++ VP   V + R+ LA Q
Sbjct: 47  LWAKTPNYSVLFSNLSNEDGGAIVTQLTQMNVPYRFADNGGALMVPEDKVHELRLRLAEQ 106

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP    N G+EL DK   FG++ F +++   RALEGE+ARTI+S+  +  ARVH+ MP 
Sbjct: 107 GLPKGG-NVGFELLDK-EKFGISQFSEQVNYQRALEGELARTIESLGPVKTARVHLAMPK 164

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++       +AI H+V+++V  L  G+VTV+D +G 
Sbjct: 165 PTLFVREQKAPSASVTLTLQPGRALDEG---QIQAITHMVSSSVAGLPPGNVTVVDQSGH 221

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT ++ + R++    L     ++   +  I   L   LG  N  + V A++N DT +  
Sbjct: 222 LLTRSDAVGRDLNDAQLKYAAEVEARYQQRIEAILNPILGQGNVHAQVTAQINFDTSEQT 281

Query: 275 EIVYDPDSKVERSIRLSKDAQRSETS--------------QPESAVTVEQNMPHVSDR-- 318
           +  Y P+   + +   S+    SE S              QP  A T   N P+ +    
Sbjct: 282 DEKYQPNGDPKNASIRSQQTSTSEQSGSPYPGGVPGALSNQPAPANTAPVNAPNTNAANG 341

Query: 319 ---------------KVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVV 363
                                S+    ++++  NYE++     T  +   ++RLS+AVVV
Sbjct: 342 QNANGQNNAANGQRTSTASASSVPTNSRRDDTVNYELDRTIRHTKMNVGDVQRLSVAVVV 401

Query: 364 NKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           N         R  D+GK     +  L +I  +   A G + +RGD++ +       N  F
Sbjct: 402 NY--------REDDKGKALALNEQQLKQIEDLTREAMGYSQQRGDSVNVV------NSQF 447

Query: 420 NSGTVQVSFMDILSRH--FATVINALVFLVGTLLVTFLGLHALRRLH 464
           N+    VS +    +   F  +I+A  +L+   LV F+      R H
Sbjct: 448 NTTEPTVSELPFWQQQSFFDQLISAGKWLL-VALVAFILYRKTVRPH 493


>gi|259907606|ref|YP_002647962.1| Flagellar basal-body M-ring protein [Erwinia pyrifoliae Ep1/96]
 gi|224963228|emb|CAX54712.1| Flagellar basal-body M-ring protein [Erwinia pyrifoliae Ep1/96]
 gi|283477448|emb|CAY73364.1| Flagellar M-ring protein FliF [Erwinia pyrifoliae DSM 12163]
          Length = 561

 Score =  165 bits (417), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 127/452 (28%), Positives = 217/452 (48%), Gaps = 46/452 (10%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
           F+   P Y  L+  +   D   I   LS+ N+ +RI   G +I VP + V + R+ +A Q
Sbjct: 47  FWAKEPGYRVLFNNVSDEDGGAIVSQLSQMNVPYRIDTPGGAIMVPEAQVHEVRMKMAQQ 106

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   S  G+EL D+   FG++ F +++   RALEGE+ARTI+++  I  ARVH+ +P 
Sbjct: 107 GLPKGGS-VGFELLDQ-EKFGISQFSEQVNFQRALEGELARTIENLGPIQHARVHLAVPK 164

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +   +PTASV +           +  AI HL+++AV  L   +VT++D  G LLT
Sbjct: 165 PSMFVRDQKQPTASVNVTLAQGRTLDDGQVTAITHLISSAVSGLPAANVTLVDQRGNLLT 224

Query: 219 ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
            +     +    +     I+ + +  I + LA  +G  N R+ V A+L+   Q+  +  Y
Sbjct: 225 QSGTGA-LQSSQVKYTNEIEADYQQRIQRLLAPLVGDSNVRTQVTAQLDFTQQERTDEQY 283

Query: 279 DPDSKVER-SIRLSKDAQRSE-------------TSQPESAVTVEQNMP---------HV 315
            P+++ E+ +IR  + +Q ++             ++QP +  T     P         + 
Sbjct: 284 QPNAEREKMAIRSRQSSQAAQGNGRGAGGVPGALSNQPPTPATAPLTKPLNAPAANGKNA 343

Query: 316 SDRKVPLPRSLEN--TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLG 373
           ++ K P    +     ++ +E +NYE++   I T      ++RLS+AVV+N        G
Sbjct: 344 NNEKTPAAGEVAQPYNNRNDETTNYELDRTLIHTKTSVGHIQRLSVAVVINH----MAQG 399

Query: 374 RSADQGKIDSY-LAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDIL 432
                G + +  LA IN +V  A G + +RGD+I I +  F       +G  +     + 
Sbjct: 400 AEGKPGPLPAAELARINTLVKEAIGYSEQRGDSINIVNSPF-------NGVAEEVMPPLW 452

Query: 433 SRH-FATVINALVFLVGTLLVTFLGLHALRRL 463
            +H F T+   ++ L   L++  +G    RRL
Sbjct: 453 QQHSFQTL---MMTLARYLVIAIIGWVMWRRL 481


>gi|30250023|ref|NP_842093.1| fliF; flagellar M-ring transmembrane protein [Nitrosomonas europaea
           ATCC 19718]
 gi|30139130|emb|CAD85994.1| fliF; flagellar M-ring transmembrane protein [Nitrosomonas europaea
           ATCC 19718]
          Length = 548

 Score =  165 bits (417), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 113/390 (28%), Positives = 197/390 (50%), Gaps = 20/390 (5%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  SP Y  LY  L   +   I  AL + N+ ++ S++G SI +P+S V + R+ LA Q
Sbjct: 48  LWSQSPDYRVLYASLSDQEGGAIIEALQKMNVPYQFSESGGSILIPASQVHEVRLRLAGQ 107

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP  +  SG+E+ +    FG + F++++   RALEGE++R+IQS+S +  ARVH+ +  
Sbjct: 108 GLPKGNL-SGFEILEN-QKFGSSQFLEQVNYQRALEGELSRSIQSLSAVQGARVHLAIAK 165

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAE---AIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +   +P  SV++  ++P    S E   AI HL+++++P++ + +VTV+D  G LL
Sbjct: 166 PSVFTRERPQPRVSVLLN-LHPGRMLSTEQVSAIVHLISSSIPDMPVKNVTVVDQQGNLL 224

Query: 218 TA---NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           +    N+ E  +    L  VQ ++      I   L    G DN  + V A+++    +  
Sbjct: 225 SGQKDNQAETGLDPGQLKYVQDMEQNFVRRIEAILTPITGEDNVHAQVTADVDFSRIERA 284

Query: 275 EIVYDPDSKVER--SIRLSKDAQRSETSQPESAV--TVEQNMPHVSDRKVPLPRSLENTD 330
           E +Y P++      ++R  + ++    SQPE  V   +    P  ++  +   +S E   
Sbjct: 285 EEIYKPNNNPAEAAAVRSQQQSESVSISQPEGGVPGALSNRPPAPAEAPIEAKQSSEAAA 344

Query: 331 K-------KEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDS 383
           K       +E  +NYE++     T     ++ RLS AVV+N     +  G  A++     
Sbjct: 345 KTTPTDTRRESTTNYEVDKTISHTRQATGRINRLSAAVVINYRTKLDTEGNPANEPLSGE 404

Query: 384 YLAEINKIVSAATGINSRRGDTITITSMDF 413
            + +I  +V    G +  RGDT+T+T+  F
Sbjct: 405 EIEKITALVKQTIGFDETRGDTLTVTNSQF 434


>gi|254239470|ref|ZP_04932792.1| Flagella M-ring outer membrane protein precursor [Pseudomonas
           aeruginosa 2192]
 gi|126192848|gb|EAZ56911.1| Flagella M-ring outer membrane protein precursor [Pseudomonas
           aeruginosa 2192]
          Length = 598

 Score =  165 bits (417), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 137/566 (24%), Positives = 260/566 (45%), Gaps = 73/566 (12%)

Query: 33  IMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGK 92
           + +  A   +   P Y  LY  L   D NR+  AL+ A+I +++  N  ++ V +  +G+
Sbjct: 52  VAIGFAVVLWSQQPDYKPLYGSLNGVDANRVVEALTAADIPYKVEPNSGALLVKADDLGR 111

Query: 93  ARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAA 152
           AR+ +A+ G+  + SN G+E+ DK  + G + FM+     R LEGE+ART+ S++ + AA
Sbjct: 112 ARMKVASAGVAPTDSNVGFEILDKEQALGTSQFMEATNYRRGLEGELARTVSSLNNVKAA 171

Query: 153 RVHIVMPDMGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDV 207
           RVH+ +P    F +   +P+ASV++     R++ PS      AI +LVA +VP LD   V
Sbjct: 172 RVHLAIPKSSVFVRDDRKPSASVLVELYPGRSLEPS---QVMAIVNLVATSVPELDKSQV 228

Query: 208 TVLDSTGKLLTANE--MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAE 265
           TV+D  G LL+  +   E  + GK     + ++  +   ++  L   LG   +++ V A+
Sbjct: 229 TVVDQKGNLLSDQQELSELTMAGKQFDFTRRMEGLLTQRVHNILQPVLGNGRYKAEVSAD 288

Query: 266 LNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPH----------- 314
           ++    +    +Y+PD    RS + + + +R  +S P+       N P            
Sbjct: 289 VDFSAVESTSEMYNPDQPALRSEQRNNE-ERQNSSGPQGVPGALSNQPPGPASAPQQATA 347

Query: 315 --------------------VSDRKVPLPR-SLENTDKKEEQS-NYEINTKSIATTHDNY 352
                               + D K   P  +   TDK+++ + NYE++     T     
Sbjct: 348 SAPADYVAPGQPLKDANGQTIIDPKTGKPELAPYPTDKRDQTTRNYELDRSISYTKQQQG 407

Query: 353 KLERLSIAVVV-NKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSM 411
           +L RLS+AVV+ ++ ++    G  + Q      LA   ++V  + G ++ RGD++++ + 
Sbjct: 408 RLRRLSVAVVLDDQMKVDAKTGEVSHQPWSADELARFTRLVQDSVGYDASRGDSVSVINA 467

Query: 412 DFLENQLFNSGTV----QVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRR-LHNI 466
            F   Q     ++    Q  F DI+ +           ++G L +  L    LR  L NI
Sbjct: 468 PFAPAQAEEIDSIPFYSQPWFWDIVKQ-----------VLGVLFILVLVFGVLRPVLSNI 516

Query: 467 DDAKKGE--VGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIF-SHSRNLQSRINSYV 523
               KG+   GG        +  +   G + +D +++   +  +  S +    +++N+  
Sbjct: 517 TGGGKGKSLAGGGGRDGDLALGESGLEGSLADDRVSIGGPSSILLPSPTEGYDAQLNA-- 574

Query: 524 SKQSDLRLLHMIEINEERFAKILRKW 549
                  + +++  +  R A+++++W
Sbjct: 575 -------IKNLVAQDPGRVAQVVKEW 593


>gi|197104328|ref|YP_002129705.1| flagellar M-ring protein FliF [Phenylobacterium zucineum HLK1]
 gi|196477748|gb|ACG77276.1| flagellar M-ring protein FliF [Phenylobacterium zucineum HLK1]
          Length = 548

 Score =  165 bits (417), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 138/515 (26%), Positives = 232/515 (45%), Gaps = 31/515 (6%)

Query: 51  LYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSG 110
           LY  L++ +   I+ AL +A I + +  +GS+I V    V   R+ L+++GLP++ S  G
Sbjct: 44  LYSNLDLKEAGSITQALDQAGIKYEVKGDGSTILVGRDKVAATRLMLSSRGLPTAGS-VG 102

Query: 111 YELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGAR 170
           YE+FD   + G T F+Q++ R RALEGE+ARTI+S+ GI +ARVH+V+P    F++   +
Sbjct: 103 YEIFDDAKALGQTDFVQQLNRQRALEGELARTIRSLDGITSARVHLVLPKRQLFQEEAEQ 162

Query: 171 PTASVMI----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNI 226
           P+ASV I    RA +P   +   AI++L+A AVPNL    VTV+D   K L+  +    +
Sbjct: 163 PSASVNIGVGGRAPSPEQVR---AIQNLIAGAVPNLRPDRVTVVDQHAKTLSGGDT--GM 217

Query: 227 LGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVER 286
             ++ S    ++  I   +   +   +G    R  V AEL +    +++  +DPD +V R
Sbjct: 218 AAEADSRKSEVEQRIAKQVKNLIEGVVGPGKARVNVSAELELARVTVQQETFDPDGQVIR 277

Query: 287 SIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIA 346
           S   + +  R           V  N+   +            + ++E  +NYEI+     
Sbjct: 278 SESTTDENSRENQEDGAGQAGVAGNL-PGAAALGGGGLVGSQSGRQESTTNYEISKTVRT 336

Query: 347 TTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAE----INKIVSAATGINSRR 402
              +  +++RLS+AV V+       +G     G      AE    I ++V  A G N  R
Sbjct: 337 EVQEPGQVKRLSVAVAVDG---VTAIGADGQPGAYTPRTAEEMQRIEQLVRTAVGFNQDR 393

Query: 403 GDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVIN-ALVFLVGTLLVTFLGLHALR 461
           GD +++ ++ F               M          +   ++ +VG L++ F+    L+
Sbjct: 394 GDQVSVINVRFPTPDTVGGVEAANPLMGFDKNDIMRAVEIGVMAIVGILMLIFVARPLLK 453

Query: 462 RLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQ----- 516
                            ++  P ++  VTT       IA D + Q       + +     
Sbjct: 454 SATGGGGGGL-----PMMMGGPQVTRVVTTADGQPMQIAADGTAQLALPGPGHTELESKI 508

Query: 517 --SRINSYVSKQSDLRLLHMIEINEERFAKILRKW 549
             +RI   V   S  R+   +E + E    ILR W
Sbjct: 509 DMARIEGQVKASSVKRVAEFVEKHPEESVAILRSW 543


>gi|313673744|ref|YP_004051855.1| flagellar m-ring protein flif [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312940500|gb|ADR19692.1| flagellar M-ring protein FliF [Calditerrivibrio nitroreducens DSM
           19672]
          Length = 554

 Score =  164 bits (416), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 129/454 (28%), Positives = 219/454 (48%), Gaps = 35/454 (7%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
           ++ N P Y  L+  L   D   +   L    I + + D+G +I VP+  V + RI LA +
Sbjct: 41  YWANKPVYKILFANLSQEDAAEVVAKLKAKKIPYNLKDSGKTIEVPAKDVYETRIELAKE 100

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           G+P      G+ELFDK  SFG+T F Q +   RAL+GE++RTI ++  +  ARVH+ +P 
Sbjct: 101 GIPKGGG-VGFELFDKT-SFGITEFAQNVNYQRALQGELSRTISTLEEVEEARVHLTLPK 158

Query: 161 MGSFRKIGARPTASVMIRAINPSVYK--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F        A+V+++            +AI  LV  AV  L + +V ++D+ G LL+
Sbjct: 159 DKLFITEDGEAKAAVVLKLKKGETLNRDKVKAIASLVVGAVKGLKIQNVQIVDTQGNLLS 218

Query: 219 ANEMERNI----LGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
            +  E N+        L   + ++  I   IN  LA  LG +N  + V AE++ D ++I 
Sbjct: 219 ESLNEENLPYVKTQTQLEYQKKVEKIISSKINSLLATTLGENNAVAQVTAEIDFDKKEIN 278

Query: 275 EIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNM--PHVSDRKVPLPRSLENTDKK 332
           +  +D +  V RS +  +   ++  + P+    VE N+  P++    V    +     K 
Sbjct: 279 KEEFDQNP-VLRSSQTIEIESKNTPNTPQGQPGVEPNLAEPNIQQNGVNSTYT-----KN 332

Query: 333 EEQSNYEINTKSIATTHDNYKLERLSIAVVVN---------KGRLTEVLGRSADQGKIDS 383
           EE  N+EI             ++RL+IAVVVN         K  +T+ + R+ ++     
Sbjct: 333 EETQNFEIGKTVTKEEKSIGSIKRLTIAVVVNDKAEIVKEGKKEVTKYVPRTKEE----- 387

Query: 384 YLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINAL 443
            L +I  +V+ A G + +RGD I +T++ F  +Q+  S  ++   M+ L    +  +  L
Sbjct: 388 -LDKIKGLVAKAAGFDEKRGDQIEVTNVSFDTSQMSESKLLEKEKMNELIIQISKYVMVL 446

Query: 444 VFLVGTLLVTFLGLHA-LRRLHNIDDAKKGEVGG 476
           V     LL  FL +   +++L +I + K GE+  
Sbjct: 447 VMF---LLFYFLVIRPIMKKLGDIKETKSGELAA 477


>gi|295097226|emb|CBK86316.1| flagellar basal-body M-ring protein/flagellar hook-basal body
           protein (fliF) [Enterobacter cloacae subsp. cloacae NCTC
           9394]
          Length = 511

 Score =  164 bits (416), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 130/467 (27%), Positives = 222/467 (47%), Gaps = 37/467 (7%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
           F+   P Y  L+  +   D   I   LS+ N+ +RI   G +I VP   V + R+ LA Q
Sbjct: 2   FWAKEPGYRVLFSNISDEDGGAIVAQLSQMNVPYRIDAPGGAILVPEGQVHEVRMKLAQQ 61

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   S  G+EL DK   FG++ F +++   RALEGE+ARTI+++  I +ARVH+  P 
Sbjct: 62  GLPKGGS-VGFELLDK-EKFGISQFSEQVNYQRALEGELARTIENLGPIRSARVHLATPK 119

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +   +PTASV +  I        +  AI HL+++AV  L   +VT++D  G+LLT
Sbjct: 120 QTMFVREQKQPTASVTVNLIQGRTLDEGQVIAITHLISSAVTGLTAENVTIVDQRGELLT 179

Query: 219 ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
            + + R +    L     I+ + +  I + LA  +G  N R+ V A+++   Q+  +  Y
Sbjct: 180 QSGL-RGLQTSQLKYTSEIESDYQQRIQRILAPLVGSKNIRAQVTAQIDFTQQEQTQEQY 238

Query: 279 DPDSKVERSIRLSKDAQRSE--------------TSQPESAVTVEQNMP------HVSDR 318
            P++  ++ +  S+   +SE              T+QP +  T     P        S  
Sbjct: 239 QPNADPQKMVIRSRQTSQSEQGNGRGNGGVPGALTNQPPAPATAPLTQPLDKPAAQTSTA 298

Query: 319 KVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQ 378
                RS    +  +E +N+E++       +   +++RLS+AVV+N   L +  G     
Sbjct: 299 GTGNDRSQPYNNHNDETTNFEVDRTLTHIKNAMGRIDRLSVAVVIN--HLPQ--GAEGKP 354

Query: 379 GKI-DSYLAEINKIVSAATGINSRRGDTITITSMDF--LENQLFNSGTVQVSFMDIL--- 432
           G + ++ L  IN +V  A G  + RGD++ I +  F  +E +       Q  F  ++   
Sbjct: 355 GPLSEAELNRINALVKEAVGYTASRGDSVNILNSPFNGVEEEELPPFWKQDKFYQLMMAI 414

Query: 433 SRHFATVINALVFLVGTLLVTFLGLH--ALRRLHNIDDAKKGEVGGK 477
           +R+    I A V     +   ++     +LRR+    +A++ E+  +
Sbjct: 415 ARYLVIAIIAWVMWRKLVHPAWIRHQETSLRRMEMEKEARQEELAAR 461


>gi|292489162|ref|YP_003532049.1| flagellar M-ring protein FliF [Erwinia amylovora CFBP1430]
 gi|292900280|ref|YP_003539649.1| flagellar M-ring protein [Erwinia amylovora ATCC 49946]
 gi|291200128|emb|CBJ47254.1| flagellar M-ring protein [Erwinia amylovora ATCC 49946]
 gi|291554596|emb|CBA22238.1| Flagellar M-ring protein FliF [Erwinia amylovora CFBP1430]
 gi|312173321|emb|CBX81576.1| Flagellar M-ring protein FliF [Erwinia amylovora ATCC BAA-2158]
          Length = 561

 Score =  164 bits (416), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 135/480 (28%), Positives = 230/480 (47%), Gaps = 52/480 (10%)

Query: 16  SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFR 75
           SL  +  L+L       I + +A  F+   P Y  L+  +   D   I   LS+ N+ +R
Sbjct: 22  SLRNSPKLLLPIAAAAAISVMIALMFWAKEPGYRVLFNNISDEDGGAIVSQLSQMNVPYR 81

Query: 76  ISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRAL 135
           I   G +I VP + V + R+ +A QGLP   S  G+EL D+   FG++ F +++   RAL
Sbjct: 82  IDTAGGAIMVPEAQVHEVRMKMAQQGLPKGGS-VGFELLDQ-EKFGISQFSEQVNFQRAL 139

Query: 136 EGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI-----RAINPSVYKSAEA 190
           EGE+ARTI+++  I  ARVH+ +P    F +   +PTASV +     RA++        A
Sbjct: 140 EGELARTIENLGPIQHARVHLAVPKPSMFVRDQKQPTASVNVTLAQGRALDDG---QVTA 196

Query: 191 IRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALA 250
           I HL+++AV  L   +VT++D  G LLT +     +    +     I+ + +  I + LA
Sbjct: 197 ITHLISSAVSGLPAANVTLVDQRGNLLTQSGTGA-LQTSQVKYTNEIEADYQQRIQRLLA 255

Query: 251 AFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVER-SIRLSKDAQRSE----------- 298
             +G  N R+ V A+L+   Q+  +  Y P+++ E+ +IR  + +Q ++           
Sbjct: 256 PLVGDSNVRTQVTAQLDFTQQERTDEQYQPNAEREKMAIRSRQSSQAAQGNGRGSGGVPG 315

Query: 299 --TSQPESAVTVEQNMP---------HVSDRKVPLPRSLEN--TDKKEEQSNYEINTKSI 345
             ++QP +  T     P         + ++ K P    +     ++ +E +NYE++   I
Sbjct: 316 ALSNQPPTPATAPLTKPLNAPAANGKNANNEKTPPAGEVAQPYNNRNDETTNYELDRTLI 375

Query: 346 ATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSY-LAEINKIVSAATGINSRRGD 404
            T      ++RLS+AVV+N        G     G + +  LA IN +V  A G + +RGD
Sbjct: 376 HTKTSVGHIQRLSVAVVINH----MAQGAEGKTGPLPAAELARINTLVKEAIGYSEQRGD 431

Query: 405 TITITSMDFLENQLFNSGTVQVSFMDILSRH-FATVINALVFLVGTLLVTFLGLHALRRL 463
           ++ I +  F       +G V+     +  +  F T+I   + L   L++  +G    RRL
Sbjct: 432 SVNIVNSPF-------NGVVEEVMPPLWQQQSFQTLI---MTLARYLVIAIIGWVMWRRL 481


>gi|115522990|ref|YP_779901.1| flagellar MS-ring protein [Rhodopseudomonas palustris BisA53]
 gi|115516937|gb|ABJ04921.1| flagellar M-ring protein FliF [Rhodopseudomonas palustris BisA53]
          Length = 535

 Score =  164 bits (415), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 145/555 (26%), Positives = 248/555 (44%), Gaps = 34/555 (6%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           ++ L+ F K    LG  R++ + +V    I  F      V +P    L+  L V D + I
Sbjct: 1   MEGLVNFLKG---LGAARLMAMIAVTAALIGFFAFVILRVTTPQMTTLFTDLSVEDSSGI 57

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
              L    I F I + GS I VP   V + R+ LA  GLP      GYE+FDK  + G T
Sbjct: 58  IKDLERQAIPFEIRNEGSVIMVPKDKVTRLRMKLAEAGLPKGG-GVGYEIFDKSEALGST 116

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS 183
           SF+Q I  +RALEGE+ARTI++I  I AARVH+V+P+   F +    P+AS+++R     
Sbjct: 117 SFVQNINHLRALEGELARTIRAIDRIQAARVHLVLPERPLFSRETPEPSASIVLRVRGAL 176

Query: 184 VYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL----TANEMERNILGKSLSIVQAIQH 239
             +   AIRH+VA+AV  L    V+++D  G+LL      +     + G       A + 
Sbjct: 177 EPQQVRAIRHVVASAVNGLKPQRVSIVDEAGQLLADGAAGDPSTEGVTGDERR--AAFEK 234

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
            +   +   +++ +G    R  + A+ + +        +DP+ +V      S++   +  
Sbjct: 235 RMRNQVEAIVSSVVGTGRARVQLTADFDYNKITQTSDKFDPEGRV-LRSSQSREESSATL 293

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
           +  +  VTV   +P          R  + + K EE +NYEI+  +     +  ++ R+S+
Sbjct: 294 NPTDGQVTVNNELPGAQGGAGAAAR--DQSKKSEETNNYEISRVTKTEVTEVGRVNRVSV 351

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQL- 418
           AV+V+        G    Q +    L  I  +V +A G + +RGD + I ++ F E    
Sbjct: 352 AVLVDGLYNKNDKGELVYQERSKEELDRIAALVRSAIGFDQKRGDQVEIVNLRFAEGPAV 411

Query: 419 --FNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGG 476
              N  T  +  +         VI   V ++  ++V F+ +  L R              
Sbjct: 412 VPINEPTGILGMLKFTKDDVMYVIELGVMMLLGMVVIFMVIRPLVR-------------- 457

Query: 477 KSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNL--QSRINSYVSKQSDLRLLHM 534
             IL+  P S      L  +  +++ +  Q + +   ++   +++   V  QS  R+  +
Sbjct: 458 -RILAAEPGSPTALPALT-DGTVSVGADGQPLPTPGPSMIDIAQVQGQVHAQSVHRVGEL 515

Query: 535 IEINEERFAKILRKW 549
            + N    A I+R+W
Sbjct: 516 ADRNPNETAAIIRQW 530


>gi|192289867|ref|YP_001990472.1| flagellar MS-ring protein [Rhodopseudomonas palustris TIE-1]
 gi|192283616|gb|ACE99996.1| flagellar M-ring protein FliF [Rhodopseudomonas palustris TIE-1]
          Length = 538

 Score =  164 bits (414), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 133/463 (28%), Positives = 223/463 (48%), Gaps = 15/463 (3%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           +  LL F K G    R   +I  +V LV    F+  R  V+ P    LY  L V D + I
Sbjct: 1   MQNLLGFLK-GLGAARLMAMIAVTVALVGFFAFVIMR--VSQPQMTTLYTDLSVEDSSSI 57

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
              L    I F + ++G+ + VP   V + R+ LA +G        GYE+FDK ++ G T
Sbjct: 58  IKELERQGIPFEMRNDGAILMVPKDKVTRLRMKLA-EGGLPKGGGVGYEIFDKSDALGTT 116

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS 183
           SF+Q I  +RALEGE++RTI++I  + AARVH+V+P+   F +    P+AS+++R     
Sbjct: 117 SFVQNINHLRALEGELSRTIRAIDRVQAARVHLVLPERPLFSREAPEPSASIVLRVRGAL 176

Query: 184 VYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQ--AIQHEI 241
             +   AIRHLVA+AV  L    V+++D  G+LL         +  + S  +  A +  +
Sbjct: 177 EPQQVRAIRHLVASAVNGLKPQRVSIVDEAGQLLADGSASGEQVEGATSDERRAAFEKRM 236

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
              I   +++ +G    R  V A+ + +        +DP+ +V RS +  +++  + TS 
Sbjct: 237 RNQIEGIVSSVVGSGRARVQVSADFDYNKITQTSDKFDPEGRVLRSSQTREES--AATSA 294

Query: 302 PESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAV 361
            +  VTV   +P  +  +    R +  + K EE +NYEI+  +     +  ++ RLS+AV
Sbjct: 295 ADGQVTVNNELPGANQGQGAGARDV--SKKSEETNNYEISRVTKTEVTEAGRVNRLSVAV 352

Query: 362 VVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNS 421
           +V+        G      +    L  I  +V +A G + +RGD I + ++ F E      
Sbjct: 353 LVDGAYTKNDKGELVYAERPKEQLDRIAALVRSAIGFDQKRGDQIEVVNLKFAEAPQVEK 412

Query: 422 GTVQVSFMDILSRHFATVIN----ALVFLVGTLLVTFLGLHAL 460
                  M +       ++N     ++FL+G L+V F+ +  L
Sbjct: 413 LPEPAGLMGMFQFTKDDIMNMIQLGVMFLLG-LVVLFMVIRPL 454


>gi|170743231|ref|YP_001771886.1| flagellar MS-ring protein [Methylobacterium sp. 4-46]
 gi|168197505|gb|ACA19452.1| flagellar M-ring protein FliF [Methylobacterium sp. 4-46]
          Length = 539

 Score =  164 bits (414), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 122/420 (29%), Positives = 209/420 (49%), Gaps = 25/420 (5%)

Query: 3   ILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNR 62
           +LD + +F       G  R+  + +V LV +  F      V+ P    LY  L + D   
Sbjct: 4   VLDLMAKF-------GPARLAAMGAVTLVLVGFFAFVILRVSRPELGVLYADLSLQDAGA 56

Query: 63  ISVALSEANIDFRI-SDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           +   L    I +    D G +I  P + + + R+ LA +GLPS+    GYELFDK ++F 
Sbjct: 57  VIRDLEARGIRYETRGDLGQTILAPRADLPRLRMDLAGKGLPSAG-GVGYELFDKGDAFS 115

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
            T+F+Q +  +RA EGE+AR+I++I  + AARVH+V+P+   F +    P+A+++++   
Sbjct: 116 TTTFVQNVNHLRAQEGELARSIRAIGRVQAARVHLVIPEKRLFNRDRELPSAAIVLKLAG 175

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL---TANEMERNILGKSLSIVQA-I 237
                   A+RHLVA++V  L    ++++D  G+LL      +  + +LG  L   QA +
Sbjct: 176 DLDPGQVRAVRHLVASSVEGLKPERISIVDERGRLLADGAGRDDAQAVLG--LDERQASL 233

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRS 297
           +  +   +   +A  +G    R  V AEL+    + R   +DP+S+V RS        RS
Sbjct: 234 EQRLRAQVEGIVAGIVGAGRARVQVAAELDPSRIESRSESFDPESRVVRS-----SQTRS 288

Query: 298 ETSQP----ESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYK 353
           ETS      E+ V+V   +P   +       + E ++K EE +NYEI+  +    ++  +
Sbjct: 289 ETSASQGPGETGVSVGNELPGARE-TAQANGTRETSNKNEETTNYEISRVTRTEVNEGGR 347

Query: 354 LERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           ++RLS+AVV++        G+     +    L  I  +V  A G +  RGD + + ++ F
Sbjct: 348 IKRLSVAVVIDGSYQPGPDGKPVYAPRSQEELDRITALVRTAVGYDKGRGDQVEVANLRF 407


>gi|125525107|gb|EAY73221.1| hypothetical protein OsI_01094 [Oryza sativa Indica Group]
          Length = 575

 Score =  164 bits (414), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 122/395 (30%), Positives = 194/395 (49%), Gaps = 30/395 (7%)

Query: 46  PHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSS 105
           P Y  L+  L   D   I   LS  N+ ++ S+ G +I VP+  V   R+ LA QGLP  
Sbjct: 56  PDYKVLFSNLSDKDGGAIVAQLSTMNVPYKYSEGGGAILVPAERVHDVRLRLATQGLPKG 115

Query: 106 SSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFR 165
           S  +G+EL +  N FG+T F + +   R LEGE+ R+IQ++S + +ARVH+ +P+   F 
Sbjct: 116 SV-TGFELME-TNRFGVTQFQERLNFQRGLEGELTRSIQALSSVQSARVHLALPNQNGFF 173

Query: 166 KIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL----- 217
           +   +P+ASV++ ++ P  +        I HLVA++VP +    V+VLD TGKLL     
Sbjct: 174 REQQKPSASVLL-SLYPGRFLDRTQLAGIVHLVASSVPEMSPSAVSVLDDTGKLLSQSPD 232

Query: 218 TANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNM----DTQQI 273
           TA      I  + LS VQ I+ +    I   L   +G +N ++ V AE++      T + 
Sbjct: 233 TAAGSSGAIDAQQLSYVQQIEQQYTRRILDILEPVVGKNNVKAQVTAEVDFSQSEQTSEQ 292

Query: 274 REIVYDPDSKVERSIRLSKDAQRSETSQPESAV--TVEQNMPHVSDRKV----PLPRSLE 327
                 PDS   RS ++ + +  ++ +QP + V        P  S   +    P P +  
Sbjct: 293 HRPNQTPDSSAVRSQQVVESSGGTQGNQPPAGVPGAASNQPPQPSTAPINGANPAPTAGN 352

Query: 328 NTD------KKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGK- 380
                    K+E  +NYE++     T   +  ++R+S AVVVN   + E  G+ A Q K 
Sbjct: 353 GQQGQAAGSKRESITNYEVDKTVRVTRAGSGAIKRVSAAVVVNYQAIAEAAGK-APQAKA 411

Query: 381 -IDSYLAEINKIVSAATGINSRRGDTITITSMDFL 414
                + ++  +V    G N  RGD++ I +  FL
Sbjct: 412 FTPEQIEQMTALVRETIGYNKDRGDSVNIMNTQFL 446


>gi|269139487|ref|YP_003296188.1| flagellar biosynthesis/type III secretory pathway lipoprotein
           [Edwardsiella tarda EIB202]
 gi|267985148|gb|ACY84977.1| flagellar biosynthesis/type III secretory pathway lipoprotein
           [Edwardsiella tarda EIB202]
 gi|304559376|gb|ADM42040.1| Flagellar M-ring protein FliF [Edwardsiella tarda FL6-60]
          Length = 572

 Score =  164 bits (414), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 130/452 (28%), Positives = 225/452 (49%), Gaps = 54/452 (11%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           L+LAS + + I++ +A   +  +P Y  LY  +   D   I   L++ NI +R ++NG++
Sbjct: 35  LLLASAVAIAIVVVLA--LWARAPDYRVLYSNISDRDGGAIVTQLTQMNIPYRFANNGAT 92

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           + VP+  V   R+ LA QGLP   +  G+EL D+   FG++ F ++I   RALEGE+ART
Sbjct: 93  LMVPADKVYDTRLKLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQINYQRALEGELART 150

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAA 197
           I+++  +V+ARVH+ MP    F +   +P+ASV +     RA++        AI ++V++
Sbjct: 151 IETLGPVVSARVHLAMPKPSLFVREQKQPSASVTLTLEPGRALDDG---QINAIVYMVSS 207

Query: 198 AVPNLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVD 256
           +V  L  G+VTV+D  G LLT  +   R++    L     ++  ++  I   L   LG  
Sbjct: 208 SVAGLPPGNVTVVDQFGHLLTQPDGTGRDLNAAQLKFTSEVEGRLQRRIETILQPMLGSG 267

Query: 257 NFRSAVVAELNMDTQQIREIVYDPDS-KVERSIR-------------LSKDAQRSETSQP 302
           N  + V A+L+  +++  +  Y P+    + +IR             L+     + +++P
Sbjct: 268 NVHAQVTAQLDFASREQTDEEYKPNQLPNQAAIRSQQISQSDQSGGQLNGGVPGALSNEP 327

Query: 303 ESAVTVEQNMPH----VSDRKVPLPR------------SLENTDKKEEQSNYEINTKSIA 346
               T   + P      + R  P P             S     +++E +NYE++     
Sbjct: 328 APPATGNIDKPRSAQGTAGRNTPTPSRSSAISNNGRLTSRNENIRRDETTNYEVDRTIRH 387

Query: 347 TTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTI 406
           T      +ERLS+AVVVN    T+    +  Q K+D    +IN +V  A G +  RGDT+
Sbjct: 388 TQARAGNIERLSVAVVVNYATDTKGKEIALSQEKMD----QINNLVREAMGFSQSRGDTL 443

Query: 407 TITSMDFLENQLFNSG-----TVQVSFMDILS 433
           ++ +  F  N + ++G       + SF+D+L+
Sbjct: 444 SVVNTPF--NSVEDNGGELPFWQKQSFIDLLT 473


>gi|161610775|ref|NP_946615.2| flagellar MS-ring protein [Rhodopseudomonas palustris CGA009]
          Length = 538

 Score =  164 bits (414), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 133/463 (28%), Positives = 223/463 (48%), Gaps = 15/463 (3%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           +  LL F K G    R   +I  +V LV    F+  R  V+ P    LY  L V D + I
Sbjct: 1   MQNLLGFLK-GLGAARLMAMIAVTVALVGFFAFVIMR--VSQPQMTTLYTDLSVEDSSSI 57

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
              L    I F + ++G+ + VP   V + R+ LA +G        GYE+FDK ++ G T
Sbjct: 58  IKELERQGIPFEMRNDGAILLVPKDKVTRLRMKLA-EGGLPKGGGVGYEIFDKSDALGTT 116

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS 183
           SF+Q I  +RALEGE++RTI++I  + AARVH+V+P+   F +    P+AS+++R     
Sbjct: 117 SFVQNINHLRALEGELSRTIRAIDRVQAARVHLVLPERPLFSREAPEPSASIVLRVRGAL 176

Query: 184 VYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQ--AIQHEI 241
             +   AIRHLVA+AV  L    V+++D  G+LL         +  + S  +  A +  +
Sbjct: 177 EPQQVRAIRHLVASAVNGLKPQRVSIVDEAGQLLADGSASGEQVEGATSDERRAAFEKRM 236

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
              I   +++ +G    R  V A+ + +        +DP+ +V RS +  +++  + TS 
Sbjct: 237 RNQIEGIVSSVVGSGRARVQVSADFDYNKITQTSDKFDPEGRVLRSSQTREES--AATSA 294

Query: 302 PESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAV 361
            +  VTV   +P  +  +    R +  + K EE +NYEI+  +     +  ++ RLS+AV
Sbjct: 295 ADGQVTVNNELPGANQGQGAGARDV--SKKSEETNNYEISRVTKTEVTEAGRVNRLSVAV 352

Query: 362 VVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNS 421
           +V+        G      +    L  I  +V +A G + +RGD I + ++ F E      
Sbjct: 353 LVDGAYTKNDKGELVYAERPKEQLDRIAALVRSAIGFDQKRGDQIEVVNLKFAEAPQVEK 412

Query: 422 GTVQVSFMDILSRHFATVIN----ALVFLVGTLLVTFLGLHAL 460
                  M +       ++N     ++FL+G L+V F+ +  L
Sbjct: 413 LPEPAGLMGMFQFTKDDIMNMIQLGVMFLLG-LVVLFMVIRPL 454


>gi|295690740|ref|YP_003594433.1| cyclic nucleotide-binding protein [Caulobacter segnis ATCC 21756]
 gi|295432643|gb|ADG11815.1| cyclic nucleotide-binding protein [Caulobacter segnis ATCC 21756]
          Length = 532

 Score =  163 bits (413), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 127/403 (31%), Positives = 207/403 (51%), Gaps = 35/403 (8%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            F+     + LY  L++ + + ++ ALS+A I F    +GS+I VP   V  AR+ +A +
Sbjct: 17  MFMGKEPNELLYSNLDLKEASEVTQALSQAGIKFETKGDGSTIMVPRDKVASARLMVAGK 76

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GL SS S  GYE+FD  N+ G T F+Q++ R RAL+GE+ RTI+++ G+ + RVH+V+P 
Sbjct: 77  GLVSSGS-IGYEIFDGGNALGQTDFVQQLNRQRALQGELERTIKAMQGVNSVRVHLVLPK 135

Query: 161 MGSFRKIGARPTASVMI--RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +   +P+A+V I   +  PS      AI++LV++AVPN+    V V+D  GK L+
Sbjct: 136 RQLFEEDSEQPSAAVTIGVGSREPST-DMVHAIQNLVSSAVPNMKAEKVAVIDQHGKTLS 194

Query: 219 ANEMERNILGKSLSIVQAIQHEIEMNINKA----LAAFLGVDNFRSAVVAELNMDTQQIR 274
           A   E ++ GK     Q  + E E  I K     +   LG    R  V AEL+++    +
Sbjct: 195 APSDE-SLAGKE---AQDRKVEAEARIAKTVKDMIEGVLGPGKARVNVTAELDLNRVTTQ 250

Query: 275 EIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEE 334
           E  +DPD +V RS   ++   +   ++  S  T   N+P           S    +  E 
Sbjct: 251 EERFDPDGQVVRSESTNESNSQENKNEDNSGATATANVPGQGAGGFQQLGSRAGAN--ES 308

Query: 335 QSNYEINTKSIATT-HDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSY-------LA 386
            +NYEI +KS+ TT  +   ++++++AV ++      V       GK  +Y       + 
Sbjct: 309 VTNYEI-SKSVKTTVQEPGTIKKVAVAVAIDG-----VTAPPGKDGKPGAYTPRSAQEIQ 362

Query: 387 EINKIVSAATGINSRRGDTITITSMDF-------LENQLFNSG 422
           +I ++V  A G ++ RGD + +T++ F       LE Q   SG
Sbjct: 363 QIEELVKTAVGFDAARGDQVKVTNIKFPQAEDQGLEKQGLLSG 405


>gi|256830792|ref|YP_003159520.1| flagellar M-ring protein FliF [Desulfomicrobium baculatum DSM 4028]
 gi|256579968|gb|ACU91104.1| flagellar M-ring protein FliF [Desulfomicrobium baculatum DSM 4028]
          Length = 537

 Score =  163 bits (413), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 122/406 (30%), Positives = 209/406 (51%), Gaps = 15/406 (3%)

Query: 36  FMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARI 95
           F    F++N   Y  LY +L   D   +   L +  I ++I+D+G++I VP  MV +ARI
Sbjct: 38  FFVMIFWMNKVDYRVLYSQLYQDDAASVVSYLQKEKIPYQITDSGATIMVPGDMVYEARI 97

Query: 96  HLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVH 155
            LA +G        G+ELFD+ NS G T+F+Q I   RAL+GE++RTI  +S + +ARVH
Sbjct: 98  KLAGEG-SLHGQGIGFELFDE-NSIGQTNFVQGINYQRALQGELSRTISELSEVESARVH 155

Query: 156 IVMPDMGSFRKIGARPTASVMIRAINPSVY--KSAEAIRHLVAAAVPNLDMGDVTVLDST 213
           +V+P+   F +  A P+A++M++         +  +AI +LV+ +V  +    +T+ DS 
Sbjct: 156 LVLPNKSLFVEEQAPPSAAIMLKLKGGRSLGAQQVQAIVNLVSTSVEGMSAEHITLADSR 215

Query: 214 GKLLTANEMERNILGKS---LSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDT 270
           GK+L   + + +I G S   L    ++Q  +E  I + L   +G     + V A+L+ D 
Sbjct: 216 GKILYEPKTDTDIAGLSSTQLEYQTSMQRSLEQRIEQLLLPIVGPGRVIARVNADLDFDR 275

Query: 271 QQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTD 330
             IR+ ++DP S V RS    K+ + S+ S      T + N    +DR      + + + 
Sbjct: 276 TTIRKEIFDPKSAVVRS--EVKNEEESKGSANVDGGTPDPNYQGENDRTA--SGTAQESV 331

Query: 331 KKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINK 390
           +    +N++IN +          ++RLS+AV+V+   + +  G  A +      + +I +
Sbjct: 332 RTSSTTNFDINKEEQQIIAQVGSIKRLSVAVLVDGKYIQQQDGTYAFEPLNAEQMEQIRQ 391

Query: 391 IVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHF 436
           +   A G +  RGD I ++S+ F E      G  Q   +D+ SR+F
Sbjct: 392 LSQRAVGFDDARGDAIEVSSISFGE----PVGAEQAPLLDVASRYF 433


>gi|15596298|ref|NP_249792.1| flagellar MS-ring protein [Pseudomonas aeruginosa PAO1]
 gi|107100552|ref|ZP_01364470.1| hypothetical protein PaerPA_01001577 [Pseudomonas aeruginosa PACS2]
 gi|116049030|ref|YP_792168.1| flagellar MS-ring protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|296390533|ref|ZP_06880008.1| flagellar MS-ring protein [Pseudomonas aeruginosa PAb1]
 gi|12230924|sp|Q51463|FLIF_PSEAE RecName: Full=Flagellar M-ring protein
 gi|9947018|gb|AAG04490.1|AE004540_10 Flagella M-ring outer membrane protein precursor [Pseudomonas
           aeruginosa PAO1]
 gi|115584251|gb|ABJ10266.1| Flagella M-ring outer membrane protein precursor [Pseudomonas
           aeruginosa UCBPP-PA14]
          Length = 598

 Score =  163 bits (413), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 136/566 (24%), Positives = 260/566 (45%), Gaps = 73/566 (12%)

Query: 33  IMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGK 92
           + +  A   +   P Y  LY  L   D NR+  AL+ A+I +++  N  ++ V +  +G+
Sbjct: 52  VAIGFAVVLWSQQPDYKPLYGSLNGVDANRVVEALTAADIPYKVEPNSGALLVKADDLGR 111

Query: 93  ARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAA 152
           AR+ +A+ G+  + +N G+E+ DK  + G + FM+     R LEGE+ART+ S++ + AA
Sbjct: 112 ARMKVASAGVAPTDNNVGFEILDKEQALGTSQFMEATNYRRGLEGELARTVSSLNNVKAA 171

Query: 153 RVHIVMPDMGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDV 207
           RVH+ +P    F +   +P+ASV++     R++ PS      AI +LVA +VP LD   V
Sbjct: 172 RVHLAIPKSSVFVRDDRKPSASVLVELYPGRSLEPS---QVMAIVNLVATSVPELDKSQV 228

Query: 208 TVLDSTGKLLTANE--MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAE 265
           TV+D  G LL+  +   E  + GK     + ++  +   ++  L   LG   +++ V A+
Sbjct: 229 TVVDQKGNLLSDQQELSELTMAGKQFDFTRRMEGLLTQRVHNILQPVLGNGRYKAEVSAD 288

Query: 266 LNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPH----------- 314
           ++    +    +Y+PD    RS + + + +R  +S P+       N P            
Sbjct: 289 VDFSAVESTSEMYNPDQPALRSEQRNNE-ERQNSSGPQGVPGALSNQPPGPASAPQQATA 347

Query: 315 --------------------VSDRKVPLPR-SLENTDKKEEQS-NYEINTKSIATTHDNY 352
                               + D K   P  +   TDK+++ + NYE++     T     
Sbjct: 348 SAPADYVAPGQPLKDANGQTIIDPKTGKPELAPYPTDKRDQTTRNYELDRSISYTKQQQG 407

Query: 353 KLERLSIAVVV-NKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSM 411
           +L RLS+AVV+ ++ ++    G  + Q      LA   ++V  + G ++ RGD++++ + 
Sbjct: 408 RLRRLSVAVVLDDQMKVDAKTGEVSHQPWSADELARFTRLVQDSVGYDASRGDSVSVINA 467

Query: 412 DFLENQLFNSGTV----QVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRR-LHNI 466
            F   Q     ++    Q  F DI+ +           ++G L +  L    LR  L NI
Sbjct: 468 PFAPAQAEEIDSIPFYSQPWFWDIVKQ-----------VLGVLFILVLVFGVLRPVLSNI 516

Query: 467 DDAKKGE--VGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIF-SHSRNLQSRINSYV 523
               KG+   GG        +  +   G + +D +++   +  +  S +    +++N+  
Sbjct: 517 TGGGKGKSLAGGGGRDGDLALGESGLEGSLADDRVSIGGPSSILLPSPTEGYDAQLNA-- 574

Query: 524 SKQSDLRLLHMIEINEERFAKILRKW 549
                  + +++  +  R A+++++W
Sbjct: 575 -------IKNLVAQDPGRVAQVVKEW 593


>gi|258592505|emb|CBE68814.1| Flagellar basal body M-ring protein [NC10 bacterium 'Dutch
           sediment']
          Length = 539

 Score =  163 bits (413), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 142/530 (26%), Positives = 249/530 (46%), Gaps = 51/530 (9%)

Query: 4   LDQLLQFFK---SGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           + ++++ FK    G  L    + +L     +  +L+M   F  + P    L+ +L  SD 
Sbjct: 5   ITKVVELFKQVWGGLGLTGRALTVLVGGGALTALLWMV--FSTHRPDMTTLFSQLNPSDA 62

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L    + +R+ D G+ I VPS++V + R+HLA +GLP      G+E+FD+  + 
Sbjct: 63  GAIVDELKSGKVSYRVVDGGTRILVPSAVVHEIRLHLATRGLPQGG-GVGFEIFDR-TTL 120

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           G T F+Q +   RAL+GE+ARTI  +  + AARVH+ +P    F +     TASV++  +
Sbjct: 121 GTTDFVQRLNYQRALQGELARTIGQLKEVTAARVHLALPQPSVFTEQEKPATASVVLN-L 179

Query: 181 NPSVYKSAEAIR---HLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKS--LSIVQ 235
            P    + E +R   HLV+++V  L+   +TV+D++GKL+      R   G +      +
Sbjct: 180 RPGARLTPEQVRGIVHLVSSSVEGLNADRITVVDTSGKLIARPAEGRLGAGSTGQFEAQE 239

Query: 236 AIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQ 295
           A++ E+E  +   L   LG +     V A+++  + +  E  +DP   ++   R + + Q
Sbjct: 240 AVEGELERRVRTMLEEILGPNKATVRVAAQMDFTSVERTEERFDPRGVIKSEQR-TTETQ 298

Query: 296 RSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLE 355
           +S T+ P +   V  N+P  +       +S   + K+ E   Y+++           +L+
Sbjct: 299 QSVTASPAAVAGVASNVPDQTATPSQSGQSTAKSTKEAETVQYDVSKVLERKVFSPGELK 358

Query: 356 RLSIAVVVN----------KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDT 405
           R+S+AV+V+           G   E + R +D+      L +I   V  A G ++ RGD 
Sbjct: 359 RVSVAVMVDGTYKPVPDGKGGERKEYVPRKSDE------LEKIKVAVKNAVGFSAARGDE 412

Query: 406 ITITSMDFLENQLFNSGTVQVSFMDILSRH--FATVINALVFLVGTLLVTFLGLHAL--- 460
           + +    F  +        + + M+   R   + +++  ++  VG LLV   GL  L   
Sbjct: 413 VEVVEFPFDTSATEK----ERALMEEAERKAFWYSLVKPVLMGVGVLLVLVFGLRPLIRS 468

Query: 461 ---RRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQD 507
              RRL   D       G  S+  P P  +A+ TG  P+   ALD ++ D
Sbjct: 469 LKERRLPTFDTP-----GMLSMSQPGP--TAIETG--PDQAPALDVASDD 509


>gi|85858817|ref|YP_461019.1| flagellar M-ring protein [Syntrophus aciditrophicus SB]
 gi|85721908|gb|ABC76851.1| flagellar M-ring protein [Syntrophus aciditrophicus SB]
          Length = 509

 Score =  163 bits (412), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 128/425 (30%), Positives = 206/425 (48%), Gaps = 45/425 (10%)

Query: 4   LDQLLQFF----KSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSD 59
           ++  L+F+    +S   L   R   L  V  + + +  A  +F N P Y  L+  L   D
Sbjct: 1   MNSFLRFYENLRQSFVELPPARKWSLLFVAGMTLSVLAAMVYFANRPEYKVLFSHLSSED 60

Query: 60  VNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNS 119
            + I   L E  I + I+  G +I VP+  V + R+ LA  GLP      G+E+FD+  +
Sbjct: 61  ASSILAKLQEKKISYEINSAGDTIFVPAEKVSELRLELAGSGLPQGG-GVGFEIFDQ-KT 118

Query: 120 FGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA 179
            G T F Q++   RAL+GE+ RTI+ +  I ++RVHI +P    F     +PTASV ++ 
Sbjct: 119 LGATEFEQQLNYRRALQGELGRTIKGLEEIESSRVHIALPRESLFVSEEKKPTASVTLK- 177

Query: 180 INPSVYKSA---EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQA 236
           + P    S+   E I HLVA++V  L+ GDV ++D+ G +L+  + E  + G S S    
Sbjct: 178 LKPGRSLSSSQIEGIAHLVASSVEGLNAGDVIIVDNKGNILSKLKGESGLSGLSGS---- 233

Query: 237 IQHEIEMNINKALAA--------FLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSI 288
            Q E + N+ K  AA         +G       V A+L+    +  E  YDP+S V RS 
Sbjct: 234 -QIEFQRNLEKDTAARIQSLLENVVGQGKAVVRVAADLDFRMTEKTEESYDPESPVVRST 292

Query: 289 RLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATT 348
           +  K +++S T             P  +D+           +K +E  NYEIN     T 
Sbjct: 293 Q--KQSEKSAT-------------PGKADQST-------GQEKLDEIINYEINKTVSKTV 330

Query: 349 HDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITI 408
               ++ +LSIAV+V+   + +  G+   Q +    +  I ++V  + G ++ RGD +T+
Sbjct: 331 MPVGEIRKLSIAVLVDGTYVKDKQGKEIYQPRSKKEIESIEELVRTSAGFSTARGDQVTV 390

Query: 409 TSMDF 413
           T+M F
Sbjct: 391 TNMPF 395


>gi|34498591|ref|NP_902806.1| flagellar M-ring protein [Chromobacterium violaceum ATCC 12472]
 gi|34104445|gb|AAQ60803.1| flagellar M-ring protein [Chromobacterium violaceum ATCC 12472]
          Length = 579

 Score =  163 bits (412), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 136/464 (29%), Positives = 227/464 (48%), Gaps = 43/464 (9%)

Query: 21  RILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNG 80
           +IL L ++  +   + + A     +P Y  L+  L   D  +++ AL + N+ +++ + G
Sbjct: 32  KILFLTALAAI-FAVVVGAVLLNRTPSYKILFSNLADRDGGQVTAALQQMNVPYQLGE-G 89

Query: 81  SSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIA 140
             ISVP+  V   R+ LAAQGLP +S   G+EL D    FG++ F +++   R++EGE+A
Sbjct: 90  GVISVPADKVYDVRLKLAAQGLPKASG-VGFELMDN-QKFGISQFAEQVNYQRSIEGELA 147

Query: 141 RTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAA 198
           RTI++IS + +ARVHI  P    F +    PTASVM++     +    +   I HLV+++
Sbjct: 148 RTIEAISSVQSARVHIATPKQSVFVREQQSPTASVMLQLYPGRMLDGGQVAGILHLVSSS 207

Query: 199 VPNLDMGDVTVLDSTGKLLT--ANEMERNILG-KSLSIVQAIQHEIEMNINKALAAFLGV 255
           VPNL + +VT++D  G LL+  A   E + L  + L  V+ I+      I   L    G 
Sbjct: 208 VPNLPLKNVTIVDQDGNLLSKQAGPDENSGLDQRQLGFVRQIEEGYVKRIEDILEPIFGR 267

Query: 256 DNFRSAVVAELNM-DTQQIREIVYDPDSKVERSIRLSKDAQRSE---------------- 298
            N R+ V A ++  +T+Q  E  Y P+S    S   ++  Q SE                
Sbjct: 268 GNARAQVTANVDFSETEQTSE-TYRPNSSPNPSA--TRSQQISEKLVNGSANPTGVPGAL 324

Query: 299 TSQPESAVTVEQNMP--------HVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHD 350
           ++QP SA +    +P        ++S   V    S   T +++  +NYE++     T   
Sbjct: 325 SNQPPSAASAPITLPPGAAPGTANLSGGSV----SASGTLQRDITTNYEVDKTIQHTKVP 380

Query: 351 NYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITS 410
              ++RLS AVVVN  R+ +  G           + +IN +V  A G NS RGDT+ + +
Sbjct: 381 TGVVKRLSAAVVVNYRRMPDKSGEMKPTPLTPQEVQQINNLVKEAMGYNSGRGDTLNVVN 440

Query: 411 MDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTF 454
             F +N      T+Q   +D +S +  +++   +  +  L + F
Sbjct: 441 AAFADNA--QPVTMQERVIDYVSGNGTSLVKYGLLGIAVLYLLF 482


>gi|152984140|ref|YP_001349624.1| flagellar MS-ring protein [Pseudomonas aeruginosa PA7]
 gi|150959298|gb|ABR81323.1| flagellar M-ring protein FliF [Pseudomonas aeruginosa PA7]
          Length = 597

 Score =  163 bits (412), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 132/493 (26%), Positives = 232/493 (47%), Gaps = 62/493 (12%)

Query: 33  IMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGK 92
           + +  A   +   P Y  LY  L   D NR+  AL+ A+I +++  N  ++ V +  +G+
Sbjct: 52  VAIGFAVVLWSQQPDYKPLYGSLNGVDANRVVEALTAADIPYKVEPNSGALLVKADDLGR 111

Query: 93  ARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAA 152
           AR+ +A+ G+  + +N G+E+ DK  + G + FM+     R LEGE+ART+ S++ + AA
Sbjct: 112 ARMKVASAGVAPTDNNIGFEILDKEQALGTSQFMEATNYRRGLEGELARTVSSLNNVKAA 171

Query: 153 RVHIVMPDMGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDV 207
           RVH+ +P    F +   +P+ASV++     R++ PS      AI +LVA +VP LD   V
Sbjct: 172 RVHLAIPKSSVFVRDDRKPSASVLVELYPGRSLEPS---QVMAIVNLVATSVPELDKSQV 228

Query: 208 TVLDSTGKLLTANE--MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAE 265
           TV+D  G LL+  +   E  + GK     + ++  +   ++  L   LG   +++ V A+
Sbjct: 229 TVVDQKGNLLSDQQELSELTMAGKQFDFTRRMEGLLTQRVHNILQPVLGNGRYKAEVSAD 288

Query: 266 LNMDTQQIREIVYDPDSKVERS-IRLSKDAQRSE---------TSQPESAVTVEQ----- 310
           ++    +    +Y+PD    RS  R +++ Q S          ++QP    T  Q     
Sbjct: 289 VDFSAVESTSEMYNPDQPALRSEQRNNEERQNSSGPQGVPGALSNQPPGPATAPQQATAG 348

Query: 311 ---------------NMPHVSDRKVPLPR-SLENTDKKEEQS-NYEINTKSIATTHDNYK 353
                          N   + D K   P  +   TDK+++ + NYE++     T     +
Sbjct: 349 APADYVAPGQPLKDANGQTIIDPKTGKPELAPYPTDKRDQTTRNYELDRSISYTKQQQGR 408

Query: 354 LERLSIAVVV-NKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMD 412
           L RLS+AVV+ ++ ++    G  + Q      LA   ++V  + G ++ RGD++++ +  
Sbjct: 409 LRRLSVAVVLDDQMKVDAKTGEVSHQPWSADELARFTRLVQDSVGYDASRGDSVSVINAP 468

Query: 413 FLENQLFNSGTV----QVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRR-LHNID 467
           F   Q     ++    Q  F DI+ +           ++G L +  L    LR  L NI 
Sbjct: 469 FAPAQAEEIDSIPFYSQPWFWDIVKQ-----------VLGVLFILVLVFGVLRPVLSNIS 517

Query: 468 DAKKGEV---GGK 477
              KG+    GG+
Sbjct: 518 GGGKGKALADGGR 530


>gi|326319071|ref|YP_004236743.1| flagellar M-ring protein FliF [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323375907|gb|ADX48176.1| flagellar M-ring protein FliF [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 568

 Score =  163 bits (412), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 132/443 (29%), Positives = 212/443 (47%), Gaps = 35/443 (7%)

Query: 46  PHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSS 105
           P Y  L+  L   D   I   LS  N+ ++ S+ G +I VP+  V   R+ LA QGLP  
Sbjct: 56  PDYKVLFSNLSDKDGGAIVAQLSTMNVPYKYSEGGGAILVPAERVHDVRLRLATQGLPKG 115

Query: 106 SSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFR 165
           S  +G+EL +  N FG+T F + +   R LEGE+ R+IQ++S + +ARVH+ +P+   F 
Sbjct: 116 SV-TGFELME-TNRFGVTQFQERLNFQRGLEGELTRSIQALSSVQSARVHLALPNQNGFF 173

Query: 166 KIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL----- 217
           +   +P+ASV++ ++ P  +        I HLVA++VP +    V+VLD TGKLL     
Sbjct: 174 REQQKPSASVLL-SLYPGRFLDRTQLAGIVHLVASSVPEMSPSAVSVLDDTGKLLSQSPD 232

Query: 218 TANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNM----DTQQI 273
           TA      I  + LS VQ I+ +    I   L   +G +N ++ V AE++      T + 
Sbjct: 233 TAAGSGSAIDAQQLSYVQQIEQQYTRRILDILEPVVGKNNVKAQVTAEVDFSQSEQTSEQ 292

Query: 274 REIVYDPDSKVERSIRLSKDAQRSETSQPESAV--TVEQNMPHVSDRKV----PLPRSLE 327
                 PDS   RS ++ + +  ++ +QP + V        P  S   +    P P +  
Sbjct: 293 HRPNQTPDSSAVRSQQVVESSGGTQGNQPPAGVPGAASNQPPQPSTAPINGANPAPTAGN 352

Query: 328 NTD------KKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGK- 380
                    K+E  +NYE++     T   +  ++R+S AVVVN   + E  G+ A Q K 
Sbjct: 353 GQQGQAAGSKRESITNYEVDKTVRVTRAGSGAIKRVSAAVVVNYQAIAEAAGK-APQAKA 411

Query: 381 -IDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATV 439
                + ++  +V    G N  RGD++ I +  FL   + N+  V++            +
Sbjct: 412 FTPEQIEQMTALVRETIGYNKDRGDSVNIMNTQFL---VDNTPAVELPLWK--QPEMIEL 466

Query: 440 INALVFLVGTLLVTFLGLHALRR 462
           + +L + VG  L   L L  L R
Sbjct: 467 VRSLGWPVGMSLFAALILLGLVR 489


>gi|218892935|ref|YP_002441804.1| flagellar MS-ring protein [Pseudomonas aeruginosa LESB58]
 gi|218773163|emb|CAW28975.1| Flagella M-ring outer membrane protein precursor [Pseudomonas
           aeruginosa LESB58]
          Length = 598

 Score =  163 bits (412), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 136/566 (24%), Positives = 260/566 (45%), Gaps = 73/566 (12%)

Query: 33  IMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGK 92
           + +  A   +   P Y  LY  L   D NR+  AL+ A+I +++  N  ++ V +  +G+
Sbjct: 52  VAIGFAVVLWSQQPDYKPLYGSLNGVDANRVVEALTAADIPYKVEPNSGALLVKADDLGR 111

Query: 93  ARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAA 152
           AR+ +A+ G+  + +N G+E+ DK  + G + FM+     R LEGE+ART+ S++ + AA
Sbjct: 112 ARMKVASAGVAPTDNNVGFEILDKEQALGTSQFMEATNYRRGLEGELARTVSSLNNVKAA 171

Query: 153 RVHIVMPDMGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDV 207
           RVH+ +P    F +   +P+ASV++     R++ PS      AI +LVA +VP LD   V
Sbjct: 172 RVHLAIPKSSVFVRDDRKPSASVLVELYPGRSLEPS---QVMAIVNLVATSVPELDKSQV 228

Query: 208 TVLDSTGKLLTANE--MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAE 265
           TV+D  G LL+  +   E  + GK     + ++  +   ++  L   LG   +++ V A+
Sbjct: 229 TVVDQKGNLLSDQQELSELTMAGKQFDFTRRMEGLLTQRVHNILQPVLGNGRYKAEVSAD 288

Query: 266 LNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPH----------- 314
           ++    +    +Y+PD    RS + + + +R  +S P+       N P            
Sbjct: 289 VDFSAVESTSEMYNPDQPALRSEQRNNE-ERQNSSGPQGVPGALSNQPPGPASAPQQATA 347

Query: 315 --------------------VSDRKVPLPR-SLENTDKKEEQS-NYEINTKSIATTHDNY 352
                               + D K   P  +   TDK+++ + NYE++     T     
Sbjct: 348 SAPADYVAPGQPLKDANGQTIIDPKTGKPELAPYPTDKRDQTTRNYELDRSISYTKQQQG 407

Query: 353 KLERLSIAVVV-NKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSM 411
           +L RLS+AVV+ ++ ++    G  + Q      LA   ++V  + G ++ RGD++++ + 
Sbjct: 408 RLRRLSVAVVLDDQMKVDAKTGEVSHQPWSADELARFTRLVQDSVGYDASRGDSVSVINA 467

Query: 412 DFLENQLFNSGTV----QVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRR-LHNI 466
            F   Q     ++    Q  F DI+ +           ++G L +  L    LR  L NI
Sbjct: 468 PFAPVQAEEIDSIPFYSQPWFWDIVKQ-----------VLGVLFILVLVFGVLRPVLSNI 516

Query: 467 DDAKKGE--VGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIF-SHSRNLQSRINSYV 523
               KG+   GG        +  +   G + +D +++   +  +  S +    +++N+  
Sbjct: 517 TGGGKGKSLAGGGGRDGDLALGESGLEGSLADDRVSIGGPSSILLPSPTEGYDAQLNA-- 574

Query: 524 SKQSDLRLLHMIEINEERFAKILRKW 549
                  + +++  +  R A+++++W
Sbjct: 575 -------IKNLVAQDPGRVAQVVKEW 593


>gi|15606425|ref|NP_213805.1| flagellar M-ring protein [Aquifex aeolicus VF5]
 gi|6225356|sp|O67241|FLIF_AQUAE RecName: Full=Flagellar M-ring protein
 gi|2983628|gb|AAC07196.1| Flagellar M-ring protein [Aquifex aeolicus VF5]
          Length = 489

 Score =  163 bits (412), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 113/394 (28%), Positives = 205/394 (52%), Gaps = 33/394 (8%)

Query: 31  VPIMLF---MAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPS 87
           +P++L      A  +++  +Y  LY  L   D+N +   L +  + ++IS +G +I VP 
Sbjct: 29  IPLLLLSLGAVALIYLSQENYTVLYTGLSPDDLNAVVTELDKEGVKYKISPDGRTIYVPE 88

Query: 88  SMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSIS 147
           ++  + R+ LAA+G+P      GYELFDK +   L+ F Q +   RA+EGE+A+TI S+ 
Sbjct: 89  NVARELRLKLAAKGVPRKGI-VGYELFDK-SGIVLSRFQQLVNFKRAIEGELAKTIMSLD 146

Query: 148 GIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE---AIRHLVAAAVPNLDM 204
            +  ARVHIV+P+   F +      ASV ++ + P    + E   AIR+LV+ +V NL  
Sbjct: 147 CVEFARVHIVLPEKSLFIREEEEAKASVFLK-LKPGCELTPEQVKAIRNLVSGSVENLKP 205

Query: 205 GDVTVLDSTGKLLTA---NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSA 261
             V V+D  G+ LTA    E + N     L + +  +  +E  + K L    G    +  
Sbjct: 206 SQVVVVDDKGRDLTAYLDEEFKTN--ASQLKVKREFEKSLERKLQKTLEEVFGYGKVKVN 263

Query: 262 VVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVP 321
           V AEL+  + + RE +YDPD  +   +   K  +R+ +++ +     + N+P  + R+  
Sbjct: 264 VSAELDFSSMKKREELYDPD--LTAVVSEQKKKERTTSTRAQGIPGTQANIPPATGRQ-- 319

Query: 322 LPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKI 381
                  T++KE  +NYE++ + I       K++R+S+ +V++K              K+
Sbjct: 320 -GGGELITERKESITNYEVSKREIYFEDKTIKVKRISVGLVIDK------------DVKV 366

Query: 382 DSYLAEINKIVSAATGINSRRGDTITITSMDFLE 415
           ++   E+  ++ A+ G++ +RGD ++I S+ F++
Sbjct: 367 NT--EELKNLIIASAGLDPKRGDQVSIVSVPFVK 398


>gi|238782822|ref|ZP_04626851.1| Flagellar M-ring protein [Yersinia bercovieri ATCC 43970]
 gi|238716245|gb|EEQ08228.1| Flagellar M-ring protein [Yersinia bercovieri ATCC 43970]
          Length = 569

 Score =  162 bits (411), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 132/489 (26%), Positives = 226/489 (46%), Gaps = 58/489 (11%)

Query: 33  IMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGK 92
           I L +A  F+  SP Y  L+  +   D   I   L++ N+ +R  D G +I VP+  V +
Sbjct: 39  ITLIIALLFWAKSPDYRVLFSNITDQDGGAIVSQLAQMNVPYRFEDRGGAIMVPADKVYE 98

Query: 93  ARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAA 152
           AR+ LA  GLP   +  G+EL D+   FG++ F +++   RALEGE++RTI+++  +  A
Sbjct: 99  ARLKLAQLGLPKGGA-VGFELLDQ-EKFGISQFSEQVNFQRALEGELSRTIETLGSVNGA 156

Query: 153 RVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVL 210
           RVH+ MP    F +   +P+ASV +R  N  + +  +  AI +L+A+AVP L    VT++
Sbjct: 157 RVHLAMPKPSMFVREQKQPSASVTVRLNNGRLLEGEQVSAITYLIASAVPGLSADSVTIV 216

Query: 211 DSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDT 270
           D  G+LLT    +     + L     ++ + +  I   L+  +G +N +S V A+L+   
Sbjct: 217 DQNGRLLTQRGGQTTQTSQ-LKFTSEVEADFQQRIQSILSPIVGRNNVKSQVTAQLDFTL 275

Query: 271 QQIREIVYDPDSKVER-SIRLSK--DAQRSETSQPESAVTVEQNMPHVSDR--------- 318
            +     + P++  +R SIR S+  DA++              N P +            
Sbjct: 276 HEQTAEQFQPNTAPDRMSIRSSQSSDAEQGGKGGVGGVPGALSNQPSLPATAPITQAATP 335

Query: 319 --------------------------KVPLPRSLENTDKKEEQSNYEINTKSIATTHDNY 352
                                       P+P +    ++++  +NYE++           
Sbjct: 336 TAPGATGAAGAATAGATGAKGGAATVATPIPFN----NRRDNTTNYELDRTLTHIKRSTG 391

Query: 353 KLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMD 412
            +ERLSIAVV+N   L    G SA   K    + +I+ +V  A G ++ RGDT+ I +  
Sbjct: 392 SIERLSIAVVINY--LPTAEGESAPLPK--EQMEQISALVKEAVGFSAERGDTVNIVNSP 447

Query: 413 F--LENQLFNSGTVQVSFMDIL---SRHFATVINALVFLVGTLLVTFLGLHA--LRRLHN 465
           F  +E ++      Q  F+++L    R+    I A +F    +   +L      L RL  
Sbjct: 448 FNNVEEEVAPPFWQQAGFINLLMAAGRYLLVAIVAWLFWRKAIKPAWLRNQELILARLEL 507

Query: 466 IDDAKKGEV 474
             +A++ E+
Sbjct: 508 EKEARQAEL 516


>gi|300722640|ref|YP_003711930.1| flagellar basal-body MS-ring and collar protein [Xenorhabdus
           nematophila ATCC 19061]
 gi|297629147|emb|CBJ89743.1| flagellar biosynthesis; basal-body MS(membrane and
           supramembrane)-ring and collar protein [Xenorhabdus
           nematophila ATCC 19061]
          Length = 574

 Score =  162 bits (411), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 121/423 (28%), Positives = 210/423 (49%), Gaps = 47/423 (11%)

Query: 33  IMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGK 92
           I + +A   ++ SP Y  LY  L   D   I   L++ N+ +R ++NGS+I +P+  V +
Sbjct: 37  IAIVVALFLWLRSPDYRVLYSNLSDKDGGEIVTQLTQMNVPYRFAENGSAIMIPTEKVHE 96

Query: 93  ARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAA 152
            R+ LA QGLP   + +G+EL DK   FG++ F +++   RALEGE+ART++S+  + +A
Sbjct: 97  TRLKLAQQGLPKGGA-TGFELLDK-EKFGISQFSEQVNYQRALEGELARTVESLGPVQSA 154

Query: 153 RVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVL 210
           RVH+ MP    F +    P+ASV +  +   V    +  AI H+V+++V  L  G+VT++
Sbjct: 155 RVHLAMPKPSLFVREQKSPSASVTVGLLQGRVLDEGQINAIVHMVSSSVAGLPAGNVTIV 214

Query: 211 DSTGKLLTANEME-RNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMD 269
           D +G+LLT ++   R++    L   Q I++     I   LA  +G  N  + V A+++  
Sbjct: 215 DQSGRLLTQSDATGRDLNTTQLKYTQEIENRFRHRIETILAPVVGRGNVHAQVTAQVDFS 274

Query: 270 TQQIREIVYDPDSKVER-SIRLSKDAQRSE-------------TSQPESAVTVEQNMPHV 315
            ++     Y P+    + ++R  + +   +             ++QP +A +     P+ 
Sbjct: 275 RREETTEEYKPNQPPNQAAVRSKQSSSSEQSGGPLVGGVPGALSNQPSAAPSAPIEKPNT 334

Query: 316 ---------SDRK------------VPLPRSLEN--TDKKEEQSNYEINTKSIATTHDNY 352
                    SD K                R + N   ++ +E +NYE++     T     
Sbjct: 335 NANTNAKDNSDEKPDQQQRNGNNRNNSYERMVSNNHNNRYDETTNYEVDRTIRHTQLQAG 394

Query: 353 KLERLSIAVVVNKGRLTEVLGRSADQGK--IDSYLAEINKIVSAATGINSRRGDTITITS 410
            +ERLS+AVVVN    T V G +  + K  +   LA+I  +   A G ++ RGD++ +T+
Sbjct: 395 AVERLSVAVVVN---YTMVQGENGPETKPLMPEQLAQIEALTREAIGFSTDRGDSLNVTN 451

Query: 411 MDF 413
             F
Sbjct: 452 TPF 454


>gi|121533763|ref|ZP_01665590.1| flagellar M-ring protein FliF [Thermosinus carboxydivorans Nor1]
 gi|121307754|gb|EAX48669.1| flagellar M-ring protein FliF [Thermosinus carboxydivorans Nor1]
          Length = 511

 Score =  162 bits (411), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 128/421 (30%), Positives = 215/421 (51%), Gaps = 37/421 (8%)

Query: 5   DQLLQFFKSGTSLGRT-RILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           +Q LQ ++S   LG+  R LI AS   V   + + + ++     Y  LY  L++ D   +
Sbjct: 6   EQSLQIWRS---LGKKQRYLIAASAFFVFAAILLWSYWWGGRIDYVPLYTGLDLKDAGEV 62

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
              L E  +  +I  NGS+I VP+  V + R+ LA+QGLP      G+E+FD+   FG+T
Sbjct: 63  VGKLKEMKVPHQIEANGSAILVPAKDVHRVRLELASQGLPRGYK--GFEIFDQ-TKFGIT 119

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS 183
            F Q++  ++AL+GE+ RTI+ ++ +  ARVHIV+ +   ++K     TASVM++ + P 
Sbjct: 120 DFQQKVYLLQALQGELTRTIEQMAEVEKARVHIVLAEDSLYKKNEKPATASVMLK-LRPG 178

Query: 184 VYKSAEAIR---HLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQ----- 235
           V  S E +R   +LVA ++  L   +VTV+D+  ++L  ++++      ++ + Q     
Sbjct: 179 VQLSREQVRGIVNLVAHSIQGLKPENVTVVDNYARVLN-DQVDTPFTAGTIPVTQLELTK 237

Query: 236 AIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDP---DSKVERSIRLSK 292
            IQ +++ N++  L   LG     + V  ELN D + I   +++P   D  + RS++   
Sbjct: 238 KIQEDLQKNVHTLLEQVLGPGKAAARVSVELNFDQRTIDRQIFEPIVDDKGIIRSMQEMS 297

Query: 293 DAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNY 352
           +  R              N+P      V    +  N +KKE   NYEIN           
Sbjct: 298 ETYRGSAPVAGGVPGTTANIPGY----VTGANNQSNYEKKEVTRNYEINETKEKVVTAPG 353

Query: 353 KLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMD 412
            ++RL++AV+V+          S D+ K +S    I K V++A G+N  RGDTI++ S+ 
Sbjct: 354 AIKRLTVAVLVDA---------SIDRAKQES----IAKTVASAVGLNPSRGDTISVESIP 400

Query: 413 F 413
           F
Sbjct: 401 F 401


>gi|146312175|ref|YP_001177249.1| flagellar MS-ring protein [Enterobacter sp. 638]
 gi|145319051|gb|ABP61198.1| flagellar M-ring protein FliF [Enterobacter sp. 638]
          Length = 565

 Score =  162 bits (410), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 121/414 (29%), Positives = 195/414 (47%), Gaps = 56/414 (13%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  SP Y  LY  +   D   I   L++ NI +R +DNG +I VP+  V + R+ LA Q
Sbjct: 44  LWAKSPDYRTLYSNVSDQDGGAIVTQLTQLNIPYRFADNGGAIEVPADKVHELRLRLAQQ 103

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F ++I   RALEGE+ARTI+++  +  ARVH+ MP 
Sbjct: 104 GLPKGGA-VGFELLDQ-EKFGISQFSEQINYQRALEGELARTIETLGPVKTARVHLAMPK 161

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VTV+D +G 
Sbjct: 162 PSLFVREQKNPSASVTVTLEPGRALDEG---QISAVTHLVSSAVAGLPTGNVTVVDQSGH 218

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  I+  I   L   +G  N  + V A++N D ++  
Sbjct: 219 LLTQSNTSSRDLNDAQLKYANDVEGRIQRRIEAILGPIVGSSNIHAQVTAQINFDNKEQT 278

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQPESAVTVEQNMPH------ 314
           E  Y P+    +++  S+    +E              ++QP  A +   + P       
Sbjct: 279 EEQYSPNGDAAQAVMRSRQLNTTEQIGGQNPGGVPGALSNQPAPANSAPISTPPANQQNG 338

Query: 315 -------------VSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAV 361
                         S      PR+      + E +NYE++     T  +   ++RLS+AV
Sbjct: 339 QQNGQQNNQQQQTTSTAASSGPRN----SSRNETTNYEVDRTIRHTKMNVGDVQRLSVAV 394

Query: 362 VVNKGRLTE--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           VVN   L +   L  + DQ K      +I  +   A G   +RGD++ + +  F
Sbjct: 395 VVNYKTLPDGKPLPLTTDQMK------QIEDLTREAMGFTEKRGDSLNVVNSPF 442


>gi|309779486|ref|ZP_07674247.1| flagellar M-ring protein FliF [Ralstonia sp. 5_7_47FAA]
 gi|308921727|gb|EFP67363.1| flagellar M-ring protein FliF [Ralstonia sp. 5_7_47FAA]
          Length = 610

 Score =  162 bits (410), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 146/566 (25%), Positives = 267/566 (47%), Gaps = 77/566 (13%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  +  SD   I  AL + N+ +R ++ G++I VP + V +AR+ LA+Q
Sbjct: 69  LWSRAPDYRVLYSNVSDSDGGAIIAALQQMNVPYRFAEGGTAIMVPEASVHEARLKLASQ 128

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP     +G+EL +    FG + F +++   RALEGE+ARTIQ++  + +ARVH+ M  
Sbjct: 129 GLPKGG-QAGFELMEN-QKFGTSQFTEQVNYQRALEGELARTIQAMQEVQSARVHLAMTK 186

Query: 161 MGSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +  A+P+ASV+++ + P         +AI HLV+++VPNL + +VTV+D +G+LL
Sbjct: 187 PSVFVREQAKPSASVLLK-LYPGRMLDRSQVQAIGHLVSSSVPNLPLANVTVVDQSGRLL 245

Query: 218 TANEMERNILG---KSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMD-TQQI 273
           +++  + N  G     LS V+ ++      I   L   +G DN R+ V A++++D T+Q+
Sbjct: 246 SSS-FQDNASGLDPTQLSYVRDVEQGYIKRIEAILGPVVGEDNVRAQVTADVDLDNTEQM 304

Query: 274 REIV---YDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPL-------- 322
            E      DP +   RS   ++  Q    +Q         N P  + R +P         
Sbjct: 305 AESYRPNQDPANAAVRSTHTAEATQNKADAQ-GGVPGALSNQPPTAPRMLPTAPAPASAS 363

Query: 323 ----------PR------------SLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
                     P+            S  ++  ++  +NYE++     T      + RLS+A
Sbjct: 364 QPAATGPNGQPQQVAAANTGGTAASGNSSSTRDTTTNYEVDKTVRRTRAAVGTVRRLSVA 423

Query: 361 VVVN---KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           VVVN    G+  + L         ++ + ++N +V  A G +++RGD++ + +  F    
Sbjct: 424 VVVNYRGDGKTWKPLS--------EAEMVKLNALVKDAVGFDAKRGDSVNVVNSQF---- 471

Query: 418 LFNSGTVQVSFMDI-------LSRHFATVINALVFLVGTLLVTFLGLH-ALRRLHNIDDA 469
              SGT+ +S  D+       + ++       L   +G L++ F  +  A+R +   D  
Sbjct: 472 ---SGTLPMSKDDLPLWKQPDMIQYAIQAAKYLALAIGFLILVFAVIRPAIRSMGEKDAP 528

Query: 470 KKGEVGGKSILSP--PPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQS 527
                 G+    P  P I+ A  +     +  A  + ++++      L++  N +  K  
Sbjct: 529 ATPTFVGREGEDPNAPIITGAAASAGPELEGPAAGADSEELPDALPQLKN--NDFEKKLE 586

Query: 528 DLRLLHMIEINEERFAKILRKWARSE 553
            +R   + + N    A ++++W  +E
Sbjct: 587 TMR--RVAQSNPRAVAAVIKQWVSNE 610


>gi|197120199|ref|YP_002140626.1| flagellar M-ring mounting plate protein FliF [Geobacter
           bemidjiensis Bem]
 gi|197089559|gb|ACH40830.1| flagellar M-ring mounting plate protein FliF [Geobacter
           bemidjiensis Bem]
          Length = 523

 Score =  162 bits (410), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 139/487 (28%), Positives = 226/487 (46%), Gaps = 46/487 (9%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           L +LL+ F    +L   + L++  V L  ++ F A     N   Y  L+  L   D   I
Sbjct: 5   LKKLLEPF---LALSTAKRLVVGGVALASLLGFAALIAVANKTDYRPLFANLTQEDAGEI 61

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
              L E  + ++IS +G +I VPS  V   R+ LA+ GLP      G+E+FD+ N FG+T
Sbjct: 62  VKKLKEQKVPYQISPDGKAILVPSDNVYDLRLSLASDGLPQGG-GVGFEIFDRKN-FGMT 119

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS 183
            F+Q++   RAL+GE+ RTI  I+G+ +ARVH+ +P+   F+      TASV+++  +  
Sbjct: 120 EFVQKLNYQRALQGELGRTIAQIAGVESARVHLALPEKALFKDQEKPATASVVLKMKSNR 179

Query: 184 VYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA---NEMERNILGKSLSIVQAIQ 238
             +  E   I HLVA+++  +D   VTVLD+ GK+L++   N+    + G      +A +
Sbjct: 180 QLREGEVQGIVHLVASSIEGMDPEQVTVLDTRGKVLSSHSPNDPTSKVAGARQDTQRAFE 239

Query: 239 HEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE 298
              E  +   L   +G     + V A  +    +  E  YDP+S   RS       QRSE
Sbjct: 240 KTEEEKLQSLLDRVVGSGKSVARVSASFDFKQVEKYEERYDPESAAVRS------EQRSE 293

Query: 299 -----TSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYK 353
                +S       V+ NM                TD   E  NYE++  +         
Sbjct: 294 EKGGGSSTASGVPGVQSNMGRAQGAAGSTTGGGSKTD---ETLNYEVSRSTARIIEPVGS 350

Query: 354 LERLSIAVVVNKGRLTEVLGRSADQGKIDSY-------LAEINKIVSAATGINSRRGDTI 406
           L ++S+A++V+ G+    L   A  G    Y       + +I  +V +A G N+ RGD +
Sbjct: 351 LSKVSVAILVD-GKYE--LSPGAKPGATPKYQPRSPDEMQKIESLVKSAVGFNAERGDQV 407

Query: 407 TITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALV--FLVGT--LLVTFLGLHALRR 462
           T+ ++ F E    + G  Q S+ D      A ++  L+   L+G   L + F  +  L +
Sbjct: 408 TVANIPFQETG--DQGGEQPSWYD------APIVQTLIKNGLIGLAFLALLFYVIRPLMK 459

Query: 463 LHNIDDA 469
           +  I+ A
Sbjct: 460 MLKIEKA 466


>gi|110677673|ref|YP_680680.1| flagellar MS-ring protein [Roseobacter denitrificans OCh 114]
 gi|109453789|gb|ABG29994.1| flagellar M-ring protein FliF, putative [Roseobacter denitrificans
           OCh 114]
          Length = 540

 Score =  162 bits (410), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 167/568 (29%), Positives = 267/568 (47%), Gaps = 53/568 (9%)

Query: 9   QFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALS 68
           Q   + T L   R +I+A          +A      +P+   LY  LE      +  AL 
Sbjct: 3   QIVTAWTGLPLRRQVIVALATGAMFFAILAMSRMATAPNMTLLYAGLENGAAGDVVAALE 62

Query: 69  EANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQE 128
           +    F +   G SI V SS   + R+ LA++GLP++S+  GYEL D ++ FG TS M +
Sbjct: 63  QRGAVFEV--RGGSIFVDSSQRDELRMTLASEGLPANSTQ-GYELLDTLSGFGTTSQMFD 119

Query: 129 ITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR----AINPSV 184
               RA EGE+ARTI S   I  ARVHI       F++ G  P ASV +     AI P  
Sbjct: 120 AAYWRAKEGELARTIVSSPHISMARVHIASTGSNPFQR-GVTPKASVSVTPSGAAITP-- 176

Query: 185 YKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQHEIEM 243
            +  +AIR LV++AV  L   DV V+D+ G L+  A+E+   I G+  + V      ++ 
Sbjct: 177 -QQGKAIRFLVSSAVAGLASEDVAVIDANGALIGNADEVAPTIGGEDKADV------LKA 229

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            + + L A +G  N    V  +   +++ IRE ++DP+S+V     +S D +   TS  E
Sbjct: 230 RVQRLLEARVGFGNSVVEVSVDTVTESEAIRERIFDPESRVA----ISTDTEERNTSSSE 285

Query: 304 SA---VTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           +    VTV  N+P   D       S +N + + E+ NYE++        +   ++R+++A
Sbjct: 286 AGGGDVTVASNLPD-QDGAGGENSSSQNNETR-ERVNYEVSETEREILREPGAIKRVTVA 343

Query: 361 VVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN 420
           V+VN+  +T+  G+     + +S L  +  +V++A G +  RGD ITI SM      L  
Sbjct: 344 VLVNEMTITDEAGQETVTPRDESELEALRDLVASAVGFDEARGDIITIKSMGLQSVPL-- 401

Query: 421 SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL---HNIDDAKKGEVGGK 477
            GT   +   ++S     V++A+   +  L+   LGL  +R L   ++++DA        
Sbjct: 402 QGT--AAGTSLMSNFNIDVMSAIQMAILALVTLILGLFVVRPLLARNDLNDA-------P 452

Query: 478 SILSPPPISSAVTTGLMPNDNIALDSSN-------QDIFSHSRNLQS-RINSYVSKQSDL 529
           ++ + P  +   T GL  +  I  D           D    S  L    I S +S+    
Sbjct: 453 AVAALPGATDGETDGLGLDGEIDGDDFQLPDLPVISDFGDASGELPDLNIGSGMSEDPVD 512

Query: 530 RLLHMIEINEERFAKILRKWARSEIEDR 557
           RL  MI   ++   +ILR W    +ED+
Sbjct: 513 RLRTMIGERQDETVEILRSW----LEDK 536


>gi|83747628|ref|ZP_00944664.1| FliF [Ralstonia solanacearum UW551]
 gi|207739709|ref|YP_002258102.1| flagellar m-ring protein [Ralstonia solanacearum IPO1609]
 gi|83725680|gb|EAP72822.1| FliF [Ralstonia solanacearum UW551]
 gi|206593091|emb|CAQ59997.1| flagellar m-ring protein [Ralstonia solanacearum IPO1609]
          Length = 611

 Score =  162 bits (410), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 140/465 (30%), Positives = 235/465 (50%), Gaps = 74/465 (15%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  +  SD   I  AL + N+ +R +D GS+I VP + V +AR+ LAAQ
Sbjct: 66  LWSRAPDYRVLYSNVADSDGGAIIAALQQMNVPYRFADGGSAIMVPEANVHEARLKLAAQ 125

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP     +G+EL +    FG + F +++   RALEGE+ARTIQ++  + +ARVH+ +  
Sbjct: 126 GLPKGGL-AGFELMEN-QKFGTSQFAEQVNYQRALEGELARTIQAMQEVQSARVHLALSK 183

Query: 161 MGSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +  A+P+ASV+++ + P         +AI HLV+++VPNL + +VTV+D +G+LL
Sbjct: 184 PSVFVREQAKPSASVLLK-LYPGRMLDRSQVQAIGHLVSSSVPNLPLANVTVVDQSGRLL 242

Query: 218 TANEMERNILG---KSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMD-TQQI 273
           +++  + N  G     L+ V+ I+      I   L   +G DN R+ V A++++D T+Q+
Sbjct: 243 SSS-FQDNASGLDPTQLNYVRDIEQGYIKRIEAILGPVVGEDNVRAQVTADVDLDNTEQM 301

Query: 274 REIV---YDPDSKVERSIRLSKDAQRSE----------TSQPESAVTV------------ 308
            E      DP + V RS   S+  Q             ++QP +A  +            
Sbjct: 302 AETYRPNQDPANGVVRSTHTSESTQNKAGAQGGVPGALSNQPPTAPRMLPTAPAPASQQA 361

Query: 309 -----EQNMPHVSDRKVPLPRSLEN---TDKKEEQSNYEINTKSIATTHDNYKL-ERLSI 359
                 QN P+   +     ++  N   +  ++   NYE++ K++  T     +  RLS+
Sbjct: 362 AAGQNGQNAPNGQQQAAATGQAATNNVESSARDTTVNYEVD-KTVRRTRAAVGIVRRLSV 420

Query: 360 AVVVN---KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLEN 416
           AVVVN    G+  + L         D+ + ++N +V  A G +++RGD++ + +  F   
Sbjct: 421 AVVVNYRADGKTWKPLS--------DADMVKLNALVKDAVGYDAKRGDSVNVVNSQF--- 469

Query: 417 QLFNSGTVQVSFMDI-LSR-----HFATVINALVFLVGTLLVTFL 455
               SGT+  S  D+ L +     H+A  I A  +  G L + FL
Sbjct: 470 ----SGTLPTSRDDLPLWKQPEMIHYA--IQAAKY--GALAIGFL 506


>gi|242278626|ref|YP_002990755.1| flagellar M-ring protein FliF [Desulfovibrio salexigens DSM 2638]
 gi|242121520|gb|ACS79216.1| flagellar M-ring protein FliF [Desulfovibrio salexigens DSM 2638]
          Length = 534

 Score =  162 bits (409), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 128/453 (28%), Positives = 214/453 (47%), Gaps = 31/453 (6%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           L +   F+   T   R  I  LA+ +++  +L +   F++N   Y  LY KL   D +R+
Sbjct: 9   LGKFQTFWSDRTVSQRIMIGGLAATVVIAFILMV---FWLNQTEYRVLYTKLYAEDASRV 65

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
              L      ++I DNGS+I VP+  V   R+ +A +G        GYE+FD+V   G T
Sbjct: 66  VSILQSTKEPYKIQDNGSTILVPADKVYDLRLKIAGEG-ALHGQGIGYEIFDEVQ-IGQT 123

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS 183
            F+Q I   RAL+GE+ARTI     +  ARVH+V+P    F +    P+ASV+++  +  
Sbjct: 124 DFIQRINYQRALQGELARTISEFPQVERARVHLVLPAKSLFIEEQVDPSASVVLKLKDGE 183

Query: 184 --VYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE----MERNILGKSLSIVQAI 237
               K  + + +LV  +V  L    VT+ D  G++L   E    +  NI    L     +
Sbjct: 184 KLADKQIKGVLNLVVMSVEGLKPEHVTITDMRGQVLYQPEDDGGLGLNITNSQLEYKSGL 243

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRS 297
           + +IE  I + L   +G D   + V A+L+   + I+   YDPD +V RS + S++  R 
Sbjct: 244 ESKIEQRIQRLLMPIVGPDKVIAKVNADLDFRQRTIKTEAYDPDGQVARSEQTSEETTR- 302

Query: 298 ETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEE--QSNYEINTKSIATTHDNYKLE 355
                     V+  +P  + R      +    D   E   +NYEIN +         +L+
Sbjct: 303 ------GTANVDGGVPEANFRGDGFTGTATTQDSARETRTTNYEINKEEQQIIVPVGELK 356

Query: 356 RLSIAVVVNKGRLTEVLGRSADQGKI------DSYLAEINKIVSAATGINSRRGDTITIT 409
           RLS+AV+V+ G  T    ++ D G++      +  +  I ++VS+A G +  RGD + ++
Sbjct: 357 RLSVAVIVD-GTYT----KNPDTGEMTYVPRSEEEMQRIRELVSSAVGYDEVRGDIVEVS 411

Query: 410 SMDFLENQLFNSGTVQVSFMDILSRHFATVINA 442
           +M F    +F    +  + ++   R     +N 
Sbjct: 412 NMSFGMQDMFGDEGLMRTMLEYAQRLGKPFLNG 444


>gi|83647861|ref|YP_436296.1| flagellar MS-ring protein [Hahella chejuensis KCTC 2396]
 gi|83635904|gb|ABC31871.1| flagellar M-ring protein FliF [Hahella chejuensis KCTC 2396]
          Length = 572

 Score =  162 bits (409), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 143/567 (25%), Positives = 258/567 (45%), Gaps = 47/567 (8%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           D +L F +    L   R L+L   +   I +  A   + N P Y  LY  + V D   +S
Sbjct: 26  DMMLGFNR----LSLLRQLVLMVGVAASIAMGAAIILWANEPAYQPLYPDMSVYDSTEVS 81

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             LS+ NI F++     ++ V +  V  AR+ LAA G+ +     GYEL DK    G + 
Sbjct: 82  DILSQNNIHFKVEPKSGALLVAAEDVSAARMRLAAAGV-TQDRTIGYELLDKDQGLGSSQ 140

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP-S 183
           FM+     R LEGE+ARTI S+  +  ARVH+ +P    F +   RP+ASV++      S
Sbjct: 141 FMESTRYRRGLEGELARTISSLRNVKNARVHLAIPKQSVFVRDKRRPSASVLVELTGSRS 200

Query: 184 VYK-SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL--GKSLSIVQAIQHE 240
           +++   EAI +LVA +VP +D  DVTV+D  G LL+ N +  + L   +     + ++  
Sbjct: 201 LHQDQVEAIVNLVAGSVPEMDHRDVTVVDQRGNLLSQNNLTEDDLRTSREFQYARRMEEV 260

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERS------IRLSKDA 294
           +   +N  L   LG   FR+ V A+++    +  +  ++PD +  RS       R++   
Sbjct: 261 LTGRVNSILEPILGPGRFRAEVSADVDFTAVEQAQETFNPDPQAVRSEQEIGEQRIAGSN 320

Query: 295 Q---RSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDN 351
           Q    + ++QP     V +              S     +K+   NYE++     T    
Sbjct: 321 QGVPGALSNQPPGVAAVPEQAGVAGAAANATANSQATDIRKQTVRNYEVDRTVSYTKQHQ 380

Query: 352 YKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSM 411
            K++RL++AVVV+  R     G    +   ++ L  +  +V  A G ++ RGD++ + + 
Sbjct: 381 GKVQRLTVAVVVDDLRRVGADGAVTTEAWPEAELQRLTVLVRDAVGYSAARGDSVNVINT 440

Query: 412 DFLENQL----FNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNID 467
            F+  ++    + +   +  ++  L +     +  L+ + G +  TF  L +        
Sbjct: 441 PFMAEEVEISDYEAPLWEQPWIRELIKWGVAFLIVLILVFGVIRPTFKNLSS-----GGA 495

Query: 468 DAKK----GEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIF-SHSRNLQSRINSY 522
           DAK     G+  G + L       ++ +G+   +++ L+++   +    S   + +IN+ 
Sbjct: 496 DAKNLALAGDEDGLAEL------ESLGSGVGEGESVGLNAAGDFLLPGSSEGYEKKINA- 548

Query: 523 VSKQSDLRLLHMIEINEERFAKILRKW 549
                   L  +I  +  R A+++R+W
Sbjct: 549 --------LKGLIAEDPGRVAQVVRQW 567


>gi|226941278|ref|YP_002796352.1| FliF1 [Laribacter hongkongensis HLHK9]
 gi|226716205|gb|ACO75343.1| FliF1 [Laribacter hongkongensis HLHK9]
          Length = 571

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 129/471 (27%), Positives = 230/471 (48%), Gaps = 36/471 (7%)

Query: 18  GRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRIS 77
           G  ++L+   +  V  +L +AA  +   P Y  L+  L   +  +++ AL++ N+ ++++
Sbjct: 28  GNKKLLLFGGMAAVASIL-VAAYLYTREPAYKVLFSNLPDREGGQVTEALTKLNVPYQLA 86

Query: 78  DNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEG 137
           D G  I VP+  V   R+ LA++GLP +S   G+EL D    FG++ F +++   RA+EG
Sbjct: 87  D-GGVIRVPAEQVYSTRLKLASEGLPKASG-IGFELMDN-QKFGISQFAEQVNYQRAVEG 143

Query: 138 EIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSA---EAIRHL 194
           E+ARTI+++  + +ARVH+ MP    F +    PTASV++  + P     A     IR+L
Sbjct: 144 ELARTIEALGVVESARVHLAMPKQSVFVREQQLPTASVLLN-LRPGFILDAGQIAGIRNL 202

Query: 195 VAAAVPNLDMGDVTVLDSTGKLLT-ANEMERNILG---KSLSIVQAIQHEIEMNINKALA 250
           VA+AVP L   ++T++D  G L++   +ME    G   + L  V+ I+  +   I   L 
Sbjct: 203 VASAVPGLPQKNITIVDQEGNLISRMPDMEDGSAGLSRRQLDYVRQIETSLTKRIEAILE 262

Query: 251 AFLGVDNFRSAVVAELNM-DTQQIREIV---YDPDSKVERSIRLSKDAQRSE-------- 298
             +G  N R+ V A ++  + +Q  E       P++   RS + S+   R E        
Sbjct: 263 PIVGSGNARAQVTAAVDFSEVEQTAETFNPNTPPNAGAIRSQQTSESQTREEAPQGGVPG 322

Query: 299 --TSQPESAVTVEQNMPHVSDRKV-PLPRSLENTDK-----KEEQSNYEINTKSIATTHD 350
             ++QP +A      +P  +   + P P   +N  +     KE  +NYE++         
Sbjct: 323 ALSNQPPNAAAAPVTLPPGTQAGLMPAPNGQQNQARPVKSSKEATTNYEVDRTIQHVRQQ 382

Query: 351 NYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITS 410
              L+R++ AVVVN  R T   G +      +  + +++K+V  A G    RGD++ + +
Sbjct: 383 TGALKRVTAAVVVNFKRTTTADGNAKMTPLSEQEMQQLDKLVREAMGFTQARGDSVQVVN 442

Query: 411 MDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALR 461
             F +    +   +Q    D  S +   +   L +++G L+V +L    +R
Sbjct: 443 ASFADT-AGSKAALQDRLFDYASNNPGEI---LKWVLGALVVLYLLFGVIR 489


>gi|39995518|ref|NP_951469.1| flagellar M-ring protein FliF [Geobacter sulfurreducens PCA]
 gi|39982281|gb|AAR33742.1| flagellar M-ring protein FliF [Geobacter sulfurreducens PCA]
 gi|298504518|gb|ADI83241.1| flagellar M-ring mounting plate protein FliF [Geobacter
           sulfurreducens KN400]
          Length = 527

 Score =  161 bits (407), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 125/412 (30%), Positives = 201/412 (48%), Gaps = 33/412 (8%)

Query: 27  SVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVP 86
           SVI   I++ +A     N   Y  L+  L   D   I   L E  + +RI+ +G +I VP
Sbjct: 30  SVIAFTILILVA-----NRTDYRPLFTNLTSEDAGEIVTKLKEQKVPYRIAADGKAILVP 84

Query: 87  SSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSI 146
           S  V   R+ LA+ GLP      G+E+FD+ N FG+T F+Q++   RAL+GE++RTI  I
Sbjct: 85  SDKVYDLRLSLASDGLPQGG-GVGFEIFDRKN-FGMTDFVQKLNYQRALQGELSRTISQI 142

Query: 147 SGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKS--AEAIRHLVAAAVPNLDM 204
           SG+  ARVH+V+P+   F++     TASV+++       +    + I HLVA+A+  ++ 
Sbjct: 143 SGVEQARVHLVIPEKSLFKEDEKPATASVVLKVKGQRQLRENDVQGIVHLVASAIEGMNP 202

Query: 205 GDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFL--GVDNFRSAV 262
             VTVLD  GKLL+ N    +  GK  + +Q +Q   E +  + L + L   V   +S  
Sbjct: 203 EHVTVLDQKGKLLSKN-TPGDAAGKMTASMQEVQRAYERSTEERLQSLLDKAVGAGKSVA 261

Query: 263 VAELNMDTQQIR--EIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVS---D 317
                 D +Q+   E  YDP++ V       +  QRSE  Q  S VT    +P V     
Sbjct: 262 RVSAVFDFRQVERYEEKYDPETVV-------RSEQRSEEKQDGSTVT--GGVPGVQTNLG 312

Query: 318 RKVPLPRSLENTDKKEEQS-NYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSA 376
           R    P        K +++ NYE++  +  T      L ++S+A++V+        G+  
Sbjct: 313 RTAGQPAGTSGGGSKNDETLNYEVSRATARTIEPVGTLSKVSVAILVDGKYDAAAAGKDG 372

Query: 377 DQGKID------SYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG 422
            + K          L +I+ +V ++ G N  RGD +T+ ++ F +     +G
Sbjct: 373 KEAKPKYTPRSPDELQKIDALVKSSVGFNVERGDQVTVVNIPFQDTGDVGAG 424


>gi|322616962|gb|EFY13870.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322618201|gb|EFY15093.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322625872|gb|EFY22691.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322626324|gb|EFY23134.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322632739|gb|EFY29484.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322639081|gb|EFY35774.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322640397|gb|EFY37053.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322647242|gb|EFY43741.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322649910|gb|EFY46331.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322660296|gb|EFY56534.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322662977|gb|EFY59184.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322668162|gb|EFY64321.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322674079|gb|EFY70173.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322675569|gb|EFY71643.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322686714|gb|EFY82692.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323195398|gb|EFZ80578.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323198074|gb|EFZ83191.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323207544|gb|EFZ92492.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323211017|gb|EFZ95877.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323217529|gb|EGA02248.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323219604|gb|EGA04088.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323231551|gb|EGA15664.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323235994|gb|EGA20073.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323240564|gb|EGA24607.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323245456|gb|EGA29456.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323250226|gb|EGA34118.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323253963|gb|EGA37787.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323255510|gb|EGA39271.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323262107|gb|EGA45670.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323266230|gb|EGA49720.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323270661|gb|EGA54102.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 560

 Score =  161 bits (407), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 134/448 (29%), Positives = 217/448 (48%), Gaps = 54/448 (12%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V I++ M    +  +P Y  L+  L   D   I   L++ NI +R ++   +
Sbjct: 28  LIVAGSATVAIVVAMV--LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGA 85

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE+ART
Sbjct: 86  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELART 143

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAA 197
           I+++  + +ARVH+ MP    F +    P+ASV +     RA++        A+ HLV++
Sbjct: 144 IETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALD---EGQISAVVHLVSS 200

Query: 198 AVPNLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVD 256
           AV  L  G+VT++D +G LLT +N   R++    L     ++  I+  I   L+  +G  
Sbjct: 201 AVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNG 260

Query: 257 NFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE--------------TSQP 302
           N  + V A+L+   ++  E  Y P+    ++   S+    SE              ++QP
Sbjct: 261 NVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQP 320

Query: 303 ----ESAVTVE-------QNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDN 351
               E+ +          QN P  S           NT ++ E SNYE++     T  + 
Sbjct: 321 APPNEAPIATPPTNQQNAQNTPQTSTSTNSNSAGPRNT-QRNETSNYEVDRTIRHTKMNV 379

Query: 352 YKLERLSIAVVVNKGRLTE--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITIT 409
             +ERLS+AVVVN   L +   L  +ADQ K      +I  +   A G + +RGDT+ + 
Sbjct: 380 GDIERLSVAVVVNYKTLADGKPLPLTADQMK------QIEDLTREAMGFSDKRGDTLNVV 433

Query: 410 SMDFLENQLFNSG-----TVQVSFMDIL 432
           +  F  + + N+G       Q SF+D L
Sbjct: 434 NSPF--SAVDNTGGELPFWQQQSFIDQL 459


>gi|300311375|ref|YP_003775467.1| hypothetical protein Hsero_2059 [Herbaspirillum seropedicae SmR1]
 gi|300074160|gb|ADJ63559.1| hypothetical protein Hsero_2059 [Herbaspirillum seropedicae SmR1]
          Length = 569

 Score =  161 bits (407), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 119/398 (29%), Positives = 197/398 (49%), Gaps = 35/398 (8%)

Query: 47  HYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSS 106
            Y  L+      D   I  +L + N+ ++ SD G++I VP +MV  AR+ LAAQGLP   
Sbjct: 47  EYRVLFSNFNDRDGGAIVASLQQMNVPYKYSDGGTAILVPENMVHDARLKLAAQGLPKGG 106

Query: 107 SNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRK 166
            N G+EL +     G++ F++++   RALEGE+AR++ S++ +  ARVH+ +P    F +
Sbjct: 107 -NVGFELMEN-QKLGISQFLEQVNFQRALEGELARSVGSLASVQTARVHLALPKASVFVR 164

Query: 167 IGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL--TANE 221
              +PTASV++ ++ P  Y   +   AI HLVA++VP L    VT++D  G LL  T  +
Sbjct: 165 DQQKPTASVVL-SLYPGRYLDPQQVSAIVHLVASSVPELSPKAVTIVDQNGNLLSDTTKQ 223

Query: 222 MERNILGKS-LSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDP 280
            + N L  + L  VQ +Q +I   +   +A  +G  N R+   A+++    +     Y P
Sbjct: 224 AQPNTLDPTQLKYVQDMQQDIVKRVESIIAPIVGNGNVRAEATADVDFSRSEQASEAYKP 283

Query: 281 ----DSKVERSIRLSKDAQRSE---------TSQPESAVTVEQNMPHVS----------- 316
               DS   RS + S+    S          ++QP +  T     P V+           
Sbjct: 284 NQTKDSAAVRSKQSSEANSASNGTSGVPGALSNQPPAPATAPIVNPAVANGAANQTGAAT 343

Query: 317 -DRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRS 375
            +  +P P +  N+ +K+E  NYE++     T      + RL++AVVVN  R  +  G+ 
Sbjct: 344 PNGALPTPTATGNS-RKDETINYEVDKTVRYTQQPMGGVRRLTVAVVVNYKRTMDNTGKI 402

Query: 376 ADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
             +   ++   +I  +V  A G N  RGD++ + +  F
Sbjct: 403 VMRPLTEAERNQITDLVKEAMGYNKDRGDSLNVVNTQF 440


>gi|16760913|ref|NP_456530.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|25304719|pir||AB0752 flagellar basal-body M-ring protein [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16503210|emb|CAD05717.1| flagellar basal-body M-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi]
          Length = 560

 Score =  161 bits (407), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 134/448 (29%), Positives = 217/448 (48%), Gaps = 54/448 (12%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V I++ M    +  +P Y  L+  L   D   I   L++ NI +R ++   +
Sbjct: 28  LIVAGSTAVAIVVAMV--LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGA 85

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE+ART
Sbjct: 86  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELART 143

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAA 197
           I+++  + +ARVH+ MP    F +    P+ASV +     RA++        A+ HLV++
Sbjct: 144 IETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEG---QISAVVHLVSS 200

Query: 198 AVPNLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVD 256
           AV  L  G+VT++D +G LLT +N   R++    L     ++  I+  I   L+  +G  
Sbjct: 201 AVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNG 260

Query: 257 NFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE--------------TSQP 302
           N  + V A+L+   ++  E  Y P+    ++   S+    SE              ++QP
Sbjct: 261 NVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQP 320

Query: 303 ----ESAVTVE-------QNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDN 351
               E+ +          QN P  S           NT ++ E SNYE++     T  + 
Sbjct: 321 APPNEAPIATPPTNQQNAQNTPQTSTSTNSNNAGPRNT-QRNETSNYEVDRTIRHTKMNV 379

Query: 352 YKLERLSIAVVVNKGRLTE--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITIT 409
             +ERLS+AVVVN   L +   L  +ADQ K      +I  +   A G + +RGDT+ + 
Sbjct: 380 GDIERLSVAVVVNYKTLADGKPLPLTADQMK------QIEDLTREAMGFSDKRGDTLNVV 433

Query: 410 SMDFLENQLFNSG-----TVQVSFMDIL 432
           +  F  + + N+G       Q SF+D L
Sbjct: 434 NSPF--SAVDNTGGELPFWQQQSFIDQL 459


>gi|302392396|ref|YP_003828216.1| flagellar M-ring protein FliF [Acetohalobium arabaticum DSM 5501]
 gi|302204473|gb|ADL13151.1| flagellar M-ring protein FliF [Acetohalobium arabaticum DSM 5501]
          Length = 524

 Score =  161 bits (407), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 122/383 (31%), Positives = 193/383 (50%), Gaps = 30/383 (7%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           + + P+Y  L+  L + D   I+  L E  ID+++  +G+ ISVP+  V + R+ LA++G
Sbjct: 44  WASQPNYVTLFNDLTMKDAGAITKQLDEKQIDYKLGADGTKISVPAQKVHQVRLDLASKG 103

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   +  G+E+FDK N  G T F Q++   RAL GE+AR+I  +  +  A+V I  P  
Sbjct: 104 LPQKGA-VGFEIFDK-NQLGSTDFEQQVNFYRALSGELARSIMHLQNVKFAKVQISAPRE 161

Query: 162 GSFRKIGARPTASVMIRAINPSV--YKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             +        ASVM++    +    K  E I +LVA++V +L   +VTV+D  G LLTA
Sbjct: 162 SLYLDKKKVVKASVMLKMKEYAELDLKQVEGITNLVASSVEDLKPENVTVVDDRGNLLTA 221

Query: 220 --NEMER----NILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQI 273
             N+ ++    +   K L +    +  +E  +N  L+  LG DN    V A+LN D +Q+
Sbjct: 222 ELNKEDKFNNTDFSPKLLELENDFESNMESELNTMLSKVLGPDNVVVRVNAKLNFDRRQM 281

Query: 274 REIVYDP---DSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTD 330
               Y+P   D  V RS + ++ +   +   P      E N+P     +        N D
Sbjct: 282 ESRTYEPVNDDQGVVRSEQSTEVSYSGQGDTPSGVPGTESNIPGYEGGE----EQSSNYD 337

Query: 331 KKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINK 390
           K+E  +NYEIN K    T     +E++S+AV+V+K  L+     S            I +
Sbjct: 338 KEETTTNYEINEKIETYTQVPGDVEKMSVAVMVDK-ELSPAQTES------------IRQ 384

Query: 391 IVSAATGINSRRGDTITITSMDF 413
            V +A G ++ RGD ITIT+ +F
Sbjct: 385 SVESAVGYSAERGDQITITNFEF 407


>gi|299068777|emb|CBJ40017.1| FliF: Flagellar biosynthesis protein, M-ring protein, Belongs to
           the fliF family [Ralstonia solanacearum CMR15]
          Length = 611

 Score =  161 bits (407), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 141/483 (29%), Positives = 234/483 (48%), Gaps = 78/483 (16%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  +  SD   I  AL + N+ +R +D GS+I VP + V +AR+ LAAQ
Sbjct: 66  LWSRAPDYRVLYSNVADSDGGAIIAALQQMNVPYRFADGGSAIMVPEANVHEARLKLAAQ 125

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP     +G+EL +    FG + F++++   RALEGE+ARTIQ++  + +ARVH+ +  
Sbjct: 126 GLPKGGL-AGFELMEN-QKFGTSQFVEQVNYQRALEGELARTIQAMQEVQSARVHLALSK 183

Query: 161 MGSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +   +P+ASV+++ + P         +AI HL+A++VP+L + +VTV+D +G+LL
Sbjct: 184 PSVFVREQVKPSASVLLK-LYPGRMLDRSQVQAIGHLLASSVPDLPLANVTVVDQSGRLL 242

Query: 218 TANEMERNILG---KSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMD-TQQI 273
           +A   + N  G     L+ V+ I+      I   L   LG DN R+ V A++++D T+Q+
Sbjct: 243 SA-AFQDNASGLDPTQLNYVRDIEQGYIKRIEAILGPVLGDDNVRAQVTADVDLDNTEQM 301

Query: 274 REIV---YDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVP--------- 321
            E      DP +   RS   S+  Q    +Q         N P  + R +P         
Sbjct: 302 AETYRPNQDPANGAVRSTHTSESTQNKAGAQ-GGVPGALSNQPPTAPRMLPTAPAPAAQQ 360

Query: 322 ------------------------LPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
                                      S+E++  ++  +NYE++     T      + RL
Sbjct: 361 AAAGQNGQNGQNGQQQGAAGTGQAAANSVESS-ARDITTNYEVDKTVRRTRAAVGTVRRL 419

Query: 358 SIAVVVN---KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFL 414
           S+AVVVN    G+  + L         D+ + ++N +V  A G +++RGD++ + +  F 
Sbjct: 420 SVAVVVNYRADGKTWKPLS--------DAEMTKLNALVKDAVGYDAKRGDSVNVVNSQF- 470

Query: 415 ENQLFNSGTVQVSFMDI-LSR-----HFATVINALVF---LVGTLLVTFLGLHALRRLHN 465
                 SGT+  S  D+ L +     H+A  I A  +    +G L++ F  +  L R  N
Sbjct: 471 ------SGTLPTSKDDLPLWKQPEMIHYA--IQAAKYGALAIGFLILVFAVIRPLIRSMN 522

Query: 466 IDD 468
             D
Sbjct: 523 KKD 525


>gi|224826633|ref|ZP_03699734.1| flagellar M-ring protein FliF [Lutiella nitroferrum 2002]
 gi|224601234|gb|EEG07416.1| flagellar M-ring protein FliF [Lutiella nitroferrum 2002]
          Length = 576

 Score =  161 bits (407), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 129/453 (28%), Positives = 209/453 (46%), Gaps = 32/453 (7%)

Query: 25  LASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSIS 84
           LA+V  V + L +  R    +P Y  L+  L   D  +I+ AL + N+ ++I   G  IS
Sbjct: 38  LAAVFSVIVGLLILNR----TPDYKVLFANLADRDGGQITAALQQMNVPYQIG-GGGVIS 92

Query: 85  VPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQ 144
           VPS  V   R+ LAAQGLP +    G+EL D    FG++ F +++   RA+EGE+ARTI+
Sbjct: 93  VPSDKVYDVRLKLAAQGLPKAGG-VGFELMDN-QKFGISQFAEQVNYQRAIEGELARTIE 150

Query: 145 SISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNL 202
           +I  + +ARVHI +P    F +   +PTASVM+      V    +   I HLV+++VPNL
Sbjct: 151 AIGAVESARVHIAIPKQSVFVRDQQQPTASVMLNLYPGRVLDGGQISGILHLVSSSVPNL 210

Query: 203 DMGDVTVLDSTGKLLTANEMERNILG---KSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
              +VTV+D  G LL++     N  G   + L  V  I+ +    I   L    G  N R
Sbjct: 211 SARNVTVVDQDGNLLSSQSDVNNAAGLDQRQLGYVHQIESDFVKRIEGILEPIFGKGNVR 270

Query: 260 SAVVAELNMDTQQIREIVYDPDS--------------KVERSIRLSKDAQRSETSQPESA 305
           + V A ++    +     + P+S              K+     L      + ++QP SA
Sbjct: 271 AQVTANVDFSEVEQTSETFRPNSTPNPSATRSQQIVEKLGSGSNLPGGVPGALSNQPPSA 330

Query: 306 VTVEQNMPHVSDRKVPL----PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAV 361
            +    +P  +          P       +++  +NYE++     T      L+RLS AV
Sbjct: 331 ASAPLTLPPGAAPGTATLSGQPLGQNGALERQLITNYEVDKTIQHTKLPKGVLKRLSAAV 390

Query: 362 VVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNS 421
           VVN   + +  G           + +IN +V    G N+ RGDT+ + +  F  N     
Sbjct: 391 VVNYRLMPDRNGEVKPTPLTAQEIQQINNLVRETMGYNTERGDTLNVVNAAFAGNA--PP 448

Query: 422 GTVQVSFMDILSRHFATVINALVFLVGTLLVTF 454
            ++Q   +D +S +   ++  ++  +  L + F
Sbjct: 449 ASLQEKVVDYVSSNATDLVKYVLLAIAVLYLLF 481


>gi|260886631|ref|ZP_05897894.1| flagellar M-ring protein FliF [Selenomonas sputigena ATCC 35185]
 gi|330839537|ref|YP_004414117.1| flagellar M-ring protein FliF [Selenomonas sputigena ATCC 35185]
 gi|260863774|gb|EEX78274.1| flagellar M-ring protein FliF [Selenomonas sputigena ATCC 35185]
 gi|329747301|gb|AEC00658.1| flagellar M-ring protein FliF [Selenomonas sputigena ATCC 35185]
          Length = 529

 Score =  160 bits (406), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 120/458 (26%), Positives = 220/458 (48%), Gaps = 31/458 (6%)

Query: 19  RTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISD 78
           R R +I+ +  LV I +   +  +   P    L+  +E  D   ++  L E  +++ I +
Sbjct: 18  RQRYMIIGAAALVFIAIVAGSIIYGGKPDMVPLFTNMEAKDAGEVAAKLKENKVNYEIQE 77

Query: 79  --NGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALE 136
              G++I VP+  V   R+ LAA+GLP    N G+ELFD  +  G+T F  ++  ++AL+
Sbjct: 78  GGQGTTILVPAKSVDSTRLDLAAEGLPRG--NKGFELFDD-SKLGVTEFQNKVNYLQALQ 134

Query: 137 GEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVM--IRAINPSVYKSAEAIRHL 194
           GE+ RTI+ I  +  ARVHIV+P+   ++K     TAS+M  ++A      K  + I +L
Sbjct: 135 GELTRTIEQIDAVEKARVHIVLPEDSLYKKNEKPATASIMLKLKANMQLSKKEVKGIVNL 194

Query: 195 VAAAVPNLDMGDVTVLDSTGKLLT-ANEMERNILGK----SLSIVQAIQHEIEMNINKAL 249
            A +V  L   ++T++D +GK+L   +E   + +G+     + + + +Q  ++ N+   L
Sbjct: 195 AAHSVQGLTPENITIVDESGKILNDPDENGDDGVGQKTLTQMEMTKKVQDNLQKNVQSLL 254

Query: 250 AAFLGVDNFRSAVVAELNMDTQQIREIVYDP---DSKVERSIRLSKDAQRSETSQPESAV 306
            A LG       +  EL+ D +     +Y P   +S + RS + + ++    ++QP    
Sbjct: 255 DASLGEGKSFVRISVELDFDQKMTDSQIYTPVVDESGIVRSQQTTSESYAGTSTQPGGPA 314

Query: 307 TVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG 366
             + N+P   ++      S    ++KE  +NYE+N +          + RL++AV+VN  
Sbjct: 315 GTQSNVPGYVEQN---NNSQAQYERKENTTNYEVNEEKRKVVASPGSIRRLTVAVLVND- 370

Query: 367 RLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQV 426
                      Q + +S L    + V +A GIN  RGDT+++  + F           + 
Sbjct: 371 --------DVTQAQQESIL----RSVRSAAGINPDRGDTVSVEPLPFSTEARDKKLADEQ 418

Query: 427 SFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLH 464
           +  D L R F   + A + ++  ++ + L     +RL 
Sbjct: 419 AERDRLDREFYLQLAAFLLVIALIVGSILMYRRKKRLE 456


>gi|148266223|ref|YP_001232929.1| flagellar M-ring protein FliF [Geobacter uraniireducens Rf4]
 gi|146399723|gb|ABQ28356.1| flagellar M-ring protein FliF [Geobacter uraniireducens Rf4]
          Length = 525

 Score =  160 bits (406), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 132/467 (28%), Positives = 223/467 (47%), Gaps = 38/467 (8%)

Query: 16  SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFR 75
           +L   + LI+A V +  ++ F A     N   Y  L+  L   D   I   L +  + ++
Sbjct: 14  TLPPAKRLIVAGVAVASLVAFAALIVVANKTDYRPLFANLTTEDAGEIVKKLKDQKVPYQ 73

Query: 76  ISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRAL 135
           I+ +G +I VPS  V   R+ LA++GLP      G+E+FD+ N FG+T F+Q++   RAL
Sbjct: 74  IAADGKAILVPSDKVYDLRLSLASEGLPQGG-GVGFEIFDRKN-FGMTEFVQKLNYQRAL 131

Query: 136 EGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRH 193
           +GE++RTI  ++G+  ARVH+ + +   F+      TASV+++  +    +  E   + H
Sbjct: 132 QGELSRTIAQLAGVEQARVHLAIAEKSLFKDNEKPTTASVVLKMKSNHTLRENEVQGVVH 191

Query: 194 LVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFL 253
           LVA+++  +D  +VTVLDS GK+L+      ++  K  S +Q  Q   E N+   L   L
Sbjct: 192 LVASSIEGMDPENVTVLDSRGKMLS-KVGASDLTSKMTSTMQETQRTYEKNLEDRLQTLL 250

Query: 254 G--VDNFRSAVVAELNMDTQQIR--EIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVE 309
              V   +S        D +Q+   E  YDP+S   RS       QRSE  +   A TV 
Sbjct: 251 DKVVGTGKSVARVSATFDFKQVEKYEERYDPESAAVRS------EQRSE--EKGGASTVA 302

Query: 310 QNMPHVSD---RKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG 366
             +P V     +  P   +     K +E  NYE++  +         + ++S+A++V+  
Sbjct: 303 AGVPGVQSNMAKAAPAGVTSGGGSKSDETLNYEVSRSTARIIEPVGSMNKVSVAILVDGK 362

Query: 367 RLTE------VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLE----- 415
            +           ++  Q +    L +I  +V +A G N+ RGD +T+ ++ F E     
Sbjct: 363 YVAPASAKEGATAKAKYQPRTPDELQKIEALVKSAVGFNAERGDQVTVANIPFQETDDGG 422

Query: 416 ----NQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
               ++ +N+  +Q    ++L    A    AL+FLV   L+  L  H
Sbjct: 423 ASDQDKWWNAPIMQALLKNLL---IALGFFALLFLVIRPLLKTLKPH 466


>gi|295098292|emb|CBK87382.1| flagellar basal-body M-ring protein/flagellar hook-basal body
           protein (fliF) [Enterobacter cloacae subsp. cloacae NCTC
           9394]
          Length = 543

 Score =  160 bits (406), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 117/408 (28%), Positives = 196/408 (48%), Gaps = 50/408 (12%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  SP Y  LY  L   D   I   L++ NI +R +DNG ++ VP+  V + R+ LA Q
Sbjct: 28  LWAKSPDYRTLYSNLSDQDGGAIVTQLTQMNIPYRFADNGGALEVPADKVHELRLRLAQQ 87

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 88  GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 145

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D +G 
Sbjct: 146 PSLFVREQKSPSASVTVNLEPGRALDEG---QISAVTHLVSSAVAGLPPGNVTLVDQSGH 202

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  ++  I   L   +G  N  + V A+++   ++  
Sbjct: 203 LLTQSNTAGRDLNDAQLKYAADVEGRLQRRIEAILGPVVGSSNVHAQVTAQIDFSNKEQT 262

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQPESAVTVEQNMPHV----- 315
           E  Y P+    R++  S+    +E              ++QP  A     + P       
Sbjct: 263 EEQYAPNGDASRAVLRSRQINETEQVGGQYPGGVPGALSNQPAPANAAPISTPPANPQNG 322

Query: 316 --------SDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGR 367
                   S      PR+      + E +NYE++     T  +   ++RLS+AVVVN   
Sbjct: 323 QQTNQQTTSTANSTGPRN----SSRNETTNYEVDRTIRHTKLNTGDIQRLSVAVVVNYKT 378

Query: 368 LTE--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           L +   L  +A+Q      + +I  +   A G + +RGDT+ + +  F
Sbjct: 379 LPDGKPLPLTAEQ------MKQIEDLTREAMGFSEKRGDTLNVVNSPF 420


>gi|220904839|ref|YP_002480151.1| flagellar M-ring protein FliF [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219869138|gb|ACL49473.1| flagellar M-ring protein FliF [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 547

 Score =  160 bits (405), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 114/383 (29%), Positives = 195/383 (50%), Gaps = 17/383 (4%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           ++  P Y  LY  L   D + +  AL    + +RI+DNG++I VP  +V   RI +A +G
Sbjct: 44  WMGRPEYRVLYSNLGPEDASVVVKALQSDKVAYRITDNGATIMVPQEVVYDQRIKIAGEG 103

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
                   G+E+FDKV   G T F+Q+I   RAL+GE+ARTI     + +ARVH+V+P  
Sbjct: 104 -GLVGQGIGFEIFDKVK-VGQTDFVQKINYTRALQGELARTISEFPSVESARVHLVIPRR 161

Query: 162 GSFRKIGARPTASVMIRAINPSV---YKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
             F +    P+ASV+++ I P++    K   AI +++  +V  LD G V++ D++GK+L 
Sbjct: 162 SLFVEERQSPSASVVLKLIRPNIKVDQKEINAILNMMLMSVEGLDRGHVSITDTSGKVLY 221

Query: 219 ANEMER--NILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI 276
             E +    I    +   Q +Q  +E  I + L    G     + V A+++   + IR  
Sbjct: 222 QPEEDSLAGITTTQMEYRQTVQRNLERRIEEMLQPLFGPGRVIAKVNADMDFSQKTIRRE 281

Query: 277 VYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEE-- 334
           ++DP+    RS        RSE SQ +    +E   P V+ R   +  S+ +     E  
Sbjct: 282 LFDPERTAVRS------EYRSEESQ-QGRANLEAGSPDVNFRGDGITGSVSDQSGTREAR 334

Query: 335 QSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSA 394
            +NYEIN +      +  +L RL++AV+++ G   +  G      +    L ++ ++V  
Sbjct: 335 TTNYEINKEEQQIVSNVGELRRLTVAVLID-GTYVKADGAWTFMPRKSEELEQVRQLVHN 393

Query: 395 ATGINSRRGDTITITSMDFLENQ 417
           A G+++ RGD + ++S  F +++
Sbjct: 394 AVGLDTGRGDALEVSSAPFTDSE 416


>gi|293395603|ref|ZP_06639886.1| flagellar M-ring protein [Serratia odorifera DSM 4582]
 gi|291421922|gb|EFE95168.1| flagellar M-ring protein [Serratia odorifera DSM 4582]
          Length = 573

 Score =  160 bits (405), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 122/423 (28%), Positives = 206/423 (48%), Gaps = 56/423 (13%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  SP Y  LY  L   D   I   L++ NI +R ++NG+++ +P+  V + R+ LA Q
Sbjct: 46  LWAKSPDYRVLYSNLNDRDGGAIVTQLTQMNIPYRFAENGAALMIPAEKVHETRLRLAQQ 105

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F ++I   RALEGE++RTI+S+  +  ARVH+ +P 
Sbjct: 106 GLPKGGA-VGFELLDQ-EKFGISQFSEQINYQRALEGELSRTIESLGPVQNARVHLALPK 163

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        AI ++VA++V  L  G+VTV+D  G+
Sbjct: 164 PSLFVREQKSPSASVTLNLQPGRALDDG---QINAIVYMVASSVAGLPPGNVTVVDQAGR 220

Query: 216 LLTANEME-RNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT ++   R++    L     +++  +  I   LA  +G  N R+ V A+++   ++  
Sbjct: 221 LLTQSDGSGRDLNASQLKYTSEVENRYQRRIEAILAPIVGSANVRAQVTAQIDFSIREQT 280

Query: 275 EIVYDPDSKVE----RSIRLSKDAQ----------RSETSQPESAVTVEQNMP------- 313
           +  Y P+   E    RS +LS+  Q           + ++QP +A T     P       
Sbjct: 281 DEQYQPNPTPEKAAIRSRQLSQSDQLGGQPVGGVPGALSNQPSAAPTAPIETPAADATAN 340

Query: 314 --HVSDRKVPLPRSLENT-------------DKKEEQSNYEINTKSIATTHDNYKLERLS 358
               ++   P  R   NT              +++E +NYE++     T H +  ++RLS
Sbjct: 341 TNTTANNAPPAARQTSNTATGNGNGNGQPQNSRRDETTNYEVDRTIRHTQHKSGAVQRLS 400

Query: 359 IAVVVNKGRLTEVLGRSADQGKI---DSYLAEINKIVSAATGINSRRGDTITITSMDFLE 415
           +AVV+N       LG   D   +      L +I  +V  A G +  RGDT+ + +  F E
Sbjct: 401 VAVVLN------TLGSDKDGKPLPMSKQQLTQIESLVREAMGYSGTRGDTLNVVNSPFTE 454

Query: 416 NQL 418
            ++
Sbjct: 455 TEM 457


>gi|313200543|ref|YP_004039201.1| flagellar m-ring protein flif [Methylovorus sp. MP688]
 gi|312439859|gb|ADQ83965.1| flagellar M-ring protein FliF [Methylovorus sp. MP688]
          Length = 580

 Score =  160 bits (405), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 118/414 (28%), Positives = 200/414 (48%), Gaps = 40/414 (9%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +   P Y  L+      D   I  +L + NI ++ S++G++I VP+S V + R+ LAAQ
Sbjct: 50  LWSQQPEYRVLFSNYADKDGGAIVASLEQMNIPYKFSESGTAILVPASQVHQVRLKLAAQ 109

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP    N G+EL +    FG++ F++++   R LEGE+ R+IQ+IS +  AR+H+ +P 
Sbjct: 110 GLPKGG-NIGFELLEN-QKFGVSQFVEQVNFQRGLEGELERSIQTISAVEVARIHLAIPK 167

Query: 161 MGSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +   +PTASV++  + P      +   AI HLVA++VP L + +VTV+D  G LL
Sbjct: 168 PSVFVRDQQKPTASVLLN-LRPGRMLDQQQVSAIVHLVASSVPELPIANVTVVDQNGNLL 226

Query: 218 --TANEMERNILGKS-LSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
             T  +  RN L  + L  +  +Q  I   +   +A  +G  N  +   AE++  TQ+  
Sbjct: 227 SDTDKKAGRNNLDPTQLKYIDELQQNIVRRVESIIAPMVGAKNVHAEASAEVDFSTQEQA 286

Query: 275 EIVYDPDSKVER-SIRLSKDAQRSETS-------------QPESAVTVEQNMPHVSDRKV 320
              Y P+   +  S+R  +  +   TS             QP +  T   N    ++   
Sbjct: 287 AETYRPNQAPDAMSVRSQQSNESQSTSPAGVGGVPGALSNQPPAPATAPLNTAVPANAGA 346

Query: 321 PLPRSLE----------------NTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVN 364
           P   +                  NT +K   +NYE++            ++RL++AVVVN
Sbjct: 347 PGAGTPANAAAANAANATPAVPVNT-QKNVTTNYELDKTIRYVQQPMGGVKRLTVAVVVN 405

Query: 365 KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQL 418
             ++ +  G+  ++   D+   EI+ +   A G N  RGD++T+ +  F  +Q+
Sbjct: 406 HKQVVDKNGKVTNRPLTDAEKTEISDLAKQAMGFNQERGDSLTVVNSSFAGDQI 459


>gi|303326607|ref|ZP_07357049.1| flagellar M-ring protein FliF [Desulfovibrio sp. 3_1_syn3]
 gi|302862595|gb|EFL85527.1| flagellar M-ring protein FliF [Desulfovibrio sp. 3_1_syn3]
          Length = 548

 Score =  160 bits (405), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 116/384 (30%), Positives = 198/384 (51%), Gaps = 19/384 (4%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +V  P Y  LY  L   D + +  AL    I ++++DNG++I VP  +V   RI +A +G
Sbjct: 44  WVGRPEYRVLYSNLGAEDASHVVKALQTDKIPYQLADNGATIMVPKEVVYDQRIKIAGEG 103

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
                   G+E+FDKV   G T F+Q+I   RAL+GE++RTI     + +ARVH+V+P  
Sbjct: 104 -GLVGQGIGFEIFDKVK-VGQTDFVQKINYTRALQGELSRTISEFPSVESARVHLVIPQR 161

Query: 162 GSFRKIGARPTASVMIRAINPSV---YKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
             F +    P+ASV+++  NP+     K   AI +++  AV  LD G V++ D+ GK+L 
Sbjct: 162 SLFVEERQSPSASVVLKLTNPNSKPDQKEISAILNMMLMAVEGLDKGHVSITDNGGKVLY 221

Query: 219 ANEMERNILGKSLSIVQ---AIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
             E E ++ G S + ++    +Q  +E  I + L    G     + V A+++   + IR 
Sbjct: 222 QPE-EDSLAGASSTQMEHRLQVQRNLERRIEEMLQPLFGPGRVIAKVNADMDFSQKTIRR 280

Query: 276 IVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSL--ENTDKKE 333
             +DP+    RS       QRSE SQ +    +E   P  + R   +  S+  +N  ++ 
Sbjct: 281 EFFDPEKTAVRS------EQRSEESQ-QGRANLEAGAPDTNFRGDGITGSVSDQNGTRET 333

Query: 334 EQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVS 393
             +NYEIN +      +   L RL++AV+++ G   +  G+ +   +    L  + ++VS
Sbjct: 334 RTTNYEINKEEQQIVANVGDLRRLTVAVIID-GTYEKADGKWSFVPRKAEELDRVRQLVS 392

Query: 394 AATGINSRRGDTITITSMDFLENQ 417
            A G++  RGD + ++S  F +++
Sbjct: 393 NAVGLDKGRGDLLEVSSAPFTDSE 416


>gi|152980320|ref|YP_001353131.1| flagellar MS-ring protein [Janthinobacterium sp. Marseille]
 gi|151280397|gb|ABR88807.1| flagellar basal-body M-ring protein [Janthinobacterium sp.
           Marseille]
          Length = 585

 Score =  160 bits (405), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 123/439 (28%), Positives = 203/439 (46%), Gaps = 50/439 (11%)

Query: 18  GRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRIS 77
           GR  +L+L S  ++ IM+ +    +   P Y  L+      D   I  +L  +N+ ++ +
Sbjct: 38  GRKVMLMLGSAAVIAIMIALV--LWSQKPEYKVLFSNFSDRDGGAIMSSLQASNVPYKFA 95

Query: 78  DNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEG 137
           + G +I VP+  V + R+ LAA+GLP      G+EL +     G++ F++++   RALEG
Sbjct: 96  EGGGAILVPADKVHEIRLKLAAEGLPKGGG-VGFELMEN-QKLGVSQFLEQVNFQRALEG 153

Query: 138 EIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI-----RAINPSVYKSAEAIR 192
           E+AR+IQS+  + AARVH+ MP    F +   +PTASV++     RA++    +   AI 
Sbjct: 154 ELARSIQSVGAVQAARVHLAMPKASVFVRDQQKPTASVLLNLRQGRALD---QQQVSAIV 210

Query: 193 HLVAAAVPNLDMGDVTVLDSTGKLL--TANEMERNILGKS-LSIVQAIQHEIEMNINKAL 249
           HLVA++VP L   +VT++D +G LL  T      N L  S L  VQ +Q  I   I   +
Sbjct: 211 HLVASSVPELSPKNVTIVDQSGNLLSETNKPAGSNTLDPSQLKYVQELQQSITKRIESII 270

Query: 250 AAFLGVDNFRSAVVAELNMDTQQIREIVYD----PDSKVERSIRLSKDAQRSE------- 298
              +G  N R+   A+++  T +    +Y     P+S   RS++ S+             
Sbjct: 271 TPIVGASNIRAEATADVDFSTSEQAAEIYKPNQVPNSATVRSLQTSESRGNGTGASGVPG 330

Query: 299 --TSQPESAVTVEQNMPHVSDRKVP----------------------LPRSLENTDKKEE 334
             T+QP    T     P ++    P                         +     +K+ 
Sbjct: 331 ALTNQPAPNATAPLTAPPLAADGTPSTATNPPAPGTPAAAAAAAAAATAAANATPTQKDT 390

Query: 335 QSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSA 394
            +N+E++            L+RLS+AVVVN  R+    G+       ++   +I  +V  
Sbjct: 391 TTNFEVDKTVRYVQQPMGGLKRLSVAVVVNYKRVVAKDGKVTIAPLSETEKNQITDLVKE 450

Query: 395 ATGINSRRGDTITITSMDF 413
           A G N  RGDT+ + +  F
Sbjct: 451 AMGYNKDRGDTLNVVNSPF 469


>gi|307822872|ref|ZP_07653103.1| flagellar M-ring protein FliF [Methylobacter tundripaludum SV96]
 gi|307736476|gb|EFO07322.1| flagellar M-ring protein FliF [Methylobacter tundripaludum SV96]
          Length = 611

 Score =  160 bits (404), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 136/487 (27%), Positives = 228/487 (46%), Gaps = 62/487 (12%)

Query: 13  SGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANI 72
           +G ++ R   L+L   + + + + +A   +   P Y  LY ++  SDV+ I   L++ NI
Sbjct: 48  AGLTIARQIGLMLG--LALSVAIGVAIVLWSQEPSYGRLYSEIGESDVSEILEILNKENI 105

Query: 73  DFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRV 132
            +++     +I VP   V   ++ LAAQGLP S+S  GYEL DK   FG +  ++ +   
Sbjct: 106 KYKVETGSGAIMVPMDQVSAVKLKLAAQGLPKSNS-LGYELLDKEQGFGASKGVETVRFQ 164

Query: 133 RALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI-----RAINPSVYKS 187
           RALEGEIARTI SI  +  ARV + +P    F +   +P+ASV++     R+++      
Sbjct: 165 RALEGEIARTIMSIQNVKTARVLLAIPAQSVFVRERKKPSASVIVNLYQGRSLDKG---Q 221

Query: 188 AEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE--MERNILGKSLSIVQAIQHEIEMNI 245
            E+I HLVA++VP L+   VTV+D  G+LL +N+  +  N+  K     + I+  +   I
Sbjct: 222 VESIIHLVASSVPQLEAEQVTVVDQKGQLLNSNDSSVAGNLTSKQFEYKKNIEEHLMGRI 281

Query: 246 NKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESA 305
              L+  +G D  R  + A+++       + +++PD    RS          +TS+ +S 
Sbjct: 282 ENILSPLVGSDGMRVQISADVDFTETDRTQEMFNPDLPALRS---------EQTSEEQST 332

Query: 306 VTVEQNMPHVSDRK--------------------------VPLPRSLENTDKKEEQSNYE 339
            +  Q +P     +                           P   +   +  K    NYE
Sbjct: 333 QSAIQGVPGALSNQPTPAGAAPDPAAAPAAPGSSATTAAAAPTSTATPGSAAKNATRNYE 392

Query: 340 INTKSIATTHDNYKLERLSIAVVVNKGRLTE----VLGRSADQGKIDSYLAEINKIVSAA 395
           ++     T      L RLS+AVVV+   + +    V G+S  Q  I+ +    + +V  A
Sbjct: 393 LDKTITHTRLATGALRRLSVAVVVDDRHVPQSDGTVKGQSYSQEDINRF----SDLVKQA 448

Query: 396 TGINSRRGDTITITSMDFLENQLFNSGTV-----QVSFMDILSRHFATVINALVFLVGTL 450
            G +S RGD +T+T++ F  ++L  +        Q  F+D++ +  A V+  L  L G L
Sbjct: 449 VGFDSSRGDQVTVTNVTFKIDELIEALPAIPVWEQGWFLDLM-KQVAAVLAVLFLLFGVL 507

Query: 451 LVTFLGL 457
             T   L
Sbjct: 508 RPTMRSL 514


>gi|62180544|ref|YP_216961.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|62128177|gb|AAX65880.1| flagellar biosynthesis; basal-body MS(membrane and
           supramembrane)-ring and collar protein [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|322715020|gb|EFZ06591.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 560

 Score =  160 bits (404), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 128/430 (29%), Positives = 209/430 (48%), Gaps = 52/430 (12%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R+ LA Q
Sbjct: 44  LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQ 103

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 104 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 161

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L +G+VT++D +G 
Sbjct: 162 PSLFVREQKSPSASVTVTLEPGRALDEG---QISAVVHLVSSAVAGLPLGNVTLVDQSGH 218

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  
Sbjct: 219 LLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT 278

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQP----ESAVTVE------- 309
           E  Y P+    ++   S+    SE              ++QP    E+ +          
Sbjct: 279 EEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNA 338

Query: 310 QNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLT 369
           QN P  S           NT ++ E SNYE++     T  +   +ERLS+AVVVN   L 
Sbjct: 339 QNTPQTSTSTNSNSAGPRNT-QRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLA 397

Query: 370 E--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG----- 422
           +   L  +ADQ K      +I  +   A G + +RGDT+ + +  F  + + N+G     
Sbjct: 398 DGKPLPLTADQMK------QIEDLTREAMGFSDKRGDTLNVVNSPF--SAVDNTGGELPF 449

Query: 423 TVQVSFMDIL 432
             Q SF+D L
Sbjct: 450 WQQQSFIDQL 459


>gi|78224304|ref|YP_386051.1| flagellar FliF M-ring protein [Geobacter metallireducens GS-15]
 gi|78195559|gb|ABB33326.1| Flagellar FliF M-ring protein [Geobacter metallireducens GS-15]
          Length = 527

 Score =  160 bits (404), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 125/428 (29%), Positives = 206/428 (48%), Gaps = 34/428 (7%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           L +LL+ F    +L   +  I+  V+ V I+ F       N   Y  L+  L   D   I
Sbjct: 5   LKKLLEPF---MALPPAKRWIVGGVVGVSIIAFALLIMVANRTDYRPLFTNLTTEDAGEI 61

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
              L E  + +RI+ +G +I VPS  V   R+ +A+ GLP      G+E+FD+ N FG+T
Sbjct: 62  VTKLKEQKVPYRIAADGKAILVPSDKVYDLRLTMASAGLPQGGG-VGFEIFDRKN-FGMT 119

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI-----R 178
            F+Q++   RAL+GE++RTI  I+G+  ARVH+ +P+   F++     TASV++     R
Sbjct: 120 EFVQKLNYQRALQGELSRTIGQIAGVEQARVHLAIPEKALFKEDEKPATASVVLKVKGNR 179

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQ 238
            +N S     + + HLVA+++  ++   VTVLD  GKLL+ N    +  GK  + +Q +Q
Sbjct: 180 QLNDS---DVQGVVHLVASSIEGMNPEHVTVLDQKGKLLSKN-GPTDAAGKMTASMQEVQ 235

Query: 239 HEIEMNINKALAAFL--GVDNFRSAVVAELNMDTQQIR--EIVYDPDSKVERSIRLSKDA 294
              E    + L + L   V + +S        D +Q+   E  YDP++ V       +  
Sbjct: 236 RTYERGTEERLQSLLDKAVGSGKSVARVSAVFDFRQVERYEEKYDPETVV-------RSE 288

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKVPL---PRSLENTDKKEEQSNYEINTKSIATTHDN 351
           QRSE S   +  T        +  + P      +  N  K +E  NYE++  +  T    
Sbjct: 289 QRSEESMGGANATAGVPGAQTNLGRTPAGAGGATGPNGSKNDETLNYEVSRSTARTIEPV 348

Query: 352 YKLERLSIAVVVNKGRLTEVLGRSADQGKID------SYLAEINKIVSAATGINSRRGDT 405
             L ++S+A++V+       +G+     K        + L +I  +V  A G N+ RGD 
Sbjct: 349 GALSKVSVAILVDGKYDAPAVGKDGKNAKPKYTPRSPAELQQIEALVKGAVGFNAVRGDQ 408

Query: 406 ITITSMDF 413
           +T+ ++ F
Sbjct: 409 VTVANIPF 416


>gi|253998468|ref|YP_003050531.1| flagellar M-ring protein FliF [Methylovorus sp. SIP3-4]
 gi|253985147|gb|ACT50004.1| flagellar M-ring protein FliF [Methylovorus sp. SIP3-4]
          Length = 576

 Score =  159 bits (403), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 118/414 (28%), Positives = 199/414 (48%), Gaps = 40/414 (9%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +   P Y  L+      D   I  +L + NI ++ S++G++I VP+S V + R+ LAAQ
Sbjct: 46  LWSQQPEYRVLFSNYADKDGGAIVASLEQMNIPYKFSESGTAILVPASQVHQVRLKLAAQ 105

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP    N G+EL +    FG++ F++++   R LEGE+ R+IQ+IS +  AR+H+ +P 
Sbjct: 106 GLPKGG-NIGFELLEN-QKFGVSQFVEQVNFQRGLEGELERSIQTISAVEVARIHLAIPK 163

Query: 161 MGSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +   +PTASV++  + P      +   AI HLVA++VP L + +VTV+D  G LL
Sbjct: 164 PSVFVRDQQKPTASVLLN-LRPGRMLDQQQVSAIVHLVASSVPELPIANVTVVDQNGNLL 222

Query: 218 --TANEMERNILGKS-LSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
             T  +  RN L  + L  +  +Q  I   +   +A  +G  N  +   AE++  TQ+  
Sbjct: 223 SDTDKKAGRNNLDPTQLKYIDELQQNIVRRVESIIAPMVGAKNVHAEASAEVDFSTQEQA 282

Query: 275 EIVYDPDSKVER-SIRLSKDAQRSETS-------------QPESAVTVEQNMPHVSDRKV 320
              Y P+   +  S+R  +  +   TS             QP +  T   N    ++   
Sbjct: 283 AETYRPNQAPDAMSVRSQQSNESQSTSPAGVGGVPGALSNQPPAPATAPLNTAVPANAGA 342

Query: 321 PLPRSLE----------------NTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVN 364
           P   +                  NT +K   +NYE++            ++RL++AVVVN
Sbjct: 343 PGAGTPANAAAANAANATPAVPVNT-QKNVTTNYELDKTIRYVQQPMGGVKRLTVAVVVN 401

Query: 365 KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQL 418
             ++ +  G+  ++   D+   EI+ +   A G N  RGD++T+ +  F   Q+
Sbjct: 402 HKQVVDKNGKVTNRPLTDAEKTEISDLAKQAMGFNQERGDSLTVVNSSFAGEQI 455


>gi|148253400|ref|YP_001237985.1| flagellar MS-ring protein [Bradyrhizobium sp. BTAi1]
 gi|146405573|gb|ABQ34079.1| Flagellar basal body M-ring protein [Bradyrhizobium sp. BTAi1]
          Length = 535

 Score =  159 bits (403), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 119/410 (29%), Positives = 201/410 (49%), Gaps = 12/410 (2%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           LL F K    LG  R+  + +V    I  F      V +P    L+  L + D + I   
Sbjct: 4   LLDFLKG---LGAARLTAMIAVTAALIGFFGFVIMRVTAPQMTTLFTDLGMDDSSSIIKD 60

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L    I F I + GS I VP   V + R+ LA +G        GYE+FDK ++ G TSF+
Sbjct: 61  LERQGIPFEIRNEGSVILVPKDKVTRLRMKLA-EGGLPKGGGVGYEIFDKSDALGTTSFV 119

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           Q I  +RALEGE+ARTI++I  I AARVH+V+P+   F +    P+AS+++R        
Sbjct: 120 QNINHLRALEGELARTIRAIDRIQAARVHLVLPERPLFSRETPEPSASIVVRVRGALDAA 179

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL---TANEMERNILGKSLSIVQAIQHEIEM 243
              AIRHLVA+AV  L    V+++D  G+LL   T  ++++ +  +  +     +  +  
Sbjct: 180 QIRAIRHLVASAVNGLKPQRVSIVDEAGQLLADGTQTDIDQQVGDERRN---TFEKRMRK 236

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            +   +++ +G    R  + A+ + +        YDP+ +V RS +  +  ++S +S+  
Sbjct: 237 QVEDIVSSVVGAGRARVQLSADFDFNRITQTSDRYDPEGRVLRSSQTRE--EQSASSESN 294

Query: 304 SAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVV 363
             VTV   +P     +       + + K EE +NYEI+  +     +  ++ R+S+AV+V
Sbjct: 295 GQVTVNNELPGNQQNQQQQQPPRDQSKKTEETNNYEISRTTKTEVTEAGRVNRISVAVLV 354

Query: 364 NKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           +        G    + +    L  I  +V +A G + +RGD + + ++ F
Sbjct: 355 DGAYSKNEKGELVYKERSKEELDRIAALVRSAIGFDQKRGDQVEVVNLKF 404


>gi|212709512|ref|ZP_03317640.1| hypothetical protein PROVALCAL_00554 [Providencia alcalifaciens DSM
           30120]
 gi|212687850|gb|EEB47378.1| hypothetical protein PROVALCAL_00554 [Providencia alcalifaciens DSM
           30120]
          Length = 563

 Score =  159 bits (403), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 125/416 (30%), Positives = 206/416 (49%), Gaps = 36/416 (8%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  SP Y  L   L   D   I   L++ N+ ++I+DNGS+I VP+  V + R+ LA  
Sbjct: 46  LWFRSPDYRVLLSNLSAKDGGDIVSQLTQMNVPYQIADNGSAILVPADKVHELRLKLAQS 105

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP    N+G+EL DK   FG++ F ++I   RALEGE++RTI+S+S + +ARVH+ +P 
Sbjct: 106 GLPKGG-NTGFELLDK-EKFGISQFSEQINYQRALEGELSRTIESLSPVQSARVHLAIPK 163

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    PTASV +  +   +    +  AI H+V+++V  L   +V ++D TG+LLT
Sbjct: 164 PTLFVREQKLPTASVTVGLLPGRMLDEGQISAIVHMVSSSVTGLTAANVIIVDQTGRLLT 223

Query: 219 ANE-MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIV 277
            N+  +++     + + + ++  ++  I   L+  +G  N  + V A+++    +     
Sbjct: 224 NNDNSQQSANSAQIKMTKEMEAHLKERIEDILSPLVGRANIHAQVTAQMDFSKVEQTSEE 283

Query: 278 YD----PDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKK- 332
           Y     PD+   RS R S ++ ++    P        N P VS    P+  + ENTD K 
Sbjct: 284 YKPNQTPDAAAVRS-RQSSESLQNSNGGPSGVPGALSNQP-VSAPSAPIDGNKENTDGKT 341

Query: 333 -------------EEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQG 379
                        +E +NYE++ K   T      ++RLS+AV+VN        G    + 
Sbjct: 342 AGNTRNGTLNTQRDETTNYEVDRKISHTQRQIGVVDRLSVAVIVN---YQSQEGEKGPEM 398

Query: 380 K--IDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILS 433
           K      L +I+ +   A G +++RGD+I IT      N LF   T  +    +LS
Sbjct: 399 KPLPPEMLQQIDALTREAMGYSAQRGDSINIT------NSLFTDDTPVIEEPSLLS 448


>gi|152990373|ref|YP_001356095.1| flagellar M-ring protein FliF [Nitratiruptor sp. SB155-2]
 gi|151422234|dbj|BAF69738.1| flagellar M-ring protein FliF [Nitratiruptor sp. SB155-2]
          Length = 542

 Score =  159 bits (402), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 115/387 (29%), Positives = 203/387 (52%), Gaps = 20/387 (5%)

Query: 43  VNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGL 102
           +++  Y  LY  L   D   I   L E  I +++  NG  I VP   +   R+ LAA+GL
Sbjct: 46  ISAEKYGVLYANLTADDAGNILTVLQEEKIPYKVEGNGKIILVPKDKIYDVRLKLAAKGL 105

Query: 103 PSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMG 162
           P S  N G+E+FD+    G+T F + I  +RALEGE+ARTI+ I  +  ARV+I +P   
Sbjct: 106 PRSQ-NVGFEIFDE-PKMGITHFQENINYIRALEGELARTIKKIDAVQDARVNIALPKDS 163

Query: 163 SFRKIGARPTASVMIRAINPSVYKSAE---AIRHLVAAAVPNLDMGDVTVLDSTGKLLT- 218
            F +      ASV+I +++P +  + E   AI  LV+ AVP L   +VTV+D++G++L+ 
Sbjct: 164 IFAREEDEAKASVII-SLHPGMSLTKEQVKAIVFLVSHAVPKLKSQNVTVVDNSGRVLSD 222

Query: 219 -ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQI--RE 275
              E E   +   + + +  + +IE ++   LA  LG    +  V A + ++T +I  R+
Sbjct: 223 MLEENEEKEVHDVVDLKRKFRRDIEKSVESMLARALGAQ--KVVVRANVEIETAKIDKRD 280

Query: 276 IVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQ 335
            +YDPD     S R  ++  +S   QP  +     N+P   +   P    L++  KK+  
Sbjct: 281 EIYDPDKTAVVSERKIQEKSKSIPQQPIGSPGTPTNVPATINTG-PNGTVLQDKSKKDIT 339

Query: 336 SNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQ-----GKIDSYLAEINK 390
           +NY++    I T  + +K++++++ V+++ G+  + + ++         + +  L     
Sbjct: 340 TNYDVTKSLIVTKQNVFKIKKITVGVLID-GKYIKKMDKNGTMQVEFVPRSEQELKSFEN 398

Query: 391 IVSAATGINSRRGDTITITSMDFLENQ 417
           ++ +A G + +RGD +T+ S+ F ENQ
Sbjct: 399 LIKSAIGYDPKRGDQVTVVSVPF-ENQ 424


>gi|304398855|ref|ZP_07380725.1| flagellar M-ring protein FliF [Pantoea sp. aB]
 gi|304353559|gb|EFM17936.1| flagellar M-ring protein FliF [Pantoea sp. aB]
          Length = 575

 Score =  159 bits (402), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 135/454 (29%), Positives = 213/454 (46%), Gaps = 61/454 (13%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +   P Y  LY  L   D   I   L++ NI +R ++NG ++ VP + V + R+ LA Q
Sbjct: 47  LWAKQPSYSVLYNNLTDEDGGAIVTQLTQMNIPYRFAENGGALMVPEANVHELRLRLAQQ 106

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   S  G+EL DK   FG++ F +++   RALEGE+ARTI+S+  + +ARVH+ MP 
Sbjct: 107 GLPKGGS-VGFELLDK-EKFGISQFSEQVNYQRALEGELARTIESLGPVKSARVHLAMPK 164

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++       +AI H+V+++V  L  G+VTV+D TG+
Sbjct: 165 PTLFVREQKAPSASVTLTLQPGRALDEG---QIQAIAHMVSSSVAGLPPGNVTVVDQTGR 221

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT ++   R++    L     ++   +  I   L   LG  N  + V A++N DT +  
Sbjct: 222 LLTRSDSAGRDLNDAQLKYSSEVEARYQQRIEAILNPILGQGNVHAQVTAQINFDTAEQT 281

Query: 275 EIVYDPDSKVERSIRLSKDAQRSETS--------------QPESAVTVEQNMP------- 313
           +  Y P++    S   S+    S+ S              QP  A T     P       
Sbjct: 282 DEKYQPNANPSNSAIRSRQTSTSDQSGSPYPGGVPGALSNQPAPANTAPVTTPNNNAANG 341

Query: 314 -----------HVSDRKVPLPRSLENTD-KKEEQSNYEINTKSIATTHDNY-KLERLSIA 360
                      + S      P S   T+ ++++  NYE++ ++I  T  N   ++RLS+A
Sbjct: 342 QAANGQNNAANNASQTTSTAPASSGPTNSRRDDTVNYELD-RTIRHTKVNVGDVQRLSVA 400

Query: 361 VVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDFLEN 416
           VVVN         R+ D+GK     +  L +I  +   A G +  RGD+I + +  F   
Sbjct: 401 VVVN--------FRADDKGKAVALNEQQLKQIEDLTREAMGYSQSRGDSINVVNSQFNTT 452

Query: 417 QLFNSG---TVQVSFMDILSRHFATVINALVFLV 447
           +   +      Q SF D L      ++ ALV  V
Sbjct: 453 EPVTTDLPFWQQQSFFDQLMDAGKWLLVALVAFV 486


>gi|322655518|gb|EFY51826.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322683020|gb|EFY79036.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|323204454|gb|EFZ89460.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
          Length = 531

 Score =  159 bits (402), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 129/438 (29%), Positives = 212/438 (48%), Gaps = 52/438 (11%)

Query: 33  IMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGK 92
           + + +A   +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V +
Sbjct: 7   VAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHE 66

Query: 93  ARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAA 152
            R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +A
Sbjct: 67  LRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSA 124

Query: 153 RVHIVMPDMGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDV 207
           RVH+ MP    F +    P+ASV +     RA++        A+ HLV++AV  L  G+V
Sbjct: 125 RVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEG---QISAVVHLVSSAVAGLPPGNV 181

Query: 208 TVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAEL 266
           T++D +G LLT +N   R++    L     ++  I+  I   L+  +G  N  + V A+L
Sbjct: 182 TLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQL 241

Query: 267 NMDTQQIREIVYDPDSKVERSIRLSKDAQRSE--------------TSQP----ESAVTV 308
           +   ++  E  Y P+    ++   S+    SE              ++QP    E+ +  
Sbjct: 242 DFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIAT 301

Query: 309 E-------QNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAV 361
                   QN P  S           NT ++ E SNYE++     T  +   +ERLS+AV
Sbjct: 302 PPTNQQNAQNTPQTSTSTNSNSAGPRNT-QRNETSNYEVDRTIRHTKMNVGDIERLSVAV 360

Query: 362 VVNKGRLTE--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VVN   L +   L  +ADQ K      +I  +   A G + +RGDT+ + +  F  + + 
Sbjct: 361 VVNYKTLADGKPLPLTADQMK------QIEDLTREAMGFSDKRGDTLNVVNSPF--SAVD 412

Query: 420 NSG-----TVQVSFMDIL 432
           N+G       Q SF+D L
Sbjct: 413 NTGGELPFWQQQSFIDQL 430


>gi|222112250|ref|YP_002554514.1| flagellar m-ring protein flif [Acidovorax ebreus TPSY]
 gi|221731694|gb|ACM34514.1| flagellar M-ring protein FliF [Acidovorax ebreus TPSY]
          Length = 564

 Score =  159 bits (402), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 116/398 (29%), Positives = 197/398 (49%), Gaps = 28/398 (7%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
           F+   P Y  L+  L   D   I   LS+ N+ ++ ++ G +I VP+  V   R+ LA Q
Sbjct: 50  FYSRQPDYRVLFSGLNDKDGGAIVAQLSQMNVPYKYTEGGGAILVPAERVHDVRLRLATQ 109

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP  S  +G+EL +  N FG+T F + +   R LEGE+ R+IQ+++ + +ARVH+ +P 
Sbjct: 110 GLPKGSV-TGFELME-TNRFGVTQFQERLNFQRGLEGELTRSIQALASVQSARVHLALPQ 167

Query: 161 MGSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +   +P+ASV++ ++ P  +        I HLVA++VP L    V+VLD TGKLL
Sbjct: 168 QNGFFREQQKPSASVLL-SLYPGRFLDRAQLAGIVHLVASSVPELAPSAVSVLDDTGKLL 226

Query: 218 --TANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMD----TQ 271
             T +     +  + L+ VQ I+ +    I   L   +G +N ++ V AE++ +    T 
Sbjct: 227 SQTPDMAGAGVDAQQLAYVQQIEQQYARRILDLLEPVVGKNNVKAQVTAEVDFNQTESTV 286

Query: 272 QIREIVYDPDSKVERSIRLSKDAQRSETSQPESAV--TVEQNMPHVSDRKV----PLP-- 323
           +  +    PD+   RS ++ +    +  +QP + V   V    P  S   +    P P  
Sbjct: 287 EQHKPNLAPDASAVRSQQVVESG-GTPGAQPPTGVPGAVTNQPPQASAAPINGANPAPTA 345

Query: 324 ------RSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSA- 376
                        K+E  +NYE++  +  T      ++R++ AVVVN   ++E  G+ A 
Sbjct: 346 AGGAPGSGAAGQAKRESITNYEVDKTTQVTRGGAGAIKRVNAAVVVNYQPVSEGPGKPAV 405

Query: 377 DQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFL 414
           ++      L ++  +V    G N  RGD++ + +  FL
Sbjct: 406 NKALTPEQLEQMTALVRETIGFNKERGDSVNLMNAPFL 443


>gi|121596094|ref|YP_987990.1| flagellar M-ring protein FliF [Acidovorax sp. JS42]
 gi|120608174|gb|ABM43914.1| flagellar M-ring protein FliF [Acidovorax sp. JS42]
          Length = 564

 Score =  159 bits (402), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 116/398 (29%), Positives = 197/398 (49%), Gaps = 28/398 (7%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
           F+   P Y  L+  L   D   I   LS+ N+ ++ ++ G +I VP+  V   R+ LA Q
Sbjct: 50  FYSRQPDYRVLFSGLNDKDGGAIVAQLSQMNVPYKYTEGGGAILVPAERVHDVRLRLATQ 109

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP  S  +G+EL +  N FG+T F + +   R LEGE+ R+IQ+++ + +ARVH+ +P 
Sbjct: 110 GLPKGSV-TGFELME-TNRFGVTQFQERLNFQRGLEGELTRSIQALASVQSARVHLALPQ 167

Query: 161 MGSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +   +P+ASV++ ++ P  +        I HLVA++VP L    V+VLD TGKLL
Sbjct: 168 QNGFFREQQKPSASVLL-SLYPGRFLDRAQLAGIVHLVASSVPELAPSAVSVLDDTGKLL 226

Query: 218 --TANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMD----TQ 271
             T +     +  + L+ VQ I+ +    I   L   +G +N ++ V AE++ +    T 
Sbjct: 227 SQTPDMAGAGVDAQQLAYVQQIEQQYARRILDLLEPVVGKNNVKAQVTAEVDFNQTESTV 286

Query: 272 QIREIVYDPDSKVERSIRLSKDAQRSETSQPESAV--TVEQNMPHVSDRKV----PLP-- 323
           +  +    PD+   RS ++ +    +  +QP + V   V    P  S   +    P P  
Sbjct: 287 EQHKPNLAPDASAVRSQQVVESG-GTPGAQPPTGVPGAVTNQPPQASAAPINGANPAPTA 345

Query: 324 ------RSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSA- 376
                        K+E  +NYE++  +  T      ++R++ AVVVN   ++E  G+ A 
Sbjct: 346 AGGAPGSGAAGQAKRESITNYEVDKTTQVTRGGAGAIKRVNAAVVVNYQPVSEGPGKPAV 405

Query: 377 DQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFL 414
           ++      L ++  +V    G N  RGD++ + +  FL
Sbjct: 406 NKALTPEQLEQMTALVRETIGFNKERGDSVNLMNAPFL 443


>gi|253702508|ref|YP_003023697.1| flagellar M-ring protein FliF [Geobacter sp. M21]
 gi|251777358|gb|ACT19939.1| flagellar M-ring protein FliF [Geobacter sp. M21]
          Length = 522

 Score =  159 bits (402), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 124/425 (29%), Positives = 205/425 (48%), Gaps = 31/425 (7%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           L +LL+ F    +L   + L++  V L  ++ F A     N   Y  L+  L   D   I
Sbjct: 5   LKKLLEPF---LALSSAKRLVVGGVALASLLGFAALIAVANKTDYRPLFANLTQEDAGEI 61

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
              L E  + ++IS +G +I VPS  V   R+ LA+ GLP      G+E+FD+ N FG+T
Sbjct: 62  VKKLKEQKVPYQISPDGKAILVPSDNVYDLRLSLASDGLPQGG-GIGFEIFDRKN-FGMT 119

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS 183
            F+Q++   RAL+GE+ RTI  I+G+ +ARVH+ +P+   F++     TASV+I+  +  
Sbjct: 120 EFVQKLNYQRALQGELGRTIAQIAGVESARVHLALPEKALFQEQEKPATASVVIKMKSNR 179

Query: 184 VYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLL---TANEMERNILGKSLSIVQAIQ 238
             +  E   + HLVA+++  +D   VTVLD+ GK+L   ++N+    + G      +A +
Sbjct: 180 QLREGEVQGVVHLVASSIEGMDPEQVTVLDTRGKVLSSHSSNDPTSKLAGARQDTQRAFE 239

Query: 239 HEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE 298
              E  +   L   +G     + V A  +    +  E  YDP+S   RS       QRSE
Sbjct: 240 KTEEEKLQSLLDRVVGSGKSVARVSASFDFKQVEKYEERYDPESAAVRS------EQRSE 293

Query: 299 -----TSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYK 353
                ++    A  V+ NM     R      +     K +E  NYE++  +         
Sbjct: 294 EKGGISTTASGAPGVQTNM----GRAQGAAGTTGGGSKTDETLNYEVSRSTARIVEPVGS 349

Query: 354 LERLSIAVVVNKGRLTEVLGRSAD-----QGKIDSYLAEINKIVSAATGINSRRGDTITI 408
           L ++S+A++V+ G+     G   D     Q +    + +I  +V +A G N+ RGD +T+
Sbjct: 350 LSKVSVAILVD-GKYELAPGAKPDAAPKYQPRSPDEMQKIEALVKSAVGFNAERGDQVTV 408

Query: 409 TSMDF 413
            ++ F
Sbjct: 409 ANIPF 413


>gi|146342729|ref|YP_001207777.1| flagellar MS-ring protein [Bradyrhizobium sp. ORS278]
 gi|146195535|emb|CAL79562.1| Flagellar basal body M-ring protein [Bradyrhizobium sp. ORS278]
          Length = 532

 Score =  159 bits (402), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 129/462 (27%), Positives = 223/462 (48%), Gaps = 20/462 (4%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           LL F K    LG  R+  + +V    +  F      V +P    L+  L + D + I   
Sbjct: 4   LLDFLKG---LGAARLAAMVAVTAALVGFFGFVIMRVTAPQMTTLFTDLSMDDSSSIIKD 60

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L    I F I + GS I VP   V + R+ LA +G        GYE+FDK ++ G TSF+
Sbjct: 61  LERQGIAFEIRNEGSVIMVPKDKVTRLRMKLA-EGGLPKGGGVGYEIFDKSDALGTTSFV 119

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           Q I  +RALEGE+ARTI++I  + AARVH+V+P+   F +    P+AS+++R        
Sbjct: 120 QNINHLRALEGELARTIRAIDRVQAARVHLVLPERPLFSRETPEPSASIVVRVRGSLEAN 179

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL---TANEMERNILGKSLSIVQAIQHEIEM 243
              AIRHLVA+AV  L    V+++D  G+LL   T  ++++ +  +  +   A +  +  
Sbjct: 180 QIRAIRHLVASAVNGLKPQRVSIVDEAGQLLADGTQTDIDQQVGDERRN---AFEKRMRK 236

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            +   +++ +G    R  + A+ + +        YDP+ +V RS +  +  ++S TS+  
Sbjct: 237 QVEDIVSSVVGSGRARVQLSADFDFNRITQTSDRYDPEGRVLRSSQTRE--EQSATSESN 294

Query: 304 SAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVV 363
             VTV   +P     +       + + K EE +NYEI+  +     +  ++ R+S+AV+V
Sbjct: 295 GQVTVNNELPGNQQNQQGQQPK-DQSKKTEETNNYEISRTTKTEVTEAGRVNRISVAVLV 353

Query: 364 NKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGT 423
           +        G    + +    L  I  +V +A G + +RGD + + ++ F +  +    +
Sbjct: 354 DGAYSKNEKGDLVYKERSKEELDRIAALVRSAIGFDQKRGDQVEVVNLKFADGPVVPQIS 413

Query: 424 VQVSFMDILSRHFAT-----VINALVFLVGTLLVTFLGLHAL 460
               F+ +L  HF       VI   V ++  ++V F+ +  L
Sbjct: 414 EPTGFLGML--HFTKDDVMYVIELAVMMLLGIVVVFMVVRPL 453


>gi|16765307|ref|NP_460922.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|120326|sp|P15928|FLIF_SALTY RecName: Full=Flagellar M-ring protein
 gi|154023|gb|AAA27096.1| fliF flagellar M-protein precursor [Salmonella enterica subsp.
           enterica serovar Typhimurium]
 gi|16420504|gb|AAL20881.1| basal-body MS (membrane and supramembrane)-ring and collar protein
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|261247135|emb|CBG24958.1| flagellar basal-body M-ring protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267993958|gb|ACY88843.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301158483|emb|CBW17993.1| flagellar basal-body M-ring protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312912959|dbj|BAJ36933.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|332988858|gb|AEF07841.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 560

 Score =  159 bits (401), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 129/433 (29%), Positives = 210/433 (48%), Gaps = 58/433 (13%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R+ LA Q
Sbjct: 44  LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQ 103

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 104 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 161

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D +G 
Sbjct: 162 PSLFVREQKSPSASVTVTLEPGRALD---EGQISAVVHLVSSAVAGLPPGNVTLVDQSGH 218

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  
Sbjct: 219 LLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT 278

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQP----ESAVTVE------- 309
           E  Y P+    ++   S+    SE              ++QP    E+ +          
Sbjct: 279 EEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNA 338

Query: 310 QNMPHVS---DRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG 366
           QN P  S   +     PRS +    + E SNYE++     T  +   +ERLS+AVVVN  
Sbjct: 339 QNTPQTSTSTNSNSAGPRSTQ----RNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYK 394

Query: 367 RLTE--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG-- 422
            L +   L  +ADQ K      +I  +   A G + +RGDT+ + +  F  + + N+G  
Sbjct: 395 TLADGKPLPLTADQMK------QIEDLTREAMGFSDKRGDTLNVVNSPF--SAVDNTGGE 446

Query: 423 ---TVQVSFMDIL 432
                Q SF+D L
Sbjct: 447 LPFWQQQSFIDQL 459


>gi|163738046|ref|ZP_02145462.1| flagellar M-ring protein FliF [Phaeobacter gallaeciensis BS107]
 gi|161388662|gb|EDQ13015.1| flagellar M-ring protein FliF [Phaeobacter gallaeciensis BS107]
          Length = 561

 Score =  159 bits (401), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 145/491 (29%), Positives = 238/491 (48%), Gaps = 31/491 (6%)

Query: 19  RTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISD 78
           R R++ + + ++V I+  +A     N+P    LY  LE      +  AL +   ++ +  
Sbjct: 14  RKRLIAVGATVIV-ILSVLAMSRVANTPTMQLLYAGLESGSAGDVVRALEQRGTEYEV-- 70

Query: 79  NGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGE 138
            G SI VP++   + R+ LA++GLP++    GYEL D ++ FG TS M +    RA EGE
Sbjct: 71  RGGSIYVPATARDELRMTLASEGLPANGGR-GYELLDSLSGFGTTSQMFDAAYWRAKEGE 129

Query: 139 IARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN-PSVYKSAEAIRHLVAA 197
           +ARTI +   +  ARVHI       F++  A PTASV +  +  P     A AIR L+++
Sbjct: 130 LARTIVASPHVTQARVHIANTGSNPFQRT-AEPTASVSVVPMGSPITPAQANAIRFLISS 188

Query: 198 AVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDN 257
           AV  L + +V V+D+ G L+ + E    +   +    Q+I+      + + + A +G  N
Sbjct: 189 AVTGLAVENVAVIDANGALIGSPEAAAAVGAGTDDRSQSIRE----RVMRLVEARVGHGN 244

Query: 258 FRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESA-VTVEQNMPHVS 316
               V  E   DT+ IRE   DP+S+V  S  +    +R+++SQ +S  VTV  N+P   
Sbjct: 245 AVVEVSVETVTDTESIREKRIDPESRVAISTDVE---ERADSSQNQSGEVTVASNIPD-- 299

Query: 317 DRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSA 376
                   S  +T    E+ NYEI+            ++RL++AV++N   +T   G + 
Sbjct: 300 GDAASGDGSKASTSATRERVNYEISETEKEILRGPGAIKRLTVAVLLNGVPITTATGETV 359

Query: 377 DQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF--LENQLFNSGT-VQVSFMDILS 433
            + + +  L  + +++SAA G +  RGD IT+ SM+   +E Q    GT V  S  D + 
Sbjct: 360 MEPRSEEELGALRELISAAVGFSEERGDVITLKSMEMPTVEPQ----GTVVSASIFDNIY 415

Query: 434 RHFATVINALVFLVGTLLVTFLGLHALRRL--HNIDDAKKGEVGGKSILSPPPISSAVTT 491
               ++I      + TL+   LGL  +R +  +       G  GG ++   P +      
Sbjct: 416 LDAMSLIQMAALALVTLI---LGLFVIRPILSNQASVPALGAPGGDAMDELPALGGG--- 469

Query: 492 GLMPNDNIALD 502
           G M N N+  D
Sbjct: 470 GFMANPNLGAD 480


>gi|197285489|ref|YP_002151361.1| flagellar MS-ring protein [Proteus mirabilis HI4320]
 gi|194682976|emb|CAR43401.1| flagellar M-ring protein [Proteus mirabilis HI4320]
          Length = 573

 Score =  159 bits (401), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 142/551 (25%), Positives = 253/551 (45%), Gaps = 62/551 (11%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            ++ SP Y  LY  L   D   I   L++ N+ +R+S NGS+I VP + V + R+ LA  
Sbjct: 46  LWLQSPDYKVLYSNLSDKDGGEIVTQLTQMNVPYRLSQNGSAIMVPDNQVHELRLKLAQA 105

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   + +G+EL DK   FG++ F ++I   RALEGE+ARTI+++  +  ARVH+ +P 
Sbjct: 106 GLPKGGA-AGFELLDK-EKFGISQFSEQINYQRALEGELARTIETLGPVQNARVHLALPK 163

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV +  +        +  AI H+VA++V  +   +VT++D +GKLLT
Sbjct: 164 PSLFVREQKSPSASVTVGLLQGRALDEGQINAIVHIVASSVAGMPDSNVTIVDQSGKLLT 223

Query: 219 -ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIV 277
             + + R++    L  VQ ++   +  I   L   +G  N  + V A+++    +     
Sbjct: 224 QPDALGRDLNSIQLKYVQELESRYQQRIETLLGPIVGRGNVHAQVTAQVDFSHTEETAEE 283

Query: 278 YDPDSKVERSIRLSKDAQRSE--------------TSQP--ESAVTVEQNMPHVSDRKV- 320
           Y P+    ++   SK   +SE              ++QP       +E+     +D K  
Sbjct: 284 YKPNQPPNQAAVRSKQVSQSEQNGGMLAGGVPGALSNQPVAPPQAPIEKAKDTTADEKTT 343

Query: 321 ------PLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVN------KGRL 368
                  + R+  +  + +E +NYE++ +          +ERLS+AV+VN      K + 
Sbjct: 344 STNANRSMTRNPNSNSRLDETTNYEVDRRIRHVKRPVGNIERLSVAVIVNYKTVEDKKKA 403

Query: 369 TEVLGRSADQGKI---DSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQ 425
           TE      +  ++   D  L +I  +V  A G +  RGD++++       N  FN     
Sbjct: 404 TEGEEPIVENKQVPLTDEQLQQIESLVREAMGYSQERGDSLSVV------NSQFNDTEEP 457

Query: 426 VSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL--HNIDDAKKGEVGG-KSILSP 482
           V  + +       ++   + L   LL+  +     R+L    ++  ++ EV   K+IL  
Sbjct: 458 VISVPVWEN--PQILAKALDLGRWLLLVIIAWILWRKLVKPQLEKRREAEVAAQKAILK- 514

Query: 483 PPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERF 542
                   T L   D++  + +  D  S  +  + R+++ +  Q   R+  M E +    
Sbjct: 515 --------TKLEVTDDV--NEAELDEESRRKQARQRVSAELQSQ---RIREMAEKDPRVV 561

Query: 543 AKILRKWARSE 553
           A ++R+W   E
Sbjct: 562 AMVIRQWMSKE 572


>gi|205360218|ref|ZP_02681717.2| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|205350665|gb|EDZ37296.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
          Length = 579

 Score =  159 bits (401), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 129/433 (29%), Positives = 211/433 (48%), Gaps = 58/433 (13%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R+ LA Q
Sbjct: 63  LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQ 122

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 123 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 180

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV +L  G+VT++D +G 
Sbjct: 181 PSLFVREQKSPSASVTVTLEPGRALD---EGQISAVVHLVSSAVASLPPGNVTLVDQSGH 237

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  
Sbjct: 238 LLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT 297

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQP----ESAVTVE------- 309
           E  Y P+    ++   S+    SE              ++QP    E+ +          
Sbjct: 298 EEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNA 357

Query: 310 QNMPHVS---DRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG 366
           QN P  S   +     PRS +    + E SNYE++     T  +   +ERLS+AVVVN  
Sbjct: 358 QNTPQTSTSTNSNSAGPRSTQ----RNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYK 413

Query: 367 RLTE--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG-- 422
            L +   L  +ADQ K      +I  +   A G + +RGDT+ + +  F  + + N+G  
Sbjct: 414 TLADGKPLPLTADQMK------QIEDLTREAMGFSDKRGDTLNVVNSPF--SAVDNTGGE 465

Query: 423 ---TVQVSFMDIL 432
                Q SF+D L
Sbjct: 466 LPFWQQQSFIDQL 478


>gi|221636057|ref|YP_002523933.1| flagellar M-ring protein FliF [Thermomicrobium roseum DSM 5159]
 gi|221157932|gb|ACM07050.1| flagellar M-ring protein FliF [Thermomicrobium roseum DSM 5159]
          Length = 530

 Score =  159 bits (401), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 120/393 (30%), Positives = 196/393 (49%), Gaps = 27/393 (6%)

Query: 48  YDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSS 107
           Y  L+  L   D   I   L +  + +++S++G++ISVP   V K R+ LAAQGLP S +
Sbjct: 50  YAPLFTGLSADDAAAIIDQLRQQGVPYKLSNDGTTISVPVEQVAKLRLALAAQGLPKSGT 109

Query: 108 NSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKI 167
             G+ELFD+ +SFG+T F Q +   RALEGE+ARTI  + G+ +ARVH+V+P+   F   
Sbjct: 110 -LGFELFDR-SSFGVTDFQQRVNYQRALEGELARTISQLDGVRSARVHLVIPEESLFSD- 166

Query: 168 GARPTASVMIRAINPSVYKSAEAIR---HLVAAAVPNLDMGDVTVLDSTGKLLTANEMER 224
             +PT + ++  + P    + E +R   HLV+A+VP L    VTV+D +G  L +     
Sbjct: 167 QQQPTTAAVVLQLKPGSRLTDEQVRGVVHLVSASVPGLQPEHVTVVDESGNALWSGGGVA 226

Query: 225 NILGKS--LSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDS 282
              G S  L   +A +  +   +   +A  +G +N    V A  + D +Q+   +Y P+ 
Sbjct: 227 AAGGMSDHLKAQRAFETAMATQLQTVVARVVGNNNAAVQVSASFDWDQRQVDSEIYSPNG 286

Query: 283 KVERSIRLSKDAQRSE--TSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEI 340
              +     +  Q SE   S P     V+ N+    +      ++ + ++ +E   NYE+
Sbjct: 287 TQPQVRSQQERVQTSEGTASGPIGIPGVDSNVGSYQEGAA--QQNQQRSELRETTVNYEL 344

Query: 341 NTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAE-INKIVSAATGIN 399
           + +         K++RLS+AVV+N                +D  +AE +  +V+AA GI 
Sbjct: 345 SRQVERVVQAPGKVQRLSVAVVLNS-------------AAVDPAVAEQVRDLVAAAAGIV 391

Query: 400 SRRGDTITITSMDFLENQLFNSGTVQVSFMDIL 432
             RGD +T++ + F       S   Q + MD L
Sbjct: 392 PERGDQVTVSVVPFTTATAEESAA-QPTLMDRL 423


>gi|194451642|ref|YP_002046020.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|195873172|ref|ZP_02696421.2| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|205357978|ref|ZP_03223896.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205359405|ref|ZP_02669752.2| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|194409946|gb|ACF70165.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|195633848|gb|EDX52200.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|205328375|gb|EDZ15139.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205336392|gb|EDZ23156.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|323130248|gb|ADX17678.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
          Length = 579

 Score =  159 bits (401), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 129/433 (29%), Positives = 210/433 (48%), Gaps = 58/433 (13%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R+ LA Q
Sbjct: 63  LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQ 122

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 123 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 180

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D +G 
Sbjct: 181 PSLFVREQKSPSASVTVTLEPGRALD---EGQISAVVHLVSSAVAGLPPGNVTLVDQSGH 237

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  
Sbjct: 238 LLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT 297

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQP----ESAVTVE------- 309
           E  Y P+    ++   S+    SE              ++QP    E+ +          
Sbjct: 298 EEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNA 357

Query: 310 QNMPHVS---DRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG 366
           QN P  S   +     PRS +    + E SNYE++     T  +   +ERLS+AVVVN  
Sbjct: 358 QNTPQTSTSTNSNSAGPRSTQ----RNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYK 413

Query: 367 RLTE--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG-- 422
            L +   L  +ADQ K      +I  +   A G + +RGDT+ + +  F  + + N+G  
Sbjct: 414 TLADGKPLPLTADQMK------QIEDLTREAMGFSDKRGDTLNVVNSPF--SAVDNTGGE 465

Query: 423 ---TVQVSFMDIL 432
                Q SF+D L
Sbjct: 466 LPFWQQQSFIDQL 478


>gi|149194458|ref|ZP_01871555.1| flagellar M-ring protein [Caminibacter mediatlanticus TB-2]
 gi|149135633|gb|EDM24112.1| flagellar M-ring protein [Caminibacter mediatlanticus TB-2]
          Length = 559

 Score =  159 bits (401), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 125/387 (32%), Positives = 203/387 (52%), Gaps = 39/387 (10%)

Query: 47  HYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSS 106
           +Y  L+  L+  D   I   L +  I ++I +NG  I VP  +VGK R+ +AAQGLP SS
Sbjct: 52  NYAILFENLKPQDAALIVQYLDKKQIPYKIPENGI-IEVPKDIVGKVRLDVAAQGLPKSS 110

Query: 107 SNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRK 166
              G+E+FDK NSFG T F Q +  +RALEGE+A+TI+SI+ +  A+V+I +P    F +
Sbjct: 111 K-VGFEIFDK-NSFGATDFEQRVKYLRALEGELAKTIESIAAVEEAKVNIAIPKESVFVE 168

Query: 167 IGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-- 221
               PTAS++I+ + P++    K  E I+ LVAAAVP L   +V ++D  G  L  N   
Sbjct: 169 NQTPPTASILIK-LRPNMTLTPKQIEGIKWLVAAAVPKLKPENVKIVDQYGNPLGENSEA 227

Query: 222 -MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQ----QIREI 276
                +L   L   + ++  +E  I+  +A  +G  N    VVA++++D      + +  
Sbjct: 228 VANSELLKAELLYKKRLEKALEDKISSLIAPIVGGKN---KVVAKVSLDIDFSKVKSKAT 284

Query: 277 VYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQN----MPHVSDRKVPLPRSLENT--- 329
           +Y PD+ V           RSE +  ES + ++      +P       P+  +  N    
Sbjct: 285 IYSPDNVV-----------RSEQTLEESRIGIKPKEVGGVPGAVSNIGPVQGTKNNQIVD 333

Query: 330 --DKKEEQSNYEINTKSIATTHDNY-KLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLA 386
             +K E  +NYEI+T +I    D+Y K++R++ AVVV+     +  G+       +  + 
Sbjct: 334 KYNKTETTTNYEIST-TIKDIKDDYPKIKRITAAVVVDGYYKKDKDGKIKFVPLSEMQIK 392

Query: 387 EINKIVSAATGINSRRGDTITITSMDF 413
            I  +V  A GI+ +RGD+++++S  F
Sbjct: 393 SIENLVKNAIGIDPKRGDSVSVSSFQF 419


>gi|163742558|ref|ZP_02149944.1| flagellar M-ring protein FliF [Phaeobacter gallaeciensis 2.10]
 gi|161384143|gb|EDQ08526.1| flagellar M-ring protein FliF [Phaeobacter gallaeciensis 2.10]
          Length = 574

 Score =  159 bits (401), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 146/497 (29%), Positives = 240/497 (48%), Gaps = 43/497 (8%)

Query: 19  RTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISD 78
           R R++ + + ++V I+  +A     N+P    LY  LE      +  AL +   ++ +  
Sbjct: 27  RKRLIAVGATVIV-ILSVLAMSRVANTPTMQLLYAGLESGSAGDVVRALEQRGTEYEV-- 83

Query: 79  NGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGE 138
            G SI VP++   + R+ LA++GLP++    GYEL D ++ FG TS M +    RA EGE
Sbjct: 84  RGGSIYVPATARDELRMTLASEGLPANGGR-GYELLDSLSGFGTTSQMFDAAYWRAKEGE 142

Query: 139 IARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN-PSVYKSAEAIRHLVAA 197
           +ARTI +   +  ARVHI       F++  A PTASV +  +  P     A AIR L+++
Sbjct: 143 LARTIVASPHVTQARVHIANTGSNPFQRT-AEPTASVSVVPMGSPITPAQANAIRFLISS 201

Query: 198 AVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDN 257
           AV  L + +V V+D+ G L+ + E    +   +    Q+I+      + + + A +G  N
Sbjct: 202 AVTGLAVENVAVIDANGALIGSPEAAAAVGAGTDDRSQSIRE----RVMRLVEARVGHGN 257

Query: 258 FRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESA-VTVEQNMPHVS 316
               V  E   DT+ IRE   DP+S+V  S  +    +R+++SQ +S  VTV  N+P   
Sbjct: 258 AVVEVSVETVTDTESIREKRIDPESRVAISTDVE---ERADSSQNQSGEVTVASNIPD-- 312

Query: 317 DRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSA 376
                   S  +T    E+ NYEI+            ++RL++AV++N   +T   G + 
Sbjct: 313 GDAASGDGSKASTSATRERVNYEISETEKEILRGPGAIKRLTVAVLLNGVPITTATGETV 372

Query: 377 DQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF--LENQLFNSGTVQVS------F 428
            + + +  L  + +++SAA G +  RGD IT+ SM+   +E Q    GTV  +      +
Sbjct: 373 MEPRSEEELGALRELISAAVGFSEERGDVITLKSMEMPTVEPQ----GTVVSASIFDNIY 428

Query: 429 MDILSRHFATVINALVFLVGTLLVTF-LGLHALRRL--HNIDDAKKGEVGGKSILSPPPI 485
           +D +S         L+ +    LVT  LGL  +R +  +       G  GG ++   P +
Sbjct: 429 LDAMS---------LIQMAALALVTLILGLFVIRPILSNQASVPALGAPGGDAMDELPAL 479

Query: 486 SSAVTTGLMPNDNIALD 502
                 G M N N+  D
Sbjct: 480 GGG---GFMANPNLGAD 493


>gi|321224614|gb|EFX49677.1| Flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
          Length = 531

 Score =  159 bits (401), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 128/433 (29%), Positives = 210/433 (48%), Gaps = 58/433 (13%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R+ LA Q
Sbjct: 15  LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQ 74

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 75  GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 132

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D +G 
Sbjct: 133 PSLFVREQKSPSASVTVTLEPGRALDEG---QISAVVHLVSSAVAGLPPGNVTLVDQSGH 189

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  
Sbjct: 190 LLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT 249

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQP----ESAVTVE------- 309
           E  Y P+    ++   S+    SE              ++QP    E+ +          
Sbjct: 250 EEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNA 309

Query: 310 QNMPHVS---DRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG 366
           QN P  S   +     PRS +    + E SNYE++     T  +   +ERLS+AVVVN  
Sbjct: 310 QNTPQTSTSTNSNSAGPRSTQ----RNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYK 365

Query: 367 RLTE--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG-- 422
            L +   L  +ADQ      + +I  +   A G + +RGDT+ + +  F  + + N+G  
Sbjct: 366 TLADGKPLPLTADQ------MKQIEDLTREAMGFSDKRGDTLNVVNSPF--SAVDNTGGE 417

Query: 423 ---TVQVSFMDIL 432
                Q SF+D L
Sbjct: 418 LPFWQQQSFIDQL 430


>gi|227355980|ref|ZP_03840372.1| flagellar M-ring protein [Proteus mirabilis ATCC 29906]
 gi|227163968|gb|EEI48870.1| flagellar M-ring protein [Proteus mirabilis ATCC 29906]
          Length = 573

 Score =  159 bits (401), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 138/550 (25%), Positives = 252/550 (45%), Gaps = 60/550 (10%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            ++ SP Y  LY  L   D   I   L++ N+ +R+S NGS+I VP + V + R+ LA  
Sbjct: 46  LWLQSPDYKVLYSNLSDKDGGEIVTQLTQMNVPYRLSQNGSAIMVPDNQVHELRLKLAQA 105

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   + +G+EL DK   FG++ F ++I   RALEGE+ARTI+++  +  ARVH+ +P 
Sbjct: 106 GLPKGGA-AGFELLDK-EKFGISQFSEQINYQRALEGELARTIETLGPVQNARVHLALPK 163

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV +  +        +  AI H+VA++V  +   +VT++D +GKLLT
Sbjct: 164 PSLFVREQKSPSASVTVGLLQGRALDEGQINAIVHIVASSVAGMPDSNVTIVDQSGKLLT 223

Query: 219 -ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIV 277
             + + R++    L  VQ ++   +  I   L   +G  N  + V A+++    +     
Sbjct: 224 QPDALGRDLNSIQLKYVQELESRYQQRIETLLGPIVGRGNVHAQVTAQVDFSHTEETAEE 283

Query: 278 YDPDSKVERSIRLSKDAQRSE--------------TSQP--ESAVTVEQNMPHVSDRKV- 320
           Y P+    ++   SK   +SE              ++QP       +E+     +D K  
Sbjct: 284 YKPNQPPNQAAVRSKQVSQSEQNGGMLAGGVPGALSNQPVAPPQAPIEKAKDTAADEKAT 343

Query: 321 ------PLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVN------KGRL 368
                  + R+  +  + +E +NYE++ +          +ERLS+AV+VN      K + 
Sbjct: 344 STNANRSMTRNPNSNSRLDETTNYEVDRRIRHVKRPVGNIERLSVAVIVNYKTVEDKKKA 403

Query: 369 TEVLGRSADQGKI---DSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQ 425
           TE      +  ++   D  L +I  +V  A G +  RGD++++       N  FN    +
Sbjct: 404 TEGEEPIVENKQVPLTDEQLQQIESLVREAMGYSQERGDSLSVV------NSQFND--TE 455

Query: 426 VSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL--HNIDDAKKGEVGGKSILSPP 483
              + +       ++   + L   LL+  +     R+L    ++  ++ EV  +  +   
Sbjct: 456 EPVISVPMWENPQILAKALDLGRWLLLVIIAWILWRKLVKPQLEKRREAEVAAQKAI--- 512

Query: 484 PISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFA 543
                + T L   D++  + +  D  S  +  + R+++ +  Q   R+  M E +    A
Sbjct: 513 -----LKTKLEVTDDV--NEAELDEESRRKQARQRVSAELQSQ---RIREMAEKDPRVVA 562

Query: 544 KILRKWARSE 553
            ++R+W   E
Sbjct: 563 MVIRQWMSKE 572


>gi|253996299|ref|YP_003048363.1| flagellar M-ring protein FliF [Methylotenera mobilis JLW8]
 gi|253982978|gb|ACT47836.1| flagellar M-ring protein FliF [Methylotenera mobilis JLW8]
          Length = 546

 Score =  158 bits (400), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 142/498 (28%), Positives = 231/498 (46%), Gaps = 63/498 (12%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +   P Y  L+      D   I  AL + N+ ++ SD+G++I VP++ V + R+ LAA 
Sbjct: 42  LWSQQPDYRVLFSNYSDKDGGAIVAALEKLNVPYKFSDSGTAIMVPAAQVHQVRLKLAAD 101

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP    N G+EL +    FG++ F++++   R LEGE+ R+IQSI+ +  AR+H+ +P 
Sbjct: 102 GLPKGG-NIGFELLEN-QKFGVSQFVEQVNFQRGLEGELERSIQSIAAVEVARIHLAIPK 159

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAE---AIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +   +PTASV++  + P     A+   A+ HLVA++VPNL   +VTV+D  G LL
Sbjct: 160 PSVFVRDQQKPTASVLLN-LRPGRTLDAQQVSAVVHLVASSVPNLPTTNVTVVDQNGNLL 218

Query: 218 --TANEM-ERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
             T  +M  +N+  + L  V+ IQ  I   +   ++  +G  N R+   AE++   Q+  
Sbjct: 219 SDTTKKMGAKNLDPEQLKYVEEIQQSIVKRVESIISPIVGAKNVRAEASAEIDFSVQEQA 278

Query: 275 EIVY----DPDSKVERSIRLSK-DAQRSETS--------QPESAVTVEQNMPHVSD-RKV 320
              Y     PD+   RS++ ++  +   ET+        QP  A T        +D    
Sbjct: 279 AETYKPNQQPDAAAVRSMQSNETKSANGETAGVPGALSNQPPPAATAPITTEANADANGQ 338

Query: 321 PLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGK 380
           P   +     +K   +NYE++            ++RL++AVVVN   + +        GK
Sbjct: 339 PASNATPTNTEKNLTTNYEVDKTVSYRQQPMGGVKRLNVAVVVNNMPVVD-----KKTGK 393

Query: 381 IDSYLA-------EINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDIL- 432
           + SY A       +IN +   A G N  RGD++ I +  F       +G  Q     I  
Sbjct: 394 V-SYRALTVAEKTQINDLAMQAMGFNKERGDSLAIVNTPF-------AGEPQEVLPAIPL 445

Query: 433 ---SRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAV 489
               R    V + L F VG + +  +    L+ L N             + +PP   +AV
Sbjct: 446 WENPRVIENVKDVLRFAVGVIALLIIYRKVLKPLLN------------KLTTPP--KAAV 491

Query: 490 TTGLMPND--NIALDSSN 505
             G  P+   +I+ D SN
Sbjct: 492 NQGEAPDAVVSISADGSN 509


>gi|292487992|ref|YP_003530869.1| flagellar M-ring protein FliF [Erwinia amylovora CFBP1430]
 gi|292899212|ref|YP_003538581.1| flagellar M-ring protein [Erwinia amylovora ATCC 49946]
 gi|291199060|emb|CBJ46171.1| flagellar M-ring protein [Erwinia amylovora ATCC 49946]
 gi|291553416|emb|CBA20461.1| Flagellar M-ring protein FliF [Erwinia amylovora CFBP1430]
 gi|312172117|emb|CBX80374.1| Flagellar M-ring protein FliF [Erwinia amylovora ATCC BAA-2158]
          Length = 573

 Score =  158 bits (400), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 143/555 (25%), Positives = 256/555 (46%), Gaps = 68/555 (12%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +   P Y  L+  L   D   I   L++ N+ ++  D G ++ VP++ V + R+ LA+Q
Sbjct: 46  LWAKQPDYRVLFSNLSNEDGGTIVTQLTQMNVPYKFDDRGGALLVPAAQVHELRLRLASQ 105

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL DK   FG++ F +++   RALEGE+ARTI ++  +  ARVH+ MP 
Sbjct: 106 GLPKGGA-VGFELLDK-EKFGISQFSEQVNYQRALEGELARTISTLGPVKDARVHLAMPK 163

Query: 161 MGSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +    P+ASV + A+ P          A+ H+V+++V  +  G+VTV+D +G+LL
Sbjct: 164 PTLFVREQKSPSASVTL-ALQPGRALDEGQINAVVHMVSSSVAGMPPGNVTVVDQSGRLL 222

Query: 218 TANEM-ERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI 276
           T N+   R++    L     ++   +  I   L   LG  N  + V A+++ + ++  + 
Sbjct: 223 TQNDPGGRDLNDTQLKYANDVETRYQQRIEAILGPILGNGNVHAQVTAQIDFNKREKTDE 282

Query: 277 VYDPDSKVERSIRLSKDAQRSETSQPESAVTVE---QNMPHVSDRKVPL----------- 322
            Y P++  +R    S+    SE     SA  V     N P  ++   P+           
Sbjct: 283 QYSPNTNPDRQAIRSRQTSNSEQLGGPSAGGVPGALSNQPAPAN-AAPVTTANPNANNAN 341

Query: 323 --------------------PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVV 362
                                +++ ++ + +  +NYE+N   + T  +  +++RLS+AVV
Sbjct: 342 AANAANANNGQPANNAASGAQKTVPSSTRSDNTTNYEVNRTILHTKMNVGEVQRLSVAVV 401

Query: 363 VNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG 422
           VN    T+  G+       DS + +I  +   A G + +RGD++ + +  F +N    + 
Sbjct: 402 VN--FRTDAAGKPI--ALKDSQIKQIENLTREAMGFSEQRGDSLNVVNSQFTDNSDLAAE 457

Query: 423 ---TVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
                Q +F+D L   F      LV +V  +L   L    LRR      A + E  G ++
Sbjct: 458 LPFWKQPAFIDQL---FNAGRWLLVLIVAFILYRKLVSPQLRRKAEQQKAAE-EAAGNAL 513

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
            S              ++ +A+ S ++D  +  R  Q R+++ V  Q   R+  M E + 
Sbjct: 514 RSS-----------TQDEGVAV-SLSKDELNQERKSQHRMSAEVLSQ---RIREMSENDP 558

Query: 540 ERFAKILRKWARSEI 554
              A ++R+W + E+
Sbjct: 559 RVVALVIRQWMKDEL 573


>gi|329901251|ref|ZP_08272776.1| Flagellar M-ring protein fliF [Oxalobacteraceae bacterium IMCC9480]
 gi|327549183|gb|EGF33775.1| Flagellar M-ring protein fliF [Oxalobacteraceae bacterium IMCC9480]
          Length = 564

 Score =  158 bits (400), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 121/438 (27%), Positives = 208/438 (47%), Gaps = 33/438 (7%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
           A+ + L+ F +S    GR  +L+L + I++ +M       +   P Y  L+      D  
Sbjct: 9   AVPNPLISFAES--QGGRNLLLMLGAAIVIAVM--AGVWMWSQQPDYRVLFSNFTDRDGG 64

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
            I   L + N+ ++ ++ G +I VP+  V  AR+ +AA GLP    N G+EL +     G
Sbjct: 65  AIVTQLQQMNVPYKFAEGGGAILVPADQVHDARLRIAAMGLPKGG-NVGFELMEN-QKLG 122

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           ++ F++++   RALEGE+AR++QSI  + +ARVH+ MP    F +   +PTASV++  +N
Sbjct: 123 VSQFLEQVNFQRALEGELARSVQSIGAVESARVHLAMPKASVFVRDQQKPTASVVLN-LN 181

Query: 182 PSVYKSAE---AIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG---KSLSIVQ 235
           P    S +   AI HLVA++VP+L  G+++V+D  G LL+         G     L  +Q
Sbjct: 182 PGRSLSEQQVSAIVHLVASSVPDLPPGNISVIDQNGNLLSDTSKAAKATGLDPTQLKYIQ 241

Query: 236 AIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQ 295
            +Q  I   I   +   +G +N R+   A+++  T +     Y P+S   +S   S+ + 
Sbjct: 242 EVQQNIVRRIESIITPIVGPNNVRAEATADIDFSTSEQAAETYKPNSPPNQSTMRSQQSS 301

Query: 296 RSETSQPESA--VTVEQNMPHVSDRKVPLPRSLEN------------------TDKKEEQ 335
            S+ S P +        N P  +      P +                       +K+  
Sbjct: 302 ESQGSNPGAGGVPGALSNQPAANATAPINPPAPAPAPAAGQGVSTGATATAAVPSQKDMT 361

Query: 336 SNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAA 395
            NYE++            ++R+S+AVVVN  ++T+  G+       ++   +I  +V  A
Sbjct: 362 VNYEVDKTVRYVQQPMGGVKRISVAVVVNYKQVTDKAGKVTATPLTEAERVQITDLVKEA 421

Query: 396 TGINSRRGDTITITSMDF 413
            G N  RGDT+ + +  F
Sbjct: 422 MGFNKDRGDTLNVVNSAF 439


>gi|260222430|emb|CBA31986.1| hypothetical protein Csp_D29860 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 579

 Score =  158 bits (400), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 118/416 (28%), Positives = 205/416 (49%), Gaps = 37/416 (8%)

Query: 22  ILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGS 81
           I +  ++ +V +++   A + V       LY  L   D   +   L+  N+ ++ ++ G 
Sbjct: 49  IALFVAIAVVGLVMGRQAEWRV-------LYSNLADKDGGAVIAQLTTMNVPYKYTEGGG 101

Query: 82  SISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIAR 141
           +I VP+  V   R+ LA+QGLP  S  SG+E+ +  N FG+T F + +T  R LEGE+ R
Sbjct: 102 AILVPADRVHDVRLKLASQGLPKGSV-SGFEMME-ANRFGMTQFQERLTFQRGLEGELTR 159

Query: 142 TIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVA 196
           +IQ++S + +ARVH+ +P+   F +   +P+ASV++     RA++         I HLVA
Sbjct: 160 SIQALSSVSSARVHLALPNQNGFFREQQKPSASVLLSLHPGRALD---KGQLAGIVHLVA 216

Query: 197 AAVPNLDMGDVTVLDSTGKLLTAN-EMERNILGKSLSIVQAIQHEIEMNINKALAAFLGV 255
           ++VP ++   V+VLD TGKLL+AN +    +  + L  VQ I+      I   L   +G 
Sbjct: 217 SSVPEMNPSAVSVLDDTGKLLSANPDAAAGVDAEQLQYVQQIEQLYSRRILDMLEPLVGK 276

Query: 256 DNFRSAVVAELNM----DTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQN 311
            N ++ V AEL+      T +  +    PDS   RS +L +    ++ + P        N
Sbjct: 277 QNVKAQVTAELDFSQTESTTESHKPNQTPDSGAVRSQQLVESTNGTQPTPPAGVPGATTN 336

Query: 312 MPHVSDRKVPL---PRSL-----------ENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
            P  +    P+   P++L            ++ KKE   NYE++     T      ++R+
Sbjct: 337 QPP-AQPAAPINGQPQTLAANGQTAAGSTNSSSKKESIINYEVDKTIRVTKGAVGAIKRI 395

Query: 358 SIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           + AVV+N   +T+  G +      ++ L ++  +V    G N  RGD++ + +  F
Sbjct: 396 NAAVVLNNQSVTDAKGVTTSVALTEAQLEKMTALVRETVGFNQDRGDSVNVVNAPF 451


>gi|224583532|ref|YP_002637330.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|224468059|gb|ACN45889.1| flagellar M-ring protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 560

 Score =  158 bits (400), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 128/430 (29%), Positives = 208/430 (48%), Gaps = 52/430 (12%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R+ LA Q
Sbjct: 44  LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQ 103

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 104 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 161

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D +G 
Sbjct: 162 PSLFVREQKSPSASVTVTLEPGRALD---EGQISAVVHLVSSAVAGLPPGNVTLVDQSGH 218

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  
Sbjct: 219 LLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT 278

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQP----ESAVTVE------- 309
           E  Y P+    ++   S+    SE              ++QP    E+ +          
Sbjct: 279 EEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNA 338

Query: 310 QNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLT 369
           QN P  S           NT ++ E SNYE++     T  +   +ERLS+AVVVN   L 
Sbjct: 339 QNTPQTSTSTNSNSAGPRNT-QRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLA 397

Query: 370 E--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG----- 422
           +   L  +ADQ K      +I  +   A G + +RGDT+ + +  F  + + N+G     
Sbjct: 398 DGKPLPLTADQMK------QIEDLTREAMGFSDKRGDTLNVVNSPF--SAVDNTGGELPF 449

Query: 423 TVQVSFMDIL 432
             Q SF+D L
Sbjct: 450 WQQQSFIDQL 459


>gi|300696960|ref|YP_003747621.1| FliF: flagellar biosynthesis protein, M-ring protein, Belongs to
           the fliF family [Ralstonia solanacearum CFBP2957]
 gi|299073684|emb|CBJ53204.1| FliF: Flagellar biosynthesis protein, M-ring protein, Belongs to
           the fliF family [Ralstonia solanacearum CFBP2957]
          Length = 616

 Score =  158 bits (400), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 137/471 (29%), Positives = 227/471 (48%), Gaps = 80/471 (16%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  +  SD   I  AL + N+ +R +D GS+I VP + V +AR+ LAAQ
Sbjct: 66  LWSRAPDYRVLYSNVADSDGGAIIAALQQMNVPYRFADGGSAIMVPEANVHEARLKLAAQ 125

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP     +G+EL +    FG + F +++   RALEGE+ARTIQ++  + +ARVH+ +  
Sbjct: 126 GLPKGGL-AGFELMEN-QKFGTSQFAEQVNYQRALEGELARTIQAMQEVQSARVHLALSK 183

Query: 161 MGSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +   +P+ASV+++ + P         +AI HL++++VPNL + +VTV+D +G+LL
Sbjct: 184 PSVFVREQVKPSASVLLK-LYPGRMLDRSQVQAIGHLLSSSVPNLPLANVTVVDQSGRLL 242

Query: 218 TANEMERNILG---KSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMD-TQQI 273
           +++  + N  G     L+ V+ I+      I   L   +G DN R+ V A++++D T+Q+
Sbjct: 243 SSS-FQDNASGLDPTQLNYVRDIEQGYIKRIEAILGPVVGEDNVRAQVTADVDLDNTEQM 301

Query: 274 REIV---YDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVP--------- 321
            E      DP + V RS   S+  Q    +Q         N P  + R +P         
Sbjct: 302 AETYRPNQDPANGVVRSTHTSESTQSKAGAQ-GGVPGALSNQPPTAPRMLPTAPAPASQQ 360

Query: 322 --------LPRSLENTDKKEEQS--------------------NYEINTKSIATTHDNYK 353
                     ++  N    ++Q                     NYE++     T      
Sbjct: 361 AAAGQNGQNGQNGPNAQNGQQQGAATGQAATNNVESSARDTTVNYEVDKTVRRTRAAVGT 420

Query: 354 LERLSIAVVVN---KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITS 410
           + RLS+AVVVN    G+  + L         D+ + ++N +V  A G +++RGD++ + +
Sbjct: 421 VRRLSVAVVVNYRADGKTWKPLS--------DADMVKLNALVKDAVGYDAKRGDSVNVVN 472

Query: 411 MDFLENQLFNSGTVQVSFMDI-LSR-----HFATVINALVFLVGTLLVTFL 455
             F       SGT+  S  D+ L +     H+A  I A  +  G L + FL
Sbjct: 473 SQF-------SGTLPTSKDDLPLWKQPEMIHYA--IQAAKY--GALAIGFL 512


>gi|218887376|ref|YP_002436697.1| flagellar M-ring protein FliF [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758330|gb|ACL09229.1| flagellar M-ring protein FliF [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 539

 Score =  158 bits (400), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 122/428 (28%), Positives = 216/428 (50%), Gaps = 17/428 (3%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           + +A + +  + +F    F++N P Y  LY  L   D +R+   L    + +++   GSS
Sbjct: 25  IFIAGLAVAVVAVFFGLVFWMNRPDYRVLYSNLSPEDASRVVKLLQADKVAYKLESGGSS 84

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I+VP+  V   R+ +A +G        G+E+FD+V   G T F+Q+I   RAL+GE++RT
Sbjct: 85  ITVPADKVYDLRLKVAGEG-NLVGQGIGFEIFDQVK-VGQTDFVQKINYQRALQGELSRT 142

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAV 199
           I     + +ARVH+V+P    F +   +P+ SV+++  + S     K  +AI +LV  AV
Sbjct: 143 ISEFPNVESARVHLVIPHRSLFIEEQQKPSVSVVLKLRDSSKKLESKDVQAIVNLVVMAV 202

Query: 200 PNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQ---AIQHEIEMNINKALAAFLGVD 256
             LD   V++ D+TGK+L A + + +I G + + +     +Q  +E  I + L   LG  
Sbjct: 203 EGLDKYKVSIADTTGKILYAPDEDGSITGMTTTQLDHKLRMQQTLERRIEELLYPVLGAG 262

Query: 257 NFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVS 316
              + V A+L+   + IR+ +YDP+  V RS + S+++QR  ++       +E   P  +
Sbjct: 263 KIIAKVNADLDFSQRTIRKELYDPEKTVVRSEQRSEESQRGRSN-------LEAGSPDAN 315

Query: 317 DR-KVPL-PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGR 374
            R   P    S +  +++   +NYEIN +          + RL++AV+V+        G+
Sbjct: 316 FRGDSPTGGASTQEGNRETRTTNYEINKEEQNIVAQVGDISRLTVAVIVDGTYEKGADGQ 375

Query: 375 SADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSR 434
            A   +    +  I ++V+ A G +  RGDTI ++S+ F    +    ++    MD   R
Sbjct: 376 WAFVPRKAEDVERIRQLVANAVGYDRARGDTIEVSSISFGGPDVPQESSLPQLVMDYALR 435

Query: 435 HFATVINA 442
               ++NA
Sbjct: 436 LGKPLLNA 443


>gi|149928162|ref|ZP_01916408.1| flagellar M-ring protein FliF [Limnobacter sp. MED105]
 gi|149823147|gb|EDM82385.1| flagellar M-ring protein FliF [Limnobacter sp. MED105]
          Length = 575

 Score =  158 bits (400), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 113/412 (27%), Positives = 201/412 (48%), Gaps = 28/412 (6%)

Query: 28  VILVPIMLFMAARF--FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISV 85
           +I VP+++ + A    + N   Y  L+  L   D   I  AL++  + +  +  G++I V
Sbjct: 38  LIGVPLLIAVIASLLMWANQTSYRVLFSGLNDQDGGAIVEALTQMKVPYEFNTAGTAILV 97

Query: 86  PSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQS 145
           PS+ V   R+ LA+QGLP  S  SG+E  D     G+T F +++   RALEGE+ R+IQS
Sbjct: 98  PSNKVYDTRLALASQGLPKGSV-SGFEAMDN-QKLGITQFQEQVNYQRALEGELVRSIQS 155

Query: 146 ISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLD 203
           IS + +ARVH+ +P    F +    P+AS+++           +   I HLVA+++P ++
Sbjct: 156 ISAVQSARVHLAIPKPSIFIREKQTPSASIVLNLFGSRTLSEPQINGIVHLVASSLPGMN 215

Query: 204 MGDVTVLDSTGKLLTA-NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAV 262
             DV+++D +G+LLT   ++E  +    L+    I+  +   I   L+   G +N R+ V
Sbjct: 216 PEDVSIVDQSGRLLTGKTQLESGLNPTQLAYTNQIEQSLTSRIVDILSPVFGSENVRATV 275

Query: 263 VAELNMDTQQIREIVYDPDSKVE----RSIRLSKDAQRSETSQP-------------ESA 305
            A ++    +  + +Y P+        RS ++S+    S  + P             E+A
Sbjct: 276 TANMDYSMSERTDEIYKPNGDTTQATIRSQQISESNDGSSNANPQGIPGVMANTPPGEAA 335

Query: 306 VTVEQN----MPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAV 361
             + QN    + +  +     P    ++ +K+   NYE++     T     K+ERLS AV
Sbjct: 336 ANIGQNPQQALANGVNGGTSTPTQTNSSTRKDSTVNYEVDKSVQYTKSQVGKIERLSAAV 395

Query: 362 VVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           VVN   +T+  G +         + +++ +V  A G + +RGD + + +  F
Sbjct: 396 VVNYKTITDPKGETRQVPLTPEEITQLDSLVKQAIGFDEQRGDAVNVVNQAF 447


>gi|194445262|ref|YP_002041234.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194736346|ref|YP_002115003.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197301177|ref|ZP_02664267.2| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|204931028|ref|ZP_03221854.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|194403925|gb|ACF64147.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194711848|gb|ACF91069.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197288091|gb|EDY27478.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|204320072|gb|EDZ05277.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
          Length = 579

 Score =  158 bits (400), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 133/449 (29%), Positives = 215/449 (47%), Gaps = 55/449 (12%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R+ LA Q
Sbjct: 63  LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQ 122

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 123 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 180

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D +G 
Sbjct: 181 PSLFVREQKSPSASVTVTLEPGRALD---EGQISAVVHLVSSAVAGLPPGNVTLVDQSGH 237

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  
Sbjct: 238 LLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT 297

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQP----ESAVTVE------- 309
           E  Y P+    ++   S+    SE              ++QP    E+ +          
Sbjct: 298 EEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNA 357

Query: 310 QNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLT 369
           QN P  S           NT ++ E SNYE++     T  +   +ERLS+AVVVN   L 
Sbjct: 358 QNTPQTSTSTNSNSAGPRNT-QRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLA 416

Query: 370 E--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG----- 422
           +   L  +ADQ K      +I  +   A G + +RGDT+ + +  F  + + N+G     
Sbjct: 417 DGKPLPLTADQMK------QIEDLTREAMGFSDKRGDTLNVVNSPF--SAVDNTGGELPF 468

Query: 423 TVQVSFMDILSRHFATVINALVFLVGTLL 451
             Q SF+D L    A     LV +V  +L
Sbjct: 469 WQQQSFIDQL---LAAGRWLLVLVVAWIL 494


>gi|39648187|emb|CAE26707.1| putative flagellar M-ring protein [Rhodopseudomonas palustris
           CGA009]
          Length = 522

 Score =  158 bits (400), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 127/444 (28%), Positives = 216/444 (48%), Gaps = 14/444 (3%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           +I  +V LV    F+  R  V+ P    LY  L V D + I   L    I F + ++G+ 
Sbjct: 3   MIAVTVALVGFFAFVIMR--VSQPQMTTLYTDLSVEDSSSIIKELERQGIPFEMRNDGAI 60

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           + VP   V + R+ LA +G        GYE+FDK ++ G TSF+Q I  +RALEGE++RT
Sbjct: 61  LLVPKDKVTRLRMKLA-EGGLPKGGGVGYEIFDKSDALGTTSFVQNINHLRALEGELSRT 119

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNL 202
           I++I  + AARVH+V+P+   F +    P+AS+++R       +   AIRHLVA+AV  L
Sbjct: 120 IRAIDRVQAARVHLVLPERPLFSREAPEPSASIVLRVRGALEPQQVRAIRHLVASAVNGL 179

Query: 203 DMGDVTVLDSTGKLLTANEMERNILGKSLSIVQ--AIQHEIEMNINKALAAFLGVDNFRS 260
               V+++D  G+LL         +  + S  +  A +  +   I   +++ +G    R 
Sbjct: 180 KPQRVSIVDEAGQLLADGSASGEQVEGATSDERRAAFEKRMRNQIEGIVSSVVGSGRARV 239

Query: 261 AVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKV 320
            V A+ + +        +DP+ +V RS +  +++  + TS  +  VTV   +P  +  + 
Sbjct: 240 QVSADFDYNKITQTSDKFDPEGRVLRSSQTREES--AATSAADGQVTVNNELPGANQGQG 297

Query: 321 PLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGK 380
              R +  + K EE +NYEI+  +     +  ++ RLS+AV+V+        G      +
Sbjct: 298 AGARDV--SKKSEETNNYEISRVTKTEVTEAGRVNRLSVAVLVDGAYTKNDKGELVYAER 355

Query: 381 IDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVI 440
               L  I  +V +A G + +RGD I + ++ F E             M +       ++
Sbjct: 356 PKEQLDRIAALVRSAIGFDQKRGDQIEVVNLKFAEAPQVEKLPEPAGLMGMFQFTKDDIM 415

Query: 441 N----ALVFLVGTLLVTFLGLHAL 460
           N     ++FL+G L+V F+ +  L
Sbjct: 416 NMIQLGVMFLLG-LVVLFMVIRPL 438


>gi|198243509|ref|YP_002215117.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|197938025|gb|ACH75358.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
          Length = 576

 Score =  158 bits (399), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 133/449 (29%), Positives = 215/449 (47%), Gaps = 55/449 (12%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R+ LA Q
Sbjct: 60  LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQ 119

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 120 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 177

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D +G 
Sbjct: 178 PSLFVREQKSPSASVTVTLEPGRALD---EGQISAVVHLVSSAVAGLPPGNVTLVDQSGH 234

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  
Sbjct: 235 LLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT 294

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQP----ESAVTVE------- 309
           E  Y P+    ++   S+    SE              ++QP    E+ +          
Sbjct: 295 EEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNA 354

Query: 310 QNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLT 369
           QN P  S           NT ++ E SNYE++     T  +   +ERLS+AVVVN   L 
Sbjct: 355 QNTPQTSTSTNSNSAGPRNT-QRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLA 413

Query: 370 E--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG----- 422
           +   L  +ADQ K      +I  +   A G + +RGDT+ + +  F  + + N+G     
Sbjct: 414 DGKPLPLTADQMK------QIEDLTREAMGFSDKRGDTLNVVNSPF--SAVDNTGGELPF 465

Query: 423 TVQVSFMDILSRHFATVINALVFLVGTLL 451
             Q SF+D L    A     LV +V  +L
Sbjct: 466 WQQQSFIDQL---LAAGRWLLVLVVAWIL 491


>gi|194469863|ref|ZP_03075847.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|200390157|ref|ZP_03216768.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205358799|ref|ZP_02659200.2| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194456227|gb|EDX45066.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|199602602|gb|EDZ01148.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205331875|gb|EDZ18639.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
          Length = 579

 Score =  158 bits (399), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 122/409 (29%), Positives = 199/409 (48%), Gaps = 51/409 (12%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R+ LA Q
Sbjct: 63  LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQ 122

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 123 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 180

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D +G 
Sbjct: 181 PSLFVREQKSPSASVTVTLEPGRALD---EGQISAVVHLVSSAVAGLPPGNVTLVDQSGH 237

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  
Sbjct: 238 LLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT 297

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQP----ESAVTVE------- 309
           E  Y P+    ++   S+    SE              ++QP    E+ +          
Sbjct: 298 EEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNA 357

Query: 310 QNMPHVS---DRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG 366
           QN P  S   +     PRS +    + E SNYE++     T  +   +ERLS+AVVVN  
Sbjct: 358 QNTPQTSTSTNSNSAGPRSTQ----RNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYK 413

Query: 367 RLTE--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
            L +   L  +ADQ K      +I  +   A G + +RGDT+ + +  F
Sbjct: 414 TLADGKPLPLTADQMK------QIEDLTREAMGFSDKRGDTLNVVNSPF 456


>gi|269836582|ref|YP_003318810.1| flagellar M-ring protein FliF [Sphaerobacter thermophilus DSM
           20745]
 gi|269785845|gb|ACZ37988.1| flagellar M-ring protein FliF [Sphaerobacter thermophilus DSM
           20745]
          Length = 535

 Score =  158 bits (399), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 154/556 (27%), Positives = 259/556 (46%), Gaps = 65/556 (11%)

Query: 21  RILILASVI--LVPIMLFMAARFFVNSPH-YDNLYVKLEVSDVNRISVALSEANIDFRIS 77
           R+ ++A VI  ++ + L +A R     P  Y   +  L   D   I   L    I + +S
Sbjct: 21  RVAVIAVVITAVMALGLLIATR----PPQRYGIAFSGLSSEDAAAIVENLRAQGIPYELS 76

Query: 78  DNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEG 137
            +G +I VP+  V   R+  A+QGLP   S+ G+ELFDK +S GLT F Q +   RA+EG
Sbjct: 77  SDGGTIRVPADQVAAVRLDAASQGLPRGGSD-GFELFDK-SSLGLTDFTQRVNYQRAIEG 134

Query: 138 EIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLV 195
           E+ RTI  I  + AARVHIV+P+   F +     TA+V+++  +      A+   I HLV
Sbjct: 135 ELERTIAKIDAVEAARVHIVIPEESLFIEEQQPTTAAVVLKLKSGRQLTEAQIRGITHLV 194

Query: 196 AAAVPNLDMGDVTVLDSTG-KLLTANEMERNILG--KSLSIVQAIQHEIEMNINKALAAF 252
           + AVPNL   ++TV+D+TG  + +  +      G  +   + QA +  +E  +   +   
Sbjct: 195 SGAVPNLQPENLTVIDNTGNPIWSGPDGGSQFAGLDERFRLQQAYEQNLERQLQALVNPI 254

Query: 253 LGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNM 312
            G  +    V A LN D +  +  +Y PD  ++  +R S+  +   TS     VT    +
Sbjct: 255 AGPGHAVVRVSATLNWDERSSQSEIYSPDG-LQPQVR-SQQEREQRTS---GTVTETGGV 309

Query: 313 PHVSDR-----KVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGR 367
           P V +      + P   S   +  +E  +NYE++ +         +++RLS+AV++    
Sbjct: 310 PGVDENVQTFPETPGAGSQSESSSREVTTNYELSRRIEEVVQAPGQVQRLSVAVML---- 365

Query: 368 LTEVLGRSADQGKIDSYLA-EINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQV 426
                    D  ++D  +A EI  ++SAA G+  +RGDTIT+T++ F  + + N   +  
Sbjct: 366 ---------DGSQVDPAVAQEIQDVISAAAGLVPQRGDTITVTAVPF--SDVGNRELIPD 414

Query: 427 SFMDILSRHFATVINALVFLVGTLLVTFLGLHALRR-LHNIDDAKK-----GEVGGKSIL 480
               IL   +A  + AL  L G + +  + L+  RR L   +DA +       VGG ++ 
Sbjct: 415 GGTPIL--EYA--LTALKVL-GLIAIPLVALYFARRVLVKPEDAGELTPALATVGGPAVT 469

Query: 481 SPPPISSAVTTGLMP---NDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEI 537
            PP          MP      I +  +   +     + QS         + L+++ +   
Sbjct: 470 EPP----------MPALATQRITISETPPQLEDEDPS-QSTDRGLPQLPAHLQVIELANT 518

Query: 538 NEERFAKILRKWARSE 553
           +  + A++LR W   E
Sbjct: 519 DPAQVAQLLRAWMSEE 534


>gi|197264219|ref|ZP_03164293.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197242474|gb|EDY25094.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
          Length = 579

 Score =  158 bits (399), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 122/409 (29%), Positives = 199/409 (48%), Gaps = 51/409 (12%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R+ LA Q
Sbjct: 63  LWAKAPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQ 122

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 123 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 180

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D +G 
Sbjct: 181 PSLFVREQKSPSASVTVTLEPGRALD---EGQISAVVHLVSSAVAGLPPGNVTLVDQSGH 237

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  
Sbjct: 238 LLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT 297

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQP----ESAVTVE------- 309
           E  Y P+    ++   S+    SE              ++QP    E+ +          
Sbjct: 298 EEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNA 357

Query: 310 QNMPHVS---DRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG 366
           QN P  S   +     PRS +    + E SNYE++     T  +   +ERLS+AVVVN  
Sbjct: 358 QNTPQTSTSTNSNSAGPRSTQ----RNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYK 413

Query: 367 RLTE--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
            L +   L  +ADQ K      +I  +   A G + +RGDT+ + +  F
Sbjct: 414 TLADGKPLPLTADQMK------QIEDLTREAMGFSDKRGDTLNVVNSPF 456


>gi|326622865|gb|EGE29210.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 531

 Score =  158 bits (399), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 127/430 (29%), Positives = 208/430 (48%), Gaps = 52/430 (12%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R+ LA Q
Sbjct: 15  LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQ 74

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 75  GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 132

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D +G 
Sbjct: 133 PSLFVREQKSPSASVTVTLEPGRALDEG---QISAVVHLVSSAVAGLPPGNVTLVDQSGH 189

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  
Sbjct: 190 LLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT 249

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQP----ESAVTVE------- 309
           E  Y P+    ++   S+    SE              ++QP    E+ +          
Sbjct: 250 EEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNA 309

Query: 310 QNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLT 369
           QN P  S           NT ++ E SNYE++     T  +   +ERLS+AVVVN   L 
Sbjct: 310 QNTPQTSTSTNSNSAGPRNT-QRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLA 368

Query: 370 E--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG----- 422
           +   L  +ADQ      + +I  +   A G + +RGDT+ + +  F  + + N+G     
Sbjct: 369 DGKPLPLTADQ------MKQIEDLTREAMGFSDKRGDTLNVVNSPF--SAVDNTGGELPF 420

Query: 423 TVQVSFMDIL 432
             Q SF+D L
Sbjct: 421 WQQQSFIDQL 430


>gi|17548611|ref|NP_521951.1| flagellar M-ring transmembrane protein [Ralstonia solanacearum
           GMI1000]
 gi|17430859|emb|CAD17541.1| probable flagellar m-ring transmembrane protein [Ralstonia
           solanacearum GMI1000]
          Length = 611

 Score =  158 bits (399), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 138/483 (28%), Positives = 230/483 (47%), Gaps = 77/483 (15%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  +  SD   I  AL + N+ +R +D GS+I VP + V +AR+ LAAQ
Sbjct: 66  LWSRAPSYRVLYSNVADSDGGAIIAALQQMNVPYRFADGGSAIMVPEANVHEARLKLAAQ 125

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP     +G+EL +    FG + F++++   RALEGE+ARTIQ++  + +ARVH+ +  
Sbjct: 126 GLPKGGL-AGFELMEN-QKFGTSQFVEQVNYQRALEGELARTIQAMQEVQSARVHLALSK 183

Query: 161 MGSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +   +P+ASV+++ + P         +AI HL+A++VP+L + +VTV+D +G+LL
Sbjct: 184 PSVFVREQVKPSASVLLK-LYPGRMLDRSQVQAIGHLLASSVPDLPLANVTVVDQSGRLL 242

Query: 218 TANEMERNILG---KSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMD-TQQI 273
           +A+  + N  G     L+ V+ I+      I   L   +G DN R+ V A +++D T+Q+
Sbjct: 243 SAS-FQDNASGLDPTQLNYVRDIEQGYIKRIEAILGPVVGEDNVRAQVTANVDLDNTEQM 301

Query: 274 REIV---YDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLE--- 327
            E      DP +   RS   S+  Q    +Q         N P  + R +P   +     
Sbjct: 302 AETYRPNQDPANGAVRSTHTSESTQNKAGAQ-GGVPGALSNQPPTAPRMLPTAPAPAAQQ 360

Query: 328 ------------------------------NTDKKEEQSNYEINTKSIATTHDNYKLERL 357
                                          +  ++   NYE++     T      + RL
Sbjct: 361 AAAGQNGQNGQNGQQQGAAAGTGQAAANTAESSARDTTINYEVDKTVRRTRAAVGTVRRL 420

Query: 358 SIAVVVN---KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFL 414
           S+AVVVN    G+  + L         D+ + ++N +V  A G +++RGD++ + +  F 
Sbjct: 421 SVAVVVNYRADGKTWKPLS--------DAEMTKLNALVKDAVGYDAKRGDSVNVVNSQF- 471

Query: 415 ENQLFNSGTVQVSFMDI-LSR-----HFATVINALVF---LVGTLLVTFLGLHALRRLHN 465
                 SGT+  S  D+ L +     H+A  I A  +    +G L++ F  +  L R  N
Sbjct: 472 ------SGTLPTSKDDLPLWKQPEMIHYA--IQAAKYGALAIGFLILVFAVIRPLIRSMN 523

Query: 466 IDD 468
             D
Sbjct: 524 KKD 526


>gi|146278778|ref|YP_001168937.1| flagellar MS-ring protein [Rhodobacter sphaeroides ATCC 17025]
 gi|145557019|gb|ABP71632.1| flagellar M-ring protein FliF [Rhodobacter sphaeroides ATCC 17025]
          Length = 543

 Score =  158 bits (399), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 120/399 (30%), Positives = 206/399 (51%), Gaps = 18/399 (4%)

Query: 18  GRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRIS 77
           GR R +++ +   + + +F  ++F  N P    LY  L+ +    +  AL    + + + 
Sbjct: 26  GRRRAIVVGATAAMFLAIFGLSQF-ANKPRMALLYAGLQGAVAGEVVAALEAQGVAYEV- 83

Query: 78  DNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEG 137
             G SI V +S   + R+ LA +GLP++ + +GYEL D ++ FG TS M +   +RA EG
Sbjct: 84  -QGDSIHVDASRRDELRMKLAGEGLPATGT-AGYELLDGLSGFGTTSQMFDAAYLRAKEG 141

Query: 138 EIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV-YKSAEAIRHLVA 196
           E+ARTI +   + AARVHI  P      +   RPTASV +     ++  + A A +HL+A
Sbjct: 142 ELARTILASPQVKAARVHIA-PAAAQLFQRERRPTASVTVTTSGGNLTMEQARAFKHLIA 200

Query: 197 AAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVD 256
           +AV  +   DV+V+D+ G L+ A +    I G + +       E+  N+ + L A +G  
Sbjct: 201 SAVAGMQPEDVSVIDTVGGLIRAGDTGDGIAGTAGTRA----AELRRNVERLLEARVGPG 256

Query: 257 NFRSAVVAELNMDT--QQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPH 314
             R+ V   L+++T  + I E  +DP  +V  S  L +  + S ++QP   VTV  N+P 
Sbjct: 257 --RAVVEVSLDVETASETIVEKTFDPKGRVPISSELQE--KTSSSTQPAPDVTVASNLPE 312

Query: 315 VSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGR 374
                    +S  N+ +  E +N+E++            + RL++AV+V+  R+    G+
Sbjct: 313 GDAAGGSAGKS--NSSETRETTNFEVSQTQRELVRQPGTVRRLTVAVLVDGVRMAGEDGQ 370

Query: 375 SADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
              Q + +  LA + ++V AA G++  RGD +T+ S+ F
Sbjct: 371 LTWQPRPEEELAVLRELVGAAVGLDESRGDRLTLRSLIF 409


>gi|317492408|ref|ZP_07950837.1| flagellar M-ring protein FliF [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316919747|gb|EFV41077.1| flagellar M-ring protein FliF [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 573

 Score =  157 bits (398), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 151/556 (27%), Positives = 261/556 (46%), Gaps = 79/556 (14%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  SP Y  LY  +   D   I   L++ NI +R +DNG+++ +P+  V + R+ LA QG
Sbjct: 52  WAKSPDYRVLYSNISDRDGGAIVTQLTQMNIPYRFADNGTALLIPADKVHETRLRLAQQG 111

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   +  G+EL D+   FG++ F ++I   RALEGE++RTI+++  +  ARVH+ +P  
Sbjct: 112 LPKGGA-VGFELLDQ-EKFGISQFSEQINYQRALEGELSRTIETLGPVQTARVHLALPKP 169

Query: 162 GSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKL 216
             F +   +P+ASV +     RA++        AI ++V+++V  L  G+VTV+D  G L
Sbjct: 170 SLFVREQKQPSASVTLNLQPGRALD---EGQINAIVYMVSSSVAGLPAGNVTVVDQGGHL 226

Query: 217 LTANE-MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           LT ++   R++    L     ++  I+  I   L   +G  N  + V A+++   ++  +
Sbjct: 227 LTQSDGTGRDLNATQLKYANEVESRIQRRIEAILQPMVGNGNVHAQVTAQIDNAVREQTD 286

Query: 276 IVYDPDSKVERSI--------------RLSKDAQRSETSQPESAVTVEQNMP-------- 313
             Y P+    ++               +LS     + T+QP  A T     P        
Sbjct: 287 EEYKPNQAPNQAAVRSQQLSDSSQSGGQLSGGVPGALTNQPAPAATGNITNPPQAGGANA 346

Query: 314 HVSDRKVPLPRSLENTD---------KKEEQSNYEINTKSIATTHDNYKLERLSIAVVVN 364
           + ++ + P   +++            +++E  NYE++     T      ++RLS+AVVVN
Sbjct: 347 NTANAQRPASSTIDTNGRRSSSASNARRDETINYEVDRTIRHTQQKAGNVDRLSVAVVVN 406

Query: 365 KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTV 424
               T   G+S         L ++  +V  A G ++ RGDT+ + +  F  +    SG V
Sbjct: 407 Y--TTNASGKSIP--LTPQQLEQVTALVREAMGFSATRGDTLNVVNTPFTTS-AEESGDV 461

Query: 425 ----QVSFMDI---LSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGK 477
               Q SF D+   L R+   +I  + F++   LV  L L+  ++L N   A++ E    
Sbjct: 462 PFWQQSSFFDLLMTLGRYLLVLI--VAFILWRKLVKPL-LN--KQLANAQPARRVE---- 512

Query: 478 SILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEI 537
               P PI   VTT + P        SN++I  + R  Q R     ++Q   R+  M E 
Sbjct: 513 ----PTPI---VTTPVQP-----AKPSNEEI-QNRRKSQQRA---TAEQQAQRVRDMAEQ 556

Query: 538 NEERFAKILRKWARSE 553
           +    A ++R+W  +E
Sbjct: 557 DPRVVALVIRQWMSNE 572


>gi|238912458|ref|ZP_04656295.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
          Length = 560

 Score =  157 bits (398), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 122/409 (29%), Positives = 199/409 (48%), Gaps = 51/409 (12%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R+ LA Q
Sbjct: 44  LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQ 103

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 104 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 161

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D +G 
Sbjct: 162 PSLFVREQKSPSASVTVTLEPGRALD---EGQISAVVHLVSSAVAGLPPGNVTLVDQSGH 218

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  
Sbjct: 219 LLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT 278

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQP----ESAVTVE------- 309
           E  Y P+    ++   S+    SE              ++QP    E+ +          
Sbjct: 279 EEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNA 338

Query: 310 QNMPHVS---DRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG 366
           QN P  S   +     PRS +    + E SNYE++     T  +   +ERLS+AVVVN  
Sbjct: 339 QNTPQTSTSTNSNNAGPRSTQ----RNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYK 394

Query: 367 RLTE--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
            L +   L  +ADQ K      +I  +   A G + +RGDT+ + +  F
Sbjct: 395 TLADGKPLPLTADQMK------QIEDLTREAMGFSDKRGDTLNVVNSPF 437


>gi|213419965|ref|ZP_03353031.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
          Length = 551

 Score =  157 bits (398), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 128/430 (29%), Positives = 208/430 (48%), Gaps = 52/430 (12%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R+ LA Q
Sbjct: 44  LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQ 103

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 104 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 161

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D +G 
Sbjct: 162 PSLFVREQKSPSASVTVTLEPGRALD---EGQISAVVHLVSSAVAGLPPGNVTLVDQSGH 218

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  
Sbjct: 219 LLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT 278

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQP----ESAVTVE------- 309
           E  Y P+    ++   S+    SE              ++QP    E+ +          
Sbjct: 279 EEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNA 338

Query: 310 QNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLT 369
           QN P  S           NT ++ E SNYE++     T  +   +ERLS+AVVVN   L 
Sbjct: 339 QNTPQTSTSTNSNNAGPRNT-QRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLA 397

Query: 370 E--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG----- 422
           +   L  +ADQ K      +I  +   A G + +RGDT+ + +  F  + + N+G     
Sbjct: 398 DGKPLPLTADQMK------QIEDLTREAMGFSDKRGDTLNVVNSPF--SAVDNTGGELPF 449

Query: 423 TVQVSFMDIL 432
             Q SF+D L
Sbjct: 450 WQQQSFIDQL 459


>gi|213053157|ref|ZP_03346035.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|289829461|ref|ZP_06547073.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
          Length = 531

 Score =  157 bits (398), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 127/430 (29%), Positives = 208/430 (48%), Gaps = 52/430 (12%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R+ LA Q
Sbjct: 15  LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQ 74

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 75  GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 132

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D +G 
Sbjct: 133 PSLFVREQKSPSASVTVTLEPGRALDEG---QISAVVHLVSSAVAGLPPGNVTLVDQSGH 189

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  
Sbjct: 190 LLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT 249

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQP----ESAVTVE------- 309
           E  Y P+    ++   S+    SE              ++QP    E+ +          
Sbjct: 250 EEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNA 309

Query: 310 QNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLT 369
           QN P  S           NT ++ E SNYE++     T  +   +ERLS+AVVVN   L 
Sbjct: 310 QNTPQTSTSTNSNNAGPRNT-QRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLA 368

Query: 370 E--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG----- 422
           +   L  +ADQ      + +I  +   A G + +RGDT+ + +  F  + + N+G     
Sbjct: 369 DGKPLPLTADQ------MKQIEDLTREAMGFSDKRGDTLNVVNSPF--SAVDNTGGELPF 420

Query: 423 TVQVSFMDIL 432
             Q SF+D L
Sbjct: 421 WQQQSFIDQL 430


>gi|197249147|ref|YP_002146054.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197212850|gb|ACH50247.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
          Length = 579

 Score =  157 bits (398), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 128/430 (29%), Positives = 208/430 (48%), Gaps = 52/430 (12%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R+ LA Q
Sbjct: 63  LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQ 122

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 123 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 180

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D +G 
Sbjct: 181 PSLFVREQKSPSASVTVTLEPGRALD---EGQISAVVHLVSSAVAGLPPGNVTLVDQSGH 237

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  
Sbjct: 238 LLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT 297

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQP----ESAVTVE------- 309
           E  Y P+    ++   S+    SE              ++QP    E+ +          
Sbjct: 298 EEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNA 357

Query: 310 QNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLT 369
           QN P  S           NT ++ E SNYE++     T  +   +ERLS+AVVVN   L 
Sbjct: 358 QNTPQTSTSTNSNNAGPRNT-QRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLA 416

Query: 370 E--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG----- 422
           +   L  +ADQ K      +I  +   A G + +RGDT+ + +  F  + + N+G     
Sbjct: 417 DGKPLPLTADQMK------QIEDLTREAMGFSDKRGDTLNVVNSPF--SAVDNTGGELPF 468

Query: 423 TVQVSFMDIL 432
             Q SF+D L
Sbjct: 469 WQQQSFIDQL 478


>gi|120613031|ref|YP_972709.1| flagellar M-ring protein FliF [Acidovorax citrulli AAC00-1]
 gi|120591495|gb|ABM34935.1| flagellar M-ring protein FliF [Acidovorax citrulli AAC00-1]
          Length = 566

 Score =  157 bits (398), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 118/393 (30%), Positives = 194/393 (49%), Gaps = 28/393 (7%)

Query: 46  PHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSS 105
           P Y  L+  L   D   I   LS  N+ ++ S+ G +I VP+  V   R+ LA QGLP  
Sbjct: 56  PDYKVLFSNLSDKDGGAIVAQLSTMNVPYKYSEGGGAILVPAERVHDVRLRLATQGLPKG 115

Query: 106 SSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFR 165
           S  +G+EL +  N FG+T F + +   R LEGE+ R+IQ++S + +ARVH+ +P+   F 
Sbjct: 116 SV-TGFELME-TNRFGVTQFQERLNFQRGLEGELTRSIQALSSVQSARVHLALPNQNGFF 173

Query: 166 KIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE- 221
           +   +P+ASV++ ++ P  +        I HLVA++VP +    V+VLD TGKLL+ +  
Sbjct: 174 REQQKPSASVLL-SLYPGRFLDRTQLAGIVHLVASSVPEMSPSAVSVLDDTGKLLSQSPD 232

Query: 222 --MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNM----DTQQIRE 275
                 I  + LS VQ I+ +    I   L   +G +N ++ V AE++      T +   
Sbjct: 233 TAAGSAIDAQQLSYVQQIEQQYTRRILDILEPVVGKNNVKAQVTAEVDFSQSEQTSEQHR 292

Query: 276 IVYDPDSKVERSIRLSKDAQRSETSQPESAV--TVEQNMPHVSDRKV----PLPRSLENT 329
               PDS   RS ++ + +  ++ +QP + V        P  S   +    P P +    
Sbjct: 293 PNQTPDSSAVRSQQVVESSGGTQGNQPPAGVPGAASNQPPQPSTAPINGANPAPTAGNGQ 352

Query: 330 D------KKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGK--I 381
                  K+E  +NYE++     T   +  ++R+S AVVVN   + +  G+ A Q K   
Sbjct: 353 QGQAAGSKRESITNYEVDKTVRVTRAGSGAIKRVSAAVVVNYQAIADAAGK-APQAKAFT 411

Query: 382 DSYLAEINKIVSAATGINSRRGDTITITSMDFL 414
              + ++  +V    G +  RGD++ I +  FL
Sbjct: 412 PEQIEQMTALVRETIGYSKDRGDSVNIMNTQFL 444


>gi|161613462|ref|YP_001587427.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|161362826|gb|ABX66594.1| hypothetical protein SPAB_01179 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 531

 Score =  157 bits (398), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 127/430 (29%), Positives = 208/430 (48%), Gaps = 52/430 (12%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R+ LA Q
Sbjct: 15  LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQ 74

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 75  GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 132

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D +G 
Sbjct: 133 PSLFVREQKSPSASVTVTLEPGRALDEG---QISAVVHLVSSAVAGLPPGNVTLVDQSGH 189

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  
Sbjct: 190 LLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT 249

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQP----ESAVTVE------- 309
           E  Y P+    ++   S+    SE              ++QP    E+ +          
Sbjct: 250 EEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNA 309

Query: 310 QNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLT 369
           QN P  S           NT ++ E SNYE++     T  +   +ERLS+AVVVN   L 
Sbjct: 310 QNTPQTSTSTNSNNAGPRNT-QRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLA 368

Query: 370 E--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG----- 422
           +   L  +ADQ      + +I  +   A G + +RGDT+ + +  F  + + N+G     
Sbjct: 369 DGKPLPLTADQ------MKQIEDLTREAMGFSDKRGDTLNVVNSPF--SAVDNTGGELPF 420

Query: 423 TVQVSFMDIL 432
             Q SF+D L
Sbjct: 421 WQQQSFIDQL 430


>gi|283785708|ref|YP_003365573.1| flagellar M-ring protein [Citrobacter rodentium ICC168]
 gi|282949162|emb|CBG88770.1| flagellar M-ring protein [Citrobacter rodentium ICC168]
          Length = 560

 Score =  157 bits (398), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 127/427 (29%), Positives = 205/427 (48%), Gaps = 53/427 (12%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V I++ M    +  SP Y  L+  L   D   I   L++ NI +R ++   +
Sbjct: 28  LIIAGSAAVAIIVAMV--LWAKSPDYRTLFSNLSDQDGGAIVTQLTQMNIPYRFTEGSGA 85

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE+ART
Sbjct: 86  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELART 143

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAA 197
           I+++  +  ARVH+ MP    F +    P+ASV I     RA++        A+ HLV++
Sbjct: 144 IETLGPVRRARVHLAMPKPSLFVREQKSPSASVTINLEPGRALDEG---QISAVVHLVSS 200

Query: 198 AVPNLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVD 256
           AV  L  G+VT++D +G+LLT +N   R++    L     +++ I+  I   L+  +G  
Sbjct: 201 AVAGLPPGNVTLVDQSGRLLTQSNTSSRDLNDAQLKYASDVENRIQRRIESILSPIVGNG 260

Query: 257 NFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE--------------TSQP 302
           N  + V A+L+   ++  E  Y P+    ++   S+    SE              ++QP
Sbjct: 261 NVHAQVTAQLDFANKEQTEEQYRPNGDASQAALRSRQVNESEQIGSGLPGGVPGALSNQP 320

Query: 303 ESAVTVEQNMP--------------HVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATT 348
             A       P                S      PR   NT ++ E SNYE++     T 
Sbjct: 321 APANAAPITTPPANQQNAQNGQNAQQTSTNNAVGPR---NT-QRNETSNYEVDRTIRHTK 376

Query: 349 HDNYKLERLSIAVVVNKGRLTE--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTI 406
            +   ++RLS+AVVVN    ++   L  +ADQ K      +I  +   A G + +RGDT+
Sbjct: 377 MNVGDIQRLSVAVVVNYKTPSDGKPLPLTADQMK------QIENLTREAMGFSDKRGDTL 430

Query: 407 TITSMDF 413
            + +  F
Sbjct: 431 NVVNSPF 437


>gi|207856518|ref|YP_002243169.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|206708321|emb|CAR32624.1| flagellar basal-body M-ring protein [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
          Length = 560

 Score =  157 bits (398), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 121/406 (29%), Positives = 197/406 (48%), Gaps = 45/406 (11%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R+ LA Q
Sbjct: 44  LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQ 103

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 104 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 161

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D +G 
Sbjct: 162 PSLFVREQKSPSASVTVTLEPGRALDEG---QISAVVHLVSSAVAGLPPGNVTLVDQSGH 218

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  
Sbjct: 219 LLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT 278

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQP----ESAVTVE------- 309
           E  Y P+    ++   S+    SE              ++QP    E+ +          
Sbjct: 279 EEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNA 338

Query: 310 QNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLT 369
           QN P  S           NT ++ E SNYE++     T  +   +ERLS+AVVVN   L 
Sbjct: 339 QNTPQTSTSTNSNSAGPRNT-QRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLA 397

Query: 370 E--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           +   L  +ADQ K      +I  +   A G + +RGDT+ + +  F
Sbjct: 398 DGKPLPLTADQMK------QIEDLTREAMGFSDKRGDTLNVVNSPF 437


>gi|29141395|ref|NP_804737.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213646788|ref|ZP_03376841.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|29137022|gb|AAO68586.1| flagellar basal-body M-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
          Length = 560

 Score =  157 bits (398), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 128/430 (29%), Positives = 208/430 (48%), Gaps = 52/430 (12%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R+ LA Q
Sbjct: 44  LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQ 103

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 104 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 161

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D +G 
Sbjct: 162 PSLFVREQKSPSASVTVTLEPGRALDEG---QISAVVHLVSSAVAGLPPGNVTLVDQSGH 218

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  
Sbjct: 219 LLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT 278

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQP----ESAVTVE------- 309
           E  Y P+    ++   S+    SE              ++QP    E+ +          
Sbjct: 279 EEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNA 338

Query: 310 QNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLT 369
           QN P  S           NT ++ E SNYE++     T  +   +ERLS+AVVVN   L 
Sbjct: 339 QNTPQTSTSTNSNNAGPRNT-QRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLA 397

Query: 370 E--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG----- 422
           +   L  +ADQ K      +I  +   A G + +RGDT+ + +  F  + + N+G     
Sbjct: 398 DGKPLPLTADQMK------QIEDLTREAMGFSDKRGDTLNVVNSPF--SAVDNTGGELPF 449

Query: 423 TVQVSFMDIL 432
             Q SF+D L
Sbjct: 450 WQQQSFIDQL 459


>gi|268316357|ref|YP_003290076.1| flagellar M-ring protein FliF [Rhodothermus marinus DSM 4252]
 gi|262333891|gb|ACY47688.1| flagellar M-ring protein FliF [Rhodothermus marinus DSM 4252]
          Length = 533

 Score =  157 bits (398), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 126/418 (30%), Positives = 192/418 (45%), Gaps = 42/418 (10%)

Query: 3   ILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNR 62
           + +QL QF    + L   + L L +V +  I+L +   ++   P Y  L+  L  SD +R
Sbjct: 1   MFEQLKQFL---SRLSPGQRLALGAVTIGSILLLLGIAYWAGRPEYALLFGGLSPSDASR 57

Query: 63  ISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGL 122
           I   L E N+ +++ + G++I VP   V + R+  A +GL  S    GYELFD+ N+ G+
Sbjct: 58  IVETLQEENVPYQLKEGGTAIWVPRDRVYELRLRFAGEGL-VSDGPVGYELFDQ-NTLGM 115

Query: 123 TSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP 182
           T FMQ +   RALEGE+ARTI S+  +  A+VH+V+P+   FR+    P+ASV++   + 
Sbjct: 116 TDFMQRLNYKRALEGELARTIMSLQQVELAKVHLVLPERSPFRETQVAPSASVLLSLKSG 175

Query: 183 S--VYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT---ANEMERNILGKSLSIVQAI 237
           +    +  + I  LVA AV  LD  +VTVLD+ G LL+   A   E  +    L + QA+
Sbjct: 176 ARLTEEQIDGITALVAGAVEGLDPANVTVLDARGNLLSNPDAGNAELALSSTQLKLRQAL 235

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSK-VERSIRLSKDAQR 296
           +  +       L   LG  N    V A LN D       + DP+S  V    RL +    
Sbjct: 236 EAHLTEKGQSMLDRVLGPGNAIVRVSATLNFDQAVTERQLIDPESATVISEERLEEAGTG 295

Query: 297 SETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLER 356
            E S   S V                              NYE++        +   +E 
Sbjct: 296 GEGSSASSMV-----------------------------RNYELSRTVERIQQNGGDVEY 326

Query: 357 LSIAVVVNKGRLTEVL-GRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           L+++V++N+ R  E   G    +   +  L EI ++V  A G    RGD   I    F
Sbjct: 327 LTVSVILNQ-RFEEGPDGTPQPRPYTEDELREIEELVKNAVGFRPERGDRFAIHQTRF 383


>gi|161502909|ref|YP_001570021.1| flagellar MS-ring protein [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|160864256|gb|ABX20879.1| hypothetical protein SARI_00968 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 560

 Score =  157 bits (398), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 124/424 (29%), Positives = 204/424 (48%), Gaps = 47/424 (11%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V I++ M    +  +P Y  L+  L   D   I   L++ NI +R ++   +
Sbjct: 28  LIVAGSAAVAIIVAMV--LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGA 85

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE+ART
Sbjct: 86  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELART 143

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAA 197
           I+++  + +ARVH+ MP    F +    P+ASV +     RA++        A+ HLV++
Sbjct: 144 IETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEG---QISAVVHLVSS 200

Query: 198 AVPNLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVD 256
           AV  L  G+VT++D +G LLT +N   R++    L     ++  I+  I   L+  +G  
Sbjct: 201 AVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNG 260

Query: 257 NFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMP 313
           N  + V A+L+   ++  E  Y P+    ++   S+    SE      P        N P
Sbjct: 261 NVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQIGAGYPGGVPGALSNQP 320

Query: 314 HVSDRKVPL---PRSLENTD-------------------KKEEQSNYEINTKSIATTHDN 351
              + + P+   P + +N                     ++ E SNYE++     T  + 
Sbjct: 321 APPN-EAPIATPPGNQQNAQNTAQTSTSTNSNSTGPRNTQRNETSNYEVDRTIRHTKMNV 379

Query: 352 YKLERLSIAVVVNKGRLTE--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITIT 409
             +ERLS+AVVVN   L +   L  +ADQ K      +I  +   A G + +RGDT+ + 
Sbjct: 380 GDIERLSVAVVVNYKTLADGKPLPLTADQMK------QIEDLTREAMGFSDKRGDTLNVV 433

Query: 410 SMDF 413
           +  F
Sbjct: 434 NSPF 437


>gi|56413118|ref|YP_150193.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197362044|ref|YP_002141681.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|56127375|gb|AAV76881.1| flagellar basal-body M-ring protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197093521|emb|CAR58982.1| flagellar basal-body M-ring protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
          Length = 563

 Score =  157 bits (398), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 121/406 (29%), Positives = 197/406 (48%), Gaps = 45/406 (11%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R+ LA Q
Sbjct: 47  LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQ 106

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 107 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 164

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D +G 
Sbjct: 165 PSLFVREQKSPSASVTVTLEPGRALDEG---QISAVVHLVSSAVAGLPPGNVTLVDQSGH 221

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  
Sbjct: 222 LLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT 281

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQP----ESAVTVE------- 309
           E  Y P+    ++   S+    SE              ++QP    E+ +          
Sbjct: 282 EEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNA 341

Query: 310 QNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLT 369
           QN P  S           NT ++ E SNYE++     T  +   +ERLS+AVVVN   L 
Sbjct: 342 QNTPQTSTSTNSNNAGPRNT-QRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLA 400

Query: 370 E--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           +   L  +ADQ K      +I  +   A G + +RGDT+ + +  F
Sbjct: 401 DGKPLPLTADQMK------QIEDLTREAMGFSDKRGDTLNVVNSPF 440


>gi|254474533|ref|ZP_05087919.1| flagellar M-ring protein FliF [Ruegeria sp. R11]
 gi|214028776|gb|EEB69611.1| flagellar M-ring protein FliF [Ruegeria sp. R11]
          Length = 558

 Score =  157 bits (397), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 137/447 (30%), Positives = 221/447 (49%), Gaps = 24/447 (5%)

Query: 19  RTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISD 78
           R R++ + + ++V I+  +A     N+P    LY  LE      +  AL +    + +  
Sbjct: 14  RKRLIAVGATVIV-ILSVLAMSRVANTPTMQLLYAGLESGSAGDVVRALDQRGTQYEV-- 70

Query: 79  NGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGE 138
            G SI VP++   + R+ LA++GLP++    GYEL D ++ FG TS M +    RA EGE
Sbjct: 71  RGGSIYVPATERDELRMTLASEGLPANGGR-GYELLDSLSGFGTTSQMFDAAYWRAKEGE 129

Query: 139 IARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN-PSVYKSAEAIRHLVAA 197
           +ARTI +   +  ARVHI       F++  A PTASV +  +  P   + A AIR LV++
Sbjct: 130 LARTIVASPHVTQARVHIANTGSNPFQRT-AEPTASVSVVPMGSPITPQQANAIRFLVSS 188

Query: 198 AVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDN 257
           AV  L + +V V+D+ G L+ + E        +    QAI+      + + + A +G  N
Sbjct: 189 AVTGLSVDNVAVIDANGALIGSPEAAAAAGAGTDDRSQAIRE----RVMRLVEARVGHGN 244

Query: 258 FRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESA-VTVEQNMPHVS 316
               V  E   DT+ IRE   DP+S+V  S  +    +R+++SQ +S  VTV  N+P   
Sbjct: 245 AVVEVSVETVTDTESIREKRVDPESRVAISTDVE---ERADSSQNQSGEVTVASNIPD-- 299

Query: 317 DRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSA 376
                   S  +T    E+ NYEI+            ++RL++AV++N    T   G + 
Sbjct: 300 GDAASGDGSKASTSATRERVNYEISETEKEIIRGPGAIKRLTVAVLLNGVATTNAAGETV 359

Query: 377 DQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF--LENQLFNSGTVQVSFMDILSR 434
            + + +  L  + +++SAA G ++ RGD IT+ SM+   +E Q    GTV  S   IL  
Sbjct: 360 MEPRSEEELGALRELISAAVGFSADRGDVITLKSMEMPTIEPQ----GTVVSS--SILDN 413

Query: 435 HFATVINALVFLVGTLLVTFLGLHALR 461
            +   ++ +      L+   LGL  +R
Sbjct: 414 IYLDAMSLIQMAALALVTLILGLFVIR 440


>gi|259908758|ref|YP_002649114.1| flagellar MS-ring protein [Erwinia pyrifoliae Ep1/96]
 gi|224964380|emb|CAX55889.1| Flagellar basal-body M-ring protein [Erwinia pyrifoliae Ep1/96]
 gi|283478734|emb|CAY74650.1| Flagellar M-ring protein FliF [Erwinia pyrifoliae DSM 12163]
          Length = 569

 Score =  157 bits (397), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 143/554 (25%), Positives = 256/554 (46%), Gaps = 70/554 (12%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +   P Y  L+  L   D   I   L++ N+ ++  D G ++ VP++ V + R+ LA+Q
Sbjct: 46  LWAKQPDYRVLFSNLSNEDGGTIVTQLTQMNVPYKFDDQGGALLVPAAQVHELRLRLASQ 105

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL DK   FG++ F +++   RALEGE+ARTI ++  +  ARVH+ MP 
Sbjct: 106 GLPKGGA-VGFELLDK-EKFGISQFSEQVNYQRALEGELARTISTLGPVKDARVHLAMPK 163

Query: 161 MGSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +    P+ASV + A+ P          A+ H+V+++V  +  G+VTV+D  G+LL
Sbjct: 164 PTLFVREQKSPSASVTL-ALQPGRALDEGQINAVVHMVSSSVAGMPPGNVTVVDQAGRLL 222

Query: 218 TANEM-ERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI 276
           T N+   R++    L     ++   +  I   L   LG  N  + V A+++ + ++  + 
Sbjct: 223 TQNDPGGRDLNDTQLKYANDVETRYQQRIEAILGPILGNGNVHAQVTAQIDFNKREKTDE 282

Query: 277 VYDPDSKVERSIRLSKDAQRSETSQPESAVTVE---QNMPHVSDRKVPLP---------- 323
            Y P+S+ ++    S+    SE     SA  V     N P  ++     P          
Sbjct: 283 QYSPNSQPDQQAIRSRQTSNSEQLGGSSAGGVPGALSNQPAPANAAPVTPANNNANNANA 342

Query: 324 ----------------RSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGR 367
                           +++ +  + +  +NYE+N   + T  +  +++RLS+AVVVN   
Sbjct: 343 NANNGQPANNAANAAQKTVPSNTRSDNTTNYEVNRTILHTKMNVGEVQRLSVAVVVNY-- 400

Query: 368 LTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG- 422
                 R+   GK     D+ + +I  +   A G + +RGD++ + +  F +N    +  
Sbjct: 401 ------RADAAGKPIALKDAQIKQIENLTREAMGFSEQRGDSLNVVNSQFTDNSDLAAEL 454

Query: 423 --TVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL 480
               Q +F+D L   F      LV +V  +L   L    LRR    +  K  E       
Sbjct: 455 PFWKQPAFIDQL---FNAGRWLLVLIVAFILYRKLVSPQLRR--KAEQQKATEEAA---- 505

Query: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540
               I++A ++    ++ +A+ S ++D  +  R  Q R+++ V  Q   R+  M E +  
Sbjct: 506 ----INAARSS--TRDEGVAV-SLSKDELNQERKSQHRMSAEVLSQ---RIREMSENDPR 555

Query: 541 RFAKILRKWARSEI 554
             A ++R+W + E+
Sbjct: 556 VVALVIRQWMKDEL 569


>gi|205360167|ref|ZP_02835012.2| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205340693|gb|EDZ27457.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
          Length = 579

 Score =  157 bits (397), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 121/406 (29%), Positives = 197/406 (48%), Gaps = 45/406 (11%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R+ LA Q
Sbjct: 63  LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQ 122

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 123 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 180

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D +G 
Sbjct: 181 PSLFVREQKSPSASVTVTLEPGRALD---EGQISAVVHLVSSAVAGLPPGNVTLVDQSGH 237

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  
Sbjct: 238 LLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT 297

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQP----ESAVTVE------- 309
           E  Y P+    ++   S+    SE              ++QP    E+ +          
Sbjct: 298 EEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNA 357

Query: 310 QNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLT 369
           QN P  S           NT ++ E SNYE++     T  +   +ERLS+AVVVN   L 
Sbjct: 358 QNTPQTSTSNNSNNAGPRNT-QRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLA 416

Query: 370 E--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           +   L  +ADQ K      +I  +   A G + +RGDT+ + +  F
Sbjct: 417 DGKPLPLTADQMK------QIEDLTREAMGFSDKRGDTLNVVNSPF 456


>gi|238796932|ref|ZP_04640436.1| Flagellar M-ring protein [Yersinia mollaretii ATCC 43969]
 gi|238719192|gb|EEQ11004.1| Flagellar M-ring protein [Yersinia mollaretii ATCC 43969]
          Length = 563

 Score =  157 bits (397), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 124/464 (26%), Positives = 218/464 (46%), Gaps = 52/464 (11%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           ++L   +   + L +A   +  +P Y  LY  +   D   I   L++ N+ +R  D G +
Sbjct: 29  IVLLICVSAAVTLLIALLLWAKAPDYRVLYSNISDQDGGAIVAQLAQMNVPYRFEDRGGA 88

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP   V +AR+ LA  GLP   S  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 89  IMVPVDKVYEARLKLAQLGLPKGGS-VGFELLDQ-EKFGISQFSEQVNFQRALEGELSRT 146

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I+++  +  ARVH+ +P    F +     +ASV +   N    +S +  AI +L+A+AVP
Sbjct: 147 IETLGPVNGARVHLAIPKPSMFVREQKPSSASVTVNLSNGRSLESGQVSAISYLIASAVP 206

Query: 201 NLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRS 260
            L+  +VT++D  G LLT     + +    L     ++ + +  I   LA  +G +N ++
Sbjct: 207 GLNADNVTIVDQGGHLLT-QRGGQEVQTSQLKFTSEVEADFQQRIQSILAPIVGRNNVKA 265

Query: 261 AVVAELNMDTQQIREIVYDPDSKVER-SIRLSKDAQRSE--------------TSQPESA 305
            V A+L+  T +     + P++  ++ SIR S+ +  SE              ++QP + 
Sbjct: 266 QVTAQLDFTTHEQTAEQFQPNTASDKMSIR-SRQSSDSEQGSKNGVGGVPGALSNQPPTP 324

Query: 306 VTVEQNMP------------------HVSDRKVPLPRSLENTDKKEEQSNYEINTKSIAT 347
            T     P                    +    P+P +    ++++  +NYE++      
Sbjct: 325 ATAPITQPVGAKEATPTTPTTPGAKGAATTVATPVPFN----NRRDNTTNYELDRTLTHI 380

Query: 348 THDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTIT 407
                 +ERLS+AVVVN     E +  +  + ++D    +IN +V  A G +  RGDT+ 
Sbjct: 381 KRSAGSIERLSVAVVVNYLPAKEGVPAALSKAQMD----QINSLVKEAVGFSVERGDTVN 436

Query: 408 ITSMDF--LENQLFNSGTVQVSFMDIL---SRHFATVINALVFL 446
           I +  F  +E ++      Q  F+++L    R+    I A  F 
Sbjct: 437 IVNSLFSDVEEEVAPPFWKQAGFINLLMAAGRYLLVAIVAWFFW 480


>gi|237731986|ref|ZP_04562467.1| flagellar MS-ring protein [Citrobacter sp. 30_2]
 gi|226907525|gb|EEH93443.1| flagellar MS-ring protein [Citrobacter sp. 30_2]
          Length = 557

 Score =  157 bits (397), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 115/402 (28%), Positives = 197/402 (49%), Gaps = 40/402 (9%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ N+ +R ++   +I VP+  V + R+ LA Q
Sbjct: 44  LWAKAPDYRTLFSNLSDQDGGAIVTQLTQMNVPYRFTEGSGAIEVPADKVHELRLRLAQQ 103

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  +  ARVH+ MP 
Sbjct: 104 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKRARVHLAMPK 161

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D  G 
Sbjct: 162 PSLFVREQKAPSASVTVNLEPGRALDEG---QISAVTHLVSSAVAGLPPGNVTLVDQAGH 218

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  ++  I   L+  +G  N  + V A+L+   ++  
Sbjct: 219 LLTQSNTSSRDLNDAQLKYASDVEGRVQRRIESILSPIVGNGNVHAQVTAQLDFANKEQT 278

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQPESAVTVEQNMPHVSDRKV 320
           E  Y P+    +++  S+    SE              ++QP  A T     P  + +  
Sbjct: 279 EEQYRPNGDDSQAVLRSRQLNVSEQIGSGAPGGVPGALSNQPAPANTAPIANPPANQQNA 338

Query: 321 PLPRSLENTD-------KKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTE--V 371
              ++  N++       ++ E SNYE++     T  +   ++RLS+AVVVN   L +   
Sbjct: 339 QTTQTANNSNNAGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKP 398

Query: 372 LGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           L  +ADQ K      +I  +   A G + +RGDT+ + +  F
Sbjct: 399 LPLTADQMK------QIEDLTREAMGFSDKRGDTLNVVNSPF 434


>gi|254466479|ref|ZP_05079890.1| flagellar M-ring protein FliF [Rhodobacterales bacterium Y4I]
 gi|206687387|gb|EDZ47869.1| flagellar M-ring protein FliF [Rhodobacterales bacterium Y4I]
          Length = 556

 Score =  157 bits (397), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 142/448 (31%), Positives = 222/448 (49%), Gaps = 26/448 (5%)

Query: 19  RTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISD 78
           R R++ + + +++ I+  +A     + P    LY  LE      +  AL +    + +  
Sbjct: 14  RKRLIAVGATVIM-ILSVIAMSHVASKPSMTLLYAGLESGSAGDVVRALEQRGTQYEV-- 70

Query: 79  NGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGE 138
            GSSI VPS+   + R+ LA++GLP++    GYEL D ++ FG TS M +    RA EGE
Sbjct: 71  RGSSIYVPSTQRDELRMTLASEGLPANGGK-GYELLDSLSGFGTTSQMFDAAYWRAKEGE 129

Query: 139 IARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN-PSVYKSAEAIRHLVAA 197
           +ARTI +   +  ARVHI    +  F++    PTASV I  +  P     A AIR LV++
Sbjct: 130 LARTIVASPHVSQARVHIANTGLNPFQRT-VEPTASVSIVPMGSPITPAQANAIRFLVSS 188

Query: 198 AVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDN 257
           AV  L + +V V+D+ G L+ +++        +    Q I+      + + + A +G  N
Sbjct: 189 AVTGLAVENVAVIDANGALIGSSDATAAAGAGTDDRSQTIRE----RVMRLVEARVGQGN 244

Query: 258 FRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSD 317
               V  E   DT+ IRE + DP S+V  S  + + A  S     E  VTV  N+P    
Sbjct: 245 AVVEVSVETVTDTESIREKLIDPKSRVAVSTDVEERADSSTNQAGE--VTVASNIPD--G 300

Query: 318 RKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSAD 377
                  S  NT    E+ NYEI+            ++RL++AV++N   +T   G +  
Sbjct: 301 DAASGQGSKANTSATRERINYEISETEKEILRGPGAIKRLTVAVLINGTAVTNDAGETVF 360

Query: 378 QGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF--LENQLFNSGTV-QVSFMDILSR 434
           Q + +  LA + +++SAA G ++ RGD IT+ SM+   +E Q    GTV   SF D L  
Sbjct: 361 QPRPEDELAAMRELISAAVGFDAERGDVITLKSMELPAVEPQ----GTVATASFFDNL-- 414

Query: 435 HFATVINALVFLVGTLLVTF-LGLHALR 461
           +F  +  +LV +    LV+  LGL  +R
Sbjct: 415 YFDAM--SLVQIGALALVSLILGLFVVR 440


>gi|320085412|emb|CBY95193.1| Flagellar M-ring protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
          Length = 560

 Score =  157 bits (397), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 121/406 (29%), Positives = 197/406 (48%), Gaps = 45/406 (11%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R+ LA Q
Sbjct: 44  LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQ 103

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 104 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 161

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D +G 
Sbjct: 162 PSLFVREQKSPSASVTVTLEPGRALDEG---QISAVVHLVSSAVAGLPPGNVTLVDQSGH 218

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  
Sbjct: 219 LLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT 278

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQP----ESAVTVE------- 309
           E  Y P+    ++   S+    SE              ++QP    E+ +          
Sbjct: 279 EEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNA 338

Query: 310 QNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLT 369
           QN P  S           NT ++ E SNYE++     T  +   +ERLS+AVVVN   L 
Sbjct: 339 QNTPQTSTSNNSNNAGPRNT-QRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLA 397

Query: 370 E--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           +   L  +ADQ K      +I  +   A G + +RGDT+ + +  F
Sbjct: 398 DGKPLPLTADQMK------QIEDLTREAMGFSDKRGDTLNVVNSPF 437


>gi|78485783|ref|YP_391708.1| flagellar M-ring protein FliF [Thiomicrospira crunogena XCL-2]
 gi|78364069|gb|ABB42034.1| Flagellar M-ring protein FliF [Thiomicrospira crunogena XCL-2]
          Length = 561

 Score =  157 bits (397), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 124/463 (26%), Positives = 226/463 (48%), Gaps = 33/463 (7%)

Query: 10  FFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSE 69
             K+ TSL   + + L   +   + L +    +  S  Y  L+  ++  D+N +   L +
Sbjct: 22  LLKNLTSLSVAKQVSLVIALAASVALAIGIILWSQSASYTLLFGSMDAKDMNEVIQTLDQ 81

Query: 70  ANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEI 129
            N+ ++I  N  +I VP+  V   R+ LAAQG P  +  +GY++ D    FG++ F +  
Sbjct: 82  ENVPYKIEQNSGAILVPNEQVHSLRLKLAAQGYPKQAP-TGYQILDIDQGFGISQFKETT 140

Query: 130 TRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI-----RAINPSV 184
              RALEGE+A+++ SI+ + +ARV + MP    F +    PTASV +     RA+N   
Sbjct: 141 RYQRALEGELAKSVSSINAVKSARVMLGMPKRSVFVRKQQEPTASVTVKLYPGRALN--- 197

Query: 185 YKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEME--RNILGKSLSIVQAIQHEIE 242
            +   AI +LV++++PN+    VTV+D  G LLT++      N+  K L   + ++  + 
Sbjct: 198 EEQVSAIVYLVSSSIPNMKPKGVTVVDQQGNLLTSDSHSGIMNVSLKQLGYTRQVEDTLS 257

Query: 243 MNINKALAAFLGVDN-FRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE--- 298
             I + L    G D+  R+ V AEL+   Q+     Y+PD +  RS +  K+  R+E   
Sbjct: 258 QRIIRLLTPVAGGDHKVRAQVTAELDFTQQEQTRENYEPDPEAIRSEQEIKEINRNEGPM 317

Query: 299 ------TSQPESA-VTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDN 351
                 T+QP  A +  E+     +D       +L+N+ K+++  NYE++       +  
Sbjct: 318 GIPGALTNQPPRAGIAPEEGYKPEND------PNLKNS-KEKKTKNYELDRTVSHIKNSV 370

Query: 352 YKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSM 411
             + RLS+AVV++     +  G +      +  L    ++VS A G++  RGDT++I + 
Sbjct: 371 GSIRRLSVAVVLDDKLTVDDNGDTVRTPLTEDELQRYRRLVSDAVGLDEARGDTLSIVNA 430

Query: 412 DFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTF 454
            F++ +  +    ++         F T++  ++  +  L++ F
Sbjct: 431 SFIQEKQEDFAGPEI----WEEPWFWTLVKQILAGLAVLIIIF 469


>gi|296103558|ref|YP_003613704.1| flagellar MS-ring protein [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295058017|gb|ADF62755.1| flagellar MS-ring protein [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 559

 Score =  157 bits (397), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 144/555 (25%), Positives = 253/555 (45%), Gaps = 79/555 (14%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  SP Y  LY  L   D   I   L++ NI +R +DNG ++ VP+  V + R+ LA Q
Sbjct: 44  LWAKSPDYRTLYSNLSDQDGGAIVTQLTQMNIPYRFADNGGALEVPADKVHELRLRLAQQ 103

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 104 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 161

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D +G 
Sbjct: 162 PSLFVREQKSPSASVTVNLEPGRALDEG---QISAVTHLVSSAVAGLPPGNVTLVDQSGH 218

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  ++  I   L   +G  N  + V A+++   ++  
Sbjct: 219 LLTQSNTAGRDLNDAQLKYAADVEARLQRRIEAILGPVVGNSNVHAQVTAQIDFSNKEQT 278

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQPESAVTVEQNMPHVSDRKV 320
           E  Y P+    +++  S+    +E              ++QP  A     + P  + +  
Sbjct: 279 EEQYRPNGDPAQAVMRSRQVNENEQVGGAYPGGVPGALSNQPAPANAAPISTPPANQQNG 338

Query: 321 PL-------------PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGR 367
                          PR    T+ + E +NYE++     T  +   ++RLS+AVVVN   
Sbjct: 339 QQNQQTTTSTASNAGPR----TNSRNETTNYEVDRTIRHTKLNVGDIQRLSVAVVVNYKT 394

Query: 368 LT--EVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG--- 422
           L   + L  +A+Q      + +I  +   A G + +RGD++ + +  F  N +  +G   
Sbjct: 395 LPNGKPLPLTAEQ------MKQIEDLTREAMGYSEKRGDSLNVVNSPF--NPVDETGGEL 446

Query: 423 --TVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL 480
               Q +F+D L    +     LV +V  LL        L+R    + A + ++  +   
Sbjct: 447 PFWQQQAFIDQL---MSAGRWLLVLIVAWLLWRKGVRPQLQRRAEAEKAAREQINARQ-- 501

Query: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540
               +  AV   L  ++ +    +NQ           R+ + V  Q   R+  M + +  
Sbjct: 502 ---EVEEAVEVRLSKDEQMQQRRANQ-----------RMGAEVMSQ---RIREMSDNDPR 544

Query: 541 RFAKILRKWARSEIE 555
             A ++R+W  +E E
Sbjct: 545 VVALVIRQWMGNEHE 559


>gi|308273184|emb|CBX29787.1| hypothetical protein N47_F14820 [uncultured Desulfobacterium sp.]
          Length = 520

 Score =  157 bits (396), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 134/465 (28%), Positives = 221/465 (47%), Gaps = 30/465 (6%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           D  +QF     SL   + + ++  +L+ I  F       N   Y  L+  L   D   I 
Sbjct: 3   DSAVQFLNFIKSLPLAKKITISVTVLLLIAAFAVMFMLSNQVDYRVLFNNLSAQDAGAII 62

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L E NI ++I   GS I VPS  V + R+ +   GLP      G+E+FDK + +  T 
Sbjct: 63  EKLKEKNIPYKIEGGGSLILVPSDQVYELRLKMVGDGLPRDGQ-IGFEIFDKTD-YKTTQ 120

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV 184
           F+Q +   RAL+GE+ARTI     + ++R+ IV+P    F +     +ASV++   +   
Sbjct: 121 FVQSLNYQRALQGELARTINCFDEVKSSRIFIVLPKETLFAEDTKPASASVLLDLKSNLP 180

Query: 185 YKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL----TANEMERNILGKSLSIVQAIQHE 240
            +   AI HLVA+AV  L+  +VTV+D+ G+++      N+    +    L     I+ E
Sbjct: 181 PERLSAIVHLVASAVEGLEPEEVTVVDTKGRVIFKGGNGNQTNTFLNNSQLDYKSKIESE 240

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           I  N+   L   +G  N    V A+++ +   + E  YDP + V RS R  +++ R+  +
Sbjct: 241 ISRNVQSMLEGIIGSGNAIVRVTADIDFNKTSMNEEEYDPAAAVVRSKRDIEESFRAGNA 300

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQ-SNYEINTKSIATTHDNYKLERLSI 359
             ESA ++      V    +P     +N  +K++  +NYEIN  +   +     ++RLS+
Sbjct: 301 SSESAPSLINQRAGV----IPAESVDQNGKRKKDTLTNYEINKVTRVISKPAGTIKRLSV 356

Query: 360 AVVVNKGRLTEVLGRSADQ-------GKIDSYLAEINKIVSAATGINSRRGDTITITSMD 412
           A V++ GR   V  +SAD         + D  L +   IV  A G N  R D I+++S+ 
Sbjct: 357 AAVID-GRYETV--KSADGTDKRNYIPRTDEELKKFEDIVKGAMGYNEDREDKISVSSIP 413

Query: 413 FLENQLFNSGTVQVS-----FMDILSRHFATVINALVFLVGTLLV 452
           F E+     G +Q++     FM +L  +  ++IN    L+    V
Sbjct: 414 FSESL---PGDIQMASEPFDFMALLKDYKNSLIN-FCLLIAVFFV 454


>gi|308187290|ref|YP_003931421.1| Flagellar M-ring protein [Pantoea vagans C9-1]
 gi|308057800|gb|ADO09972.1| Flagellar M-ring protein [Pantoea vagans C9-1]
          Length = 575

 Score =  157 bits (396), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 135/468 (28%), Positives = 215/468 (45%), Gaps = 63/468 (13%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +   P Y  LY  L   D   I   L++ NI +R ++NG ++ VP + V + R+ LA Q
Sbjct: 47  LWAKQPSYSVLYNNLTDEDGGAIVTQLTQMNIPYRFAENGGALIVPEANVHELRLRLAQQ 106

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   S  G+EL DK   FG++ F +++   RALEGE+ARTI+S+  + +ARVH+ MP 
Sbjct: 107 GLPKGGS-VGFELLDK-EKFGISQFSEQVNYQRALEGELARTIESLGPVKSARVHLAMPK 164

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++       +AI H+V+++V  L  G+VTV+D TG+
Sbjct: 165 PTLFVREQKAPSASVTLTLQPGRALDEG---QIQAIAHMVSSSVAGLPPGNVTVVDQTGR 221

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT ++   R++    L     ++   +  I   L   LG  N  + V A++N DT +  
Sbjct: 222 LLTRSDNAGRDLNDAQLKYSSEVEARYQQRIEAILNPILGQGNVHAQVTAQINFDTSEQT 281

Query: 275 EIVYDPDSKVERSIRLSKDAQRSETS--------------QPESAVTVEQNMP------- 313
           +  Y P++    +   S+    S+ S              QP  A T     P       
Sbjct: 282 DEKYQPNANPSNTAIRSRQTSTSDQSGSPYPGGVPGALSNQPAPANTAPVTTPNNNAANG 341

Query: 314 ------------HVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNY-KLERLSIA 360
                                  S     ++++  NYE++ +SI  T  N   ++RLS+A
Sbjct: 342 QNANGQNNAANNASQTTSTAAASSAPTNSRRDDTVNYELD-RSIRHTKVNVGDVQRLSVA 400

Query: 361 VVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDFLEN 416
           VVVN         R+ D+GK     +  L +I  +   A G +  RGD++ + +  F   
Sbjct: 401 VVVN--------FRADDKGKAVALNEQQLKQIEDLTREAMGYSQTRGDSVNVVNSQFNTT 452

Query: 417 QLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLH 464
           +     T  + F    S  F  ++NA  +L+   LV F+    L R H
Sbjct: 453 EAV---TADLPFWQQQS-FFDQLMNAGKWLL-IALVAFILYRKLVRPH 495


>gi|193222343|emb|CAL62027.2| Flagellar M-ring protein [Herminiimonas arsenicoxydans]
          Length = 562

 Score =  157 bits (396), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 127/438 (28%), Positives = 208/438 (47%), Gaps = 56/438 (12%)

Query: 18  GRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRIS 77
           GR  +L++    ++ +M+ +    +   P Y  L+      D   I  +L  AN+ ++ +
Sbjct: 24  GRKFLLMVGVAAVIAVMIGLV--LWGQKPEYRVLFSNFSDRDGGAIMTSLQAANVPYKFA 81

Query: 78  DNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEG 137
           + G +I VP+  V + R+ LAA+GLP   S  G+EL +     G++ F++++   RALEG
Sbjct: 82  EGGGAILVPADKVHEIRLKLAAEGLPKGGS-VGFELMEN-QKLGVSQFLEQVNFQRALEG 139

Query: 138 EIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI-----RAINPSVYKSAEAIR 192
           E+AR+IQS+  + AARVH+ +P    F +   +PTASV++     R ++    +   AI 
Sbjct: 140 ELARSIQSVGAVQAARVHLALPKASVFVRDQQKPTASVLLNLHAGRFLD---QQQVSAIV 196

Query: 193 HLVAAAVPNLDMGDVTVLDSTGKLLTANEME--RNILGKS-LSIVQAIQHEIEMNINKAL 249
           HLVA++VP L   +VT++D  G LL+ N      N L  S L  VQ +Q  I   I   +
Sbjct: 197 HLVASSVPELSPKNVTIVDQAGNLLSENNKPAGTNTLDPSQLKYVQELQQNIAKRIESII 256

Query: 250 AAFLGVDNFRSAVVAELNMDTQQIREIVYDPD----SKVERSIRLSKDAQRSE------- 298
              +G++N R+   A+++  T +    +Y P+    S   RS + S+    S        
Sbjct: 257 TPIVGLNNVRAEATADVDFSTSEQAAEIYKPNQVPSSATVRSQQTSESTNGSNNATGVPG 316

Query: 299 --TSQPESAVTVEQN-MPHVSDRKVPLPRSLENTD-------------KKEEQSNYEINT 342
             T+QP  A T   N  P  +                           +++  +NYE++ 
Sbjct: 317 ALTNQPAPAATAPLNTTPQTTAAPGTPGAPGTPGAPAATATAPQATPIQRDTTTNYEVDK 376

Query: 343 KSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLA-------EINKIVSAA 395
                      L+RLS+AVVVN  R   V+G+    GK+ S+L        +I  +V  A
Sbjct: 377 TIRYVQQPMGGLKRLSVAVVVNYKR---VVGKD---GKV-SFLPLTEIEKTQITDLVREA 429

Query: 396 TGINSRRGDTITITSMDF 413
            G N  RGDT+ + +  F
Sbjct: 430 MGYNKDRGDTLNVVNSPF 447


>gi|134095076|ref|YP_001100151.1| flagellar MS-ring protein [Herminiimonas arsenicoxydans]
          Length = 545

 Score =  157 bits (396), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 127/438 (28%), Positives = 208/438 (47%), Gaps = 56/438 (12%)

Query: 18  GRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRIS 77
           GR  +L++    ++ +M+ +    +   P Y  L+      D   I  +L  AN+ ++ +
Sbjct: 7   GRKFLLMVGVAAVIAVMIGLV--LWGQKPEYRVLFSNFSDRDGGAIMTSLQAANVPYKFA 64

Query: 78  DNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEG 137
           + G +I VP+  V + R+ LAA+GLP   S  G+EL +     G++ F++++   RALEG
Sbjct: 65  EGGGAILVPADKVHEIRLKLAAEGLPKGGS-VGFELMEN-QKLGVSQFLEQVNFQRALEG 122

Query: 138 EIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI-----RAINPSVYKSAEAIR 192
           E+AR+IQS+  + AARVH+ +P    F +   +PTASV++     R ++    +   AI 
Sbjct: 123 ELARSIQSVGAVQAARVHLALPKASVFVRDQQKPTASVLLNLHAGRFLD---QQQVSAIV 179

Query: 193 HLVAAAVPNLDMGDVTVLDSTGKLLTANEME--RNILGKS-LSIVQAIQHEIEMNINKAL 249
           HLVA++VP L   +VT++D  G LL+ N      N L  S L  VQ +Q  I   I   +
Sbjct: 180 HLVASSVPELSPKNVTIVDQAGNLLSENNKPAGTNTLDPSQLKYVQELQQNIAKRIESII 239

Query: 250 AAFLGVDNFRSAVVAELNMDTQQIREIVYDPD----SKVERSIRLSKDAQRSE------- 298
              +G++N R+   A+++  T +    +Y P+    S   RS + S+    S        
Sbjct: 240 TPIVGLNNVRAEATADVDFSTSEQAAEIYKPNQVPSSATVRSQQTSESTNGSNNATGVPG 299

Query: 299 --TSQPESAVTVEQN-MPHVSDRKVPLPRSLENTD-------------KKEEQSNYEINT 342
             T+QP  A T   N  P  +                           +++  +NYE++ 
Sbjct: 300 ALTNQPAPAATAPLNTTPQTTAAPGTPGAPGTPGAPAATATAPQATPIQRDTTTNYEVDK 359

Query: 343 KSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLA-------EINKIVSAA 395
                      L+RLS+AVVVN  R   V+G+    GK+ S+L        +I  +V  A
Sbjct: 360 TIRYVQQPMGGLKRLSVAVVVNYKR---VVGKD---GKV-SFLPLTEIEKTQITDLVREA 412

Query: 396 TGINSRRGDTITITSMDF 413
            G N  RGDT+ + +  F
Sbjct: 413 MGYNKDRGDTLNVVNSPF 430


>gi|325295413|ref|YP_004281927.1| flagellar M-ring protein FliF [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065861|gb|ADY73868.1| flagellar M-ring protein FliF [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 529

 Score =  156 bits (395), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 130/432 (30%), Positives = 209/432 (48%), Gaps = 46/432 (10%)

Query: 22  ILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGS 81
           IL+L+++ LV  + F+A +       Y  LY  L   D   I   L E +I +++  NGS
Sbjct: 24  ILLLSALTLVSFLAFIAIKQSTTE-DYAVLYTHLSPDDAGSILSVLQEEHIPYKVEGNGS 82

Query: 82  SISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIAR 141
            I VP   V   R+ LAA+GLP      G+ELFD+    G+T F + +  +RALEGEI R
Sbjct: 83  IILVPKEKVYDIRLKLAAKGLPHGKV-VGFELFDE-PKLGITQFQENVEFLRALEGEIER 140

Query: 142 TIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS---VYKSAEAIRHLVAAA 198
           TI+ I+ I   +V+I +P    F +    P AS+++  + P      +  +AI  LV+ A
Sbjct: 141 TIKRINAIQDVKVNIALPKDSIFVRESEEPKASILVN-LWPGRELTKEQVKAIVFLVSHA 199

Query: 199 VPNLDMGDVTVLDSTGKLLT----ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLG 254
           VP L   +VTV+D+ G++LT     NE E     K L + + ++ EIE  I   L+  LG
Sbjct: 200 VPGLKPENVTVIDNRGRVLTDLLSGNEDETG-SSKELEVKRKLEKEIERKIQSMLSQVLG 258

Query: 255 VDNFRSAVVAELNMDTQQIREIVYDPDSKV---ERSIRLSKDAQRSETS-QPESAVTVEQ 310
                     E+     + +E +YDPD      ER I      Q  ET  +P+     EQ
Sbjct: 259 SGKVVVRASVEIETGRLEKKEELYDPDMTAVVSERKI------QEKETGIKPK-----EQ 307

Query: 311 NMPHVSDRKVPL-----PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNK 365
            +P  +    P+        +   +KK+  +NY+++     T    +K++R+S+ V+V+ 
Sbjct: 308 GVPGTTTNVPPVLNLNQGNEILKKEKKDVTTNYDVSKTIQKTITPIFKIKRISVGVLVD- 366

Query: 366 GRLTEVLGRSAD---------QGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLEN 416
           G+  +   ++ +         Q +I +Y     +IV +A G + +RGDT+T+ S+ F   
Sbjct: 367 GKYQKEKDKAGNEIIKFVPRSQEEIKTY----EEIVKSAIGYDPKRGDTVTVASVPFEAK 422

Query: 417 QLFNSGTVQVSF 428
           Q       Q  F
Sbjct: 423 QFVQKEKSQKKF 434


>gi|288549808|ref|ZP_05968261.2| flagellar M-ring protein FliF [Enterobacter cancerogenus ATCC
           35316]
 gi|288317495|gb|EFC56433.1| flagellar M-ring protein FliF [Enterobacter cancerogenus ATCC
           35316]
          Length = 543

 Score =  156 bits (395), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 117/408 (28%), Positives = 194/408 (47%), Gaps = 50/408 (12%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  SP Y  LY  L   D   I   L++ NI +R +DNG ++ VP+  V + R+ LA Q
Sbjct: 28  LWAKSPDYRTLYSNLSDQDGGAIVTQLTQMNIPYRFADNGGALEVPADKVHELRLRLAQQ 87

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 88  GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 145

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D +G 
Sbjct: 146 PSLFVREQKSPSASVTVNLEPGRALDEG---QISAVTHLVSSAVAGLPPGNVTLVDQSGH 202

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  ++  I   L   +G  N  + V A+++   ++  
Sbjct: 203 LLTQSNSAGRDLNDAQLKYAADVEGRLQRRIEAILGPVVGSSNVHAQVTAQIDFANKEQT 262

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQPESAVTVEQNMPH------ 314
           E  Y P+    +++  S+    +E              ++QP  A       P       
Sbjct: 263 EEQYSPNGNPSQAVMRSRQVNENEQVGGPYPGGVPGALSNQPAPANAAPITTPAANQQNG 322

Query: 315 -------VSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGR 367
                   S      PR    T  + E +NYE++     T  +   ++RLS+AVVVN   
Sbjct: 323 QQNNAQTTSTAASSGPR----TSSRNETTNYEVDRTIRHTKLNVGDVQRLSVAVVVNYKT 378

Query: 368 LTE--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           L +   L  + +Q K      +I  +   A G + +RGDT+ + +  F
Sbjct: 379 LPDGKPLPLTTEQMK------QIEDLTREAMGYSEKRGDTLNVVNSPF 420


>gi|77918796|ref|YP_356611.1| flagellar M-ring protein FliF [Pelobacter carbinolicus DSM 2380]
 gi|77544879|gb|ABA88441.1| flagellar M-ring protein FliF [Pelobacter carbinolicus DSM 2380]
          Length = 519

 Score =  156 bits (395), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 134/451 (29%), Positives = 215/451 (47%), Gaps = 30/451 (6%)

Query: 19  RTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISD 78
           R R L L +V+L  ++ F A  F  N   Y  L+  L+ +D   +   L E  + +R+  
Sbjct: 19  RKRQLSLLAVVLACVVFFAAIIFQANKADYQMLFGNLDSADAAAVVDRLKEQKVPYRLEH 78

Query: 79  NGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGE 138
            G +I +P+  V + R+ +A  GLP      G+E+FDK  SFG+T F Q+I  +RAL+GE
Sbjct: 79  GGRAIFIPADKVYEIRLAMAGSGLPRGG-GVGFEIFDK-QSFGMTDFAQKINYLRALQGE 136

Query: 139 IARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVA 196
           ++RTI S++ + AARVH+ +P+   FR    + +ASV+++       +  +   I +LVA
Sbjct: 137 LSRTIASLAPVEAARVHLALPEKRLFRDQQQKASASVIVKLATGQSLRETQILGIVNLVA 196

Query: 197 AAVPNLDMGDVTVLDSTGKLLTANEMERNILGKS---LSIVQAIQHEIEMNINKALAAFL 253
            +V  LD+  V V+D  G++L+         G +   L   Q ++  +E+     L   L
Sbjct: 197 GSVDGLDVDQVAVIDDNGRVLSQTADHSGTGGTAPDMLEYQQNLEQRLELRAQALLDRAL 256

Query: 254 GVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMP 313
           G+ N    V A ++   ++  E  YDP+    RS + S     SE     +A  V     
Sbjct: 257 GMGNSMVQVTAAIDYTQRERMEESYDPNQTAVRSEQSS-----SEKGGVANAGGVPGVQT 311

Query: 314 HVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNY-KLERLSIAVVVNKGRLTEVL 372
           ++ + K     S   T +  E  NYEI +K ++   D+   ++ LS+AV+V        +
Sbjct: 312 NIKNEKA--GNSFIPTSRSNETINYEI-SKVVSKQVDSVGSIKNLSVAVLV----ADRPV 364

Query: 373 GRSADQGKIDSY-------LAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGT-V 424
               D  K  SY       LA I K++S A G+N  RGD I + S  F     FNS   V
Sbjct: 365 DNQGDTDKAPSYQPRDPKELAAIEKMISRALGLNPDRGDQIAVISRPF--ETAFNSEPLV 422

Query: 425 QVSFMDILSRHFATVINALVFLVGTLLVTFL 455
           + S    + +    +  AL+ L   L   F+
Sbjct: 423 KSSPWSRIYQMVPMIKYALLALTAGLFYFFV 453


>gi|291278937|ref|YP_003495772.1| flagellar M-ring protein FliF [Deferribacter desulfuricans SSM1]
 gi|290753639|dbj|BAI80016.1| flagellar M-ring protein FliF [Deferribacter desulfuricans SSM1]
          Length = 556

 Score =  156 bits (395), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 136/494 (27%), Positives = 245/494 (49%), Gaps = 42/494 (8%)

Query: 1   MAILDQLLQF---FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEV 57
           MA+ D + QF   F S + + +  I+     + + I++ +    + N P Y  LY  L  
Sbjct: 1   MALKDFINQFKAVFNSLSLIQKVSIVTATVAVFLTIIVLV---IWANKPVYKTLYSNLSS 57

Query: 58  SDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKV 117
            D  +I   L    I + + DNG +I VP   V + R++LA +GLPS    +G+ELFDK 
Sbjct: 58  DDAAKIVEELKANKIPYELKDNGKTILVPEKNVYELRLNLAQKGLPSGGG-AGFELFDK- 115

Query: 118 NSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI 177
           +SFG++ F Q +   RAL+GE+ARTI+S+  +  ARVH+ +P    F    + P A+V++
Sbjct: 116 SSFGISEFAQNVNYQRALQGELARTIKSLDEVEDARVHLTLPKERIFVSEESSPKATVVL 175

Query: 178 RAINPS--VYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT---ANEMERNILGKS-L 231
           +  N +    ++ +AI  LVA AV  L + +V V+D+ G+LL+   + + E  +L ++ L
Sbjct: 176 KFRNGANISRENIKAIASLVAGAVKGLTIDNVQVVDTKGRLLSEFLSKDYEPLLLTQTQL 235

Query: 232 SIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLS 291
              + I+  +E  IN  L+  LG DN  + V A+++   + + +  YDP+  V RS +  
Sbjct: 236 EYQKHIEKNLESKINSILSRVLGPDNAVAKVTADIDFTKKVVSKEEYDPNP-VLRSQQTV 294

Query: 292 KDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLEN-----TDKKEEQSNYEINTKSIA 346
           +   ++  + P     V  N+          P ++ N       K E   N+E+      
Sbjct: 295 EIESKNTPNAPGGTPGVSSNLAE--------PNNINNGSNSEYSKAETTQNFEVGKTVTK 346

Query: 347 TTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKI---VSAATGINSRRG 403
                  ++++++AV++N  ++ +  G+ +    +     EI KI   V +A GI+  RG
Sbjct: 347 EEKPIGVVKKITVAVLLNDKKVVKEEGKKSKIEYVKWTPEEIEKIKKLVESAAGIDVNRG 406

Query: 404 DTITITSMDF-----LENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           D I +T++ F     LE   F +   ++S +  ++++       L  L+  L    +   
Sbjct: 407 DRIEVTNISFDTTHDLEVASFYNKQEKMSLIFTIAKY------VLALLIVVLFYFLVVRP 460

Query: 459 ALRRLHNIDDAKKG 472
            L+RL  + + ++G
Sbjct: 461 ILKRLETVRETEEG 474


>gi|161511085|ref|NP_773639.2| flagellar MS-ring protein [Bradyrhizobium japonicum USDA 110]
          Length = 537

 Score =  156 bits (394), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 120/411 (29%), Positives = 204/411 (49%), Gaps = 13/411 (3%)

Query: 6   QLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISV 65
           Q L  F  G    R   +I  +  LV    F+  R  V +P    L+  L V D + I  
Sbjct: 2   QGLADFLKGIGAARFGAMIAVTAALVGFFAFVIMR--VTTPQMTTLFTDLSVEDSSSIIK 59

Query: 66  ALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSF 125
            L    I F + + G+ I VP   V + R+ LA +G        GYE+FDK ++ G TSF
Sbjct: 60  DLERQAIQFELRNEGTIIMVPKDKVTRLRMKLA-EGGLPKGGGVGYEVFDKSDALGTTSF 118

Query: 126 MQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVY 185
           +Q I  +RALEGE+ARTI++I  I AARVH+V+P+   F +    P+AS+++R       
Sbjct: 119 VQNINHLRALEGELARTIRAIDRIQAARVHLVLPERPLFSREAPEPSASIVVRVRGALEA 178

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL---TANEMERNILGKSLSIVQAIQHEIE 242
           +   AIRHLVA+AV  L    V+++D  G+LL    A + E+ +  +  +     +  + 
Sbjct: 179 QQIRAIRHLVASAVNGLKPQRVSIVDEAGQLLADGAATDPEQALGDERRT---TFEKRMR 235

Query: 243 MNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQP 302
             +   +++ +G    R  + A+ + +        +DP+ +V RS +  +++  S T+  
Sbjct: 236 KQVEDIVSSVVGSGRARVQLSADFDFNKITQTSDKFDPEGRVLRSTQTREES--SMTADN 293

Query: 303 ESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVV 362
              VTV   +P   +++     + + + K EE +NYEI+  +     +  ++ R+S+AV+
Sbjct: 294 NGQVTVNNELP--GNQQNNGVAAKDQSKKTEETNNYEISRTTKTEVTEAGRVNRISVAVL 351

Query: 363 VNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           V+        G  A Q +    L  I  +V +A G + +RGD + + ++ F
Sbjct: 352 VDGIYSKNDKGELAYQDRTKEQLDRIATLVRSAIGFDQKRGDQVEVVNLRF 402


>gi|157371187|ref|YP_001479176.1| flagellar MS-ring protein [Serratia proteamaculans 568]
 gi|157322951|gb|ABV42048.1| flagellar M-ring protein FliF [Serratia proteamaculans 568]
          Length = 563

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 117/410 (28%), Positives = 204/410 (49%), Gaps = 40/410 (9%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  SP Y  LY  +   D   I   L++ NI FR ++NG+++ +P+  V + R+ LA  
Sbjct: 46  LWAKSPDYRVLYSNINDRDGGAIVTQLTQMNIPFRFAENGAALLIPADKVHETRLRLAQL 105

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F ++I   RALEGE++RTI+S+  +  ARVH+ +P 
Sbjct: 106 GLPKGGA-VGFELLDQ-EKFGISQFSEQINYQRALEGELSRTIESLGPVQNARVHLALPK 163

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        AI ++V+++V  L  G+VTV+D +G+
Sbjct: 164 PSLFVREQKSPSASVTLTLQPGRALDDG---QINAIVYMVSSSVAGLPPGNVTVVDQSGR 220

Query: 216 LLTANE-MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT ++   R++    L     ++   +  I   LA  +G  N R+ V A+++  T++  
Sbjct: 221 LLTQSDGAGRDLNAAQLKYANEVESRYQRRIEAILAPMVGNGNARAQVTAQIDFATREQT 280

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQPESAVT--VEQNMPHVSDR 318
           +  Y P+    ++   SK   +S+              ++QP +  T  +E   P  +  
Sbjct: 281 DEEYQPNQLPNKAAVRSKQMSQSDQIGGPLVGGVPGALSNQPSAPATAPIETAKPAATGN 340

Query: 319 KVPLPR----------SLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRL 368
                +          S     + +E +NYE++     T      ++RLS+AVVVN  R 
Sbjct: 341 NANATQPNAAATRSAASGPQNSRLDETTNYEVDRTIRHTQQKAGTVQRLSVAVVVNY-RG 399

Query: 369 TEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQL 418
           T+  G+     K    LA+I  +V  + G +S RGDT+ + +  F +N++
Sbjct: 400 TDKDGKPLPMSK--EQLAQIESLVRESMGFSSTRGDTLNVVNTPFTDNEV 447


>gi|207728374|ref|YP_002256768.1| flagellar m-ring protein [Ralstonia solanacearum MolK2]
 gi|206591620|emb|CAQ57232.1| flagellar m-ring protein [Ralstonia solanacearum MolK2]
          Length = 614

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 137/470 (29%), Positives = 228/470 (48%), Gaps = 80/470 (17%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  +  SD   I  AL + N+ +R +D  S+I VP + V + R+ LAAQ
Sbjct: 66  LWSRAPDYRVLYSNVADSDGGAIIAALQQMNVPYRFADGDSAIMVPEANVHEVRLKLAAQ 125

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP     +G+EL +    FG + F +++   RALEGE+ARTIQ++  + +ARVH+ +  
Sbjct: 126 GLPKGGL-AGFELMEN-QKFGTSQFAEQVNYQRALEGELARTIQAMQEVQSARVHLALSK 183

Query: 161 MGSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +  A+P+ASV+++ + P         +AI HLV+++VPNL + +VTV+D +G+LL
Sbjct: 184 PSVFVREQAKPSASVLLK-LYPGRMLDRSQVQAIGHLVSSSVPNLPLANVTVVDQSGRLL 242

Query: 218 TANEMERNILG---KSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMD-TQQI 273
           +++  + N  G     L+ V+ I+      I   L   +G DN R+ V A++++D T+Q+
Sbjct: 243 SSS-FQDNASGLDPTQLNYVRDIEQGYIKRIEAILGPVVGDDNVRAQVTADVDLDNTEQM 301

Query: 274 REIV---YDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVP--------- 321
            E      DP + V RS   S+  Q    +Q         N P  + R +P         
Sbjct: 302 AETYRPNQDPANGVVRSTHTSESTQNKAGAQ-GGVPGALSNQPPTAPRMLPTAPAPASQQ 360

Query: 322 ---------------------------LPRSLENTDKKEEQSNYEINTKSIATTHDNYKL 354
                                         S+E++  ++   NYE++     T      +
Sbjct: 361 AAAGQNGQNGQNAPNGQQQAAAAAGQAATNSVESS-ARDTTVNYEVDKTVRRTRAAVGTV 419

Query: 355 ERLSIAVVVN---KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSM 411
            RLS+AVVVN    G+  + L         D+ + ++N +V  A G +++RGD++ + + 
Sbjct: 420 RRLSVAVVVNYRADGKTWKPLS--------DADMVKLNALVKDAVGYDAKRGDSVNVVNS 471

Query: 412 DFLENQLFNSGTVQVSFMDI-LSR-----HFATVINALVFLVGTLLVTFL 455
            F       SGT+ +S  D+ L +     H+A  I A  +  G L + FL
Sbjct: 472 QF-------SGTLPMSRDDLPLWKQPEMIHYA--IQAAKY--GALAIGFL 510


>gi|260868531|ref|YP_003234933.1| flagellar basal-body MS-ring and collar protein FliF [Escherichia
           coli O111:H- str. 11128]
 gi|257764887|dbj|BAI36382.1| flagellar basal-body MS-ring and collar protein FliF [Escherichia
           coli O111:H- str. 11128]
 gi|323180809|gb|EFZ66349.1| flagellar M-ring protein FliF [Escherichia coli 1180]
          Length = 552

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 200/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R+S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRVSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFREQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+    ++   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPVPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|319764515|ref|YP_004128452.1| flagellar m-ring protein flif [Alicycliphilus denitrificans BC]
 gi|330826731|ref|YP_004390034.1| flagellar M-ring protein FliF [Alicycliphilus denitrificans K601]
 gi|317119076|gb|ADV01565.1| flagellar M-ring protein FliF [Alicycliphilus denitrificans BC]
 gi|329312103|gb|AEB86518.1| flagellar M-ring protein FliF [Alicycliphilus denitrificans K601]
          Length = 564

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 112/397 (28%), Positives = 195/397 (49%), Gaps = 26/397 (6%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
           F+   P Y  L+  L   D   I   L++ N+ ++ ++ G +I VP+  V   R+ LA Q
Sbjct: 50  FYGRQPEYRVLFSGLNDKDGGAIVAQLAQMNVPYKYTEGGGAIMVPAERVHDVRLRLATQ 109

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP  S  +G+EL +  N FG+T F + +   R LEGE+ R+IQ+++ + +ARVH+ +P+
Sbjct: 110 GLPKGSV-TGFELME-TNRFGVTQFQERLNFQRGLEGELTRSIQALASVQSARVHLALPN 167

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +   +P+ASV++      +    +   I HLVA++VP L    V+VLD TGKLL+
Sbjct: 168 QNGFFREQQKPSASVLLTLYPGRILDRTQIAGIVHLVASSVPELAPSAVSVLDDTGKLLS 227

Query: 219 ANE---MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNM----DTQ 271
            +        +  + L+ VQ I+ +    I   L   +G +N ++ V AE++      T 
Sbjct: 228 QSPDGGAGSGVDAQQLAYVQQIEQQYTRRILDLLEPVVGKNNVKAQVTAEVDFSQTESTS 287

Query: 272 QIREIVYDPDSKVERSIRLSKDAQRSETSQPESAV--TVEQNMPHVSDRKV----PLP-- 323
           +       PD+   RS ++ +    +  +QP + V   V    P  S   +    P P  
Sbjct: 288 EQHRPNLSPDASAVRSQQIVESGA-APAAQPPTGVPGAVSNQPPQGSTAPINGANPPPTA 346

Query: 324 -----RSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSA-D 377
                   +   K+E  +NYE++  +  T      ++R++ AVVVN   ++E  G+ A +
Sbjct: 347 ANAQQAGQQAGGKRESITNYEVDKTTRVTRAGAGAIKRVNAAVVVNYQSVSEAPGKPAVN 406

Query: 378 QGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFL 414
           +      + ++  +V    G N  RGD++ + +  FL
Sbjct: 407 KALSPEQIEQMTALVRETIGFNKERGDSVNLMNAPFL 443


>gi|291613068|ref|YP_003523225.1| flagellar M-ring protein FliF [Sideroxydans lithotrophicus ES-1]
 gi|291583180|gb|ADE10838.1| flagellar M-ring protein FliF [Sideroxydans lithotrophicus ES-1]
          Length = 546

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 115/407 (28%), Positives = 203/407 (49%), Gaps = 40/407 (9%)

Query: 35  LFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKAR 94
           LFM    +  +P Y  LY  +   D   +  +L + NI ++ ++ G+ + VP+  V + R
Sbjct: 41  LFM----WGQTPDYRVLYANMSERDGGAVIESLQQQNIPYKFTEGGT-LMVPADRVYEVR 95

Query: 95  IHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARV 154
           + +AA+GLP   +  G+EL +    FG + F++++   RALEGE++R++++I+ + +ARV
Sbjct: 96  LQMAAKGLPKGGT-VGFELMEN-QKFGTSQFLEQVNYQRALEGELSRSVETIASVASARV 153

Query: 155 HIVMPDMGSFRKIGARPTASVM--IRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDS 212
           H+ +P    F K   +P+ASV+  +RA N        AI HL++++VPN++  +VTV+D 
Sbjct: 154 HLAIPKQSVFVKEQQKPSASVILSLRAGNSLDEGQVSAIVHLISSSVPNMNAQNVTVVDQ 213

Query: 213 TGKLLTA---NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNM- 268
           +G LL++   +  E+ +    L  V+ I+ +    I   L    GV N R+ V A L+  
Sbjct: 214 SGTLLSSARDSNAEQLMDATQLKYVRQIEQDYVKRIEDILIPITGVQNVRAQVTASLDFS 273

Query: 269 DTQQIREIV---YDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRS 325
            T+Q  E       P+    RS+         +T + ++  T    +P     + P+P +
Sbjct: 274 QTEQTAETFRPNQPPNQAAVRSL---------QTLETQNGTTSTGGVPGALSNQPPVPAT 324

Query: 326 ---------------LENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTE 370
                                KE  +NYE++     T      ++RLSIAVVVN    T 
Sbjct: 325 APIVTPASAVVAAAGTAGNMHKELTTNYEVDRTIQHTKLPVGSIKRLSIAVVVNNPSTTG 384

Query: 371 VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
             G++  +   D+  A+I  +V    G +++RGD++ + +  F E Q
Sbjct: 385 KDGKATSRPYTDAEKAQITALVKETVGFDAKRGDSLNLLNSAFNEQQ 431


>gi|170769442|ref|ZP_02903895.1| flagellar M-ring protein FliF [Escherichia albertii TW07627]
 gi|170121766|gb|EDS90697.1| flagellar M-ring protein FliF [Escherichia albertii TW07627]
          Length = 552

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 113/397 (28%), Positives = 193/397 (48%), Gaps = 32/397 (8%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R+S+   +I VP+  V + R+ LA Q
Sbjct: 41  LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRVSETSGAIEVPADKVHELRLRLAQQ 100

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE++RTI++I  +  ARVH+ +P 
Sbjct: 101 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLALPK 158

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV +  +        +  AI HLV++AV  L  G++T++D  G LLT
Sbjct: 159 PSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVAGLPTGNITLVDQGGHLLT 218

Query: 219 -ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIV 277
            +N  ER++    L     ++  I+  I   L   +G  N  + V A+L+  +++  E  
Sbjct: 219 QSNSSERDLNDIQLKYANDVESRIQQRIEAILTPIVGNGNIHAQVTAQLDFASKEQTEEQ 278

Query: 278 YDPDSKVERSIRLSKDAQRSETS---QPESAVTVEQNMP-HVSDRKVPLPRSLENTDKKE 333
           Y P+    ++   S+    SE S    P        N P   ++  +  P + +N  +++
Sbjct: 279 YRPNGNESQTALRSRQLNESEQSGSGYPGGVPGALSNQPAPANNAPISTPPTTQNNRQQQ 338

Query: 334 ---------------EQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTE--VLGRSA 376
                          E SNYE++     T  +   ++RLS+AVVVN   L +   L  S 
Sbjct: 339 TSTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSVAVVVNDKTLPDGKPLPLST 398

Query: 377 DQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           +Q      + +I  +   A G + +RGD++ + +  F
Sbjct: 399 EQ------MKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|293410294|ref|ZP_06653870.1| flagellar M-ring protein FliF [Escherichia coli B354]
 gi|291470762|gb|EFF13246.1| flagellar M-ring protein FliF [Escherichia coli B354]
          Length = 552

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 117/418 (27%), Positives = 202/418 (48%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIIAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DAQRSETSQPESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+   ++++S +S P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSSYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|1772459|dbj|BAA14029.1| FliF [Escherichia coli W3110]
          Length = 552

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 119/418 (28%), Positives = 198/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N R
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIR 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAHLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|162136034|ref|YP_530830.2| flagellar MS-ring protein [Rhodopseudomonas palustris BisB18]
          Length = 539

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 148/555 (26%), Positives = 254/555 (45%), Gaps = 36/555 (6%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           L+ F K    LG  R++ + +V    I  F      V +P    L+  L V D + I   
Sbjct: 4   LVSFLKG---LGAARLMAMIAVTAALIGFFAFVIMRVTTPQMTTLFTDLSVEDSSGIIKD 60

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L    I F I + GS I VP   V + R+ LA +G        GYE+FDK ++ G TSF+
Sbjct: 61  LERQAIPFEIRNEGSVIMVPKDKVTRLRMKLA-EGGLPKGGGVGYEIFDKSDALGSTSFV 119

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           Q I  +RALEGE+ARTI++I  I AARVH+V+P+   F +    P+AS+++R       +
Sbjct: 120 QNINHLRALEGELARTIRAIDRIQAARVHLVLPERPLFSRETPEPSASIVLRVRGALEPQ 179

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL----TANEMERNILGKSLSIVQAIQHEIE 242
              AIRH+VA+AV  L    V+++D  G+LL      +       G         +  + 
Sbjct: 180 QVRAIRHVVASAVNGLKPQRVSIVDEAGQLLADGAAGDPASDGATGDERR--AGFEKRMR 237

Query: 243 MNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQP 302
             +   +++ +G    R  + A+ + +        +DP+ +V RS +  +++ ++  +  
Sbjct: 238 NQVEAIVSSVVGSGRARVQLTADFDYNKVTQTSDKFDPEGRVLRSSQSREESSQTAAAN- 296

Query: 303 ESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVV 362
           +  VTV   +P           + + + K EE +NYEI+  +     +  ++ R+S+AV+
Sbjct: 297 DGQVTVNNELPGAQAGAG-AAVARDQSKKSEETNNYEISRVTKTEITEAGRVNRISVAVL 355

Query: 363 VNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNS- 421
           V+        G    Q +    L  I  +V +A G + +RGD + + ++ F E       
Sbjct: 356 VDGIYGKNDKGEMVYQERSKDQLDRIAALVRSAIGFDQKRGDQVEVVNLRFAEAPSVPPV 415

Query: 422 -------GTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEV 474
                  G VQ +  D++      VI   V ++  L+V F+ +  L R   I  A+ G  
Sbjct: 416 AEPGGLLGMVQFTKDDVM-----YVIELAVMMLLGLVVMFMVIRPLVR--RILAAEPGAA 468

Query: 475 GGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHM 534
           G   +   P ++ A  T + P D + L +   ++        +++   V  QS  R+  +
Sbjct: 469 GANGV---PALTDASGTAIGP-DGLPLVAPGPNMIDI-----AQVQGQVHAQSVHRVGEL 519

Query: 535 IEINEERFAKILRKW 549
            + N    A I+R+W
Sbjct: 520 ADRNPNETAAIVRQW 534


>gi|300818642|ref|ZP_07098850.1| flagellar M-ring protein FliF [Escherichia coli MS 107-1]
 gi|300528814|gb|EFK49876.1| flagellar M-ring protein FliF [Escherichia coli MS 107-1]
          Length = 552

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 200/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R+S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRVSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+    ++   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPVPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|294678998|ref|YP_003579613.1| flagellar M-ring protein FliF [Rhodobacter capsulatus SB 1003]
 gi|294477818|gb|ADE87206.1| flagellar M-ring protein FliF [Rhodobacter capsulatus SB 1003]
          Length = 551

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 125/425 (29%), Positives = 212/425 (49%), Gaps = 19/425 (4%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           + QL+  ++    L  TR +++A   ++     +A   F +      LY  LE +    +
Sbjct: 1   MQQLMAVWQG---LDTTRRVLVAGATILMFAAILALSSFASRSDMALLYAGLEGARAGEV 57

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
             AL    + + +   G SI V ++   + R+ LA +GLP++   +GYEL D ++ FG T
Sbjct: 58  VAALDARAVPYEV--RGDSIYVDAARRDELRMALAGEGLPATG-GAGYELLDGLSGFGTT 114

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS 183
           S M +    RA EGE+ARTI +   I AARVHI  P   SFRK    PTASV +   +  
Sbjct: 115 SQMFDAAYWRAKEGELARTIVANPMIRAARVHIAAPSGQSFRKEN-HPTASVTVTTASGG 173

Query: 184 VYKS-AEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIE 242
           +  + A+A++ LV++AV  +   DV+++DS   L++  +   N      +       E+ 
Sbjct: 174 LSPTHAKALKFLVSSAVQGMSPDDVSIIDSVAGLISTGDDVFNPAANDRA------EELR 227

Query: 243 MNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQP 302
            N+ + L A +G  N    V  +   + + I E   +PDS+V  S    + +++S+ ++P
Sbjct: 228 SNVERLLEARVGYGNAVVEVSVQTVTEREAITEKRIEPDSRVAISTETQERSEKSDDTKP 287

Query: 303 ESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVV 362
             AVTV  N+P          +S     +  EQ N+E++  +     +   ++RL++AV+
Sbjct: 288 -GAVTVASNLPQ--GDAANGGKSQSQASETREQVNFEVSETTREVLRNPGDIKRLTVAVL 344

Query: 363 VNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG 422
           V+     +  G +A   + D  LA + ++V++A G + +RGD ITI SM F    L  +G
Sbjct: 345 VDGVEGKDANGVTAITPRTDEELAALKELVASAVGFDEKRGDVITIRSMAF--EPLAETG 402

Query: 423 TVQVS 427
           T   S
Sbjct: 403 TEATS 407


>gi|238784726|ref|ZP_04628730.1| Flagellar M-ring protein [Yersinia bercovieri ATCC 43970]
 gi|238714405|gb|EEQ06413.1| Flagellar M-ring protein [Yersinia bercovieri ATCC 43970]
          Length = 572

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 142/549 (25%), Positives = 256/549 (46%), Gaps = 67/549 (12%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  SP Y  LY  L   D   I   L++ NI +R +DNG ++ +P+  V + R+ LA Q
Sbjct: 46  LWAKSPDYRVLYSNLSDRDGGEIVTQLTQLNIPYRFADNGGALLIPADKVHETRLRLAQQ 105

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F ++I   RALEGE+ARTI ++  ++  RVH+ MP 
Sbjct: 106 GLPKGGA-VGFELLDQ-EKFGISQFSEQINYQRALEGELARTIGTLGPVLNVRVHLAMPK 163

Query: 161 MGSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +    PTASV + A+ P          AI ++V+++V  L  G+VTV+D TG+LL
Sbjct: 164 PSLFVREQKSPTASVTL-ALQPGRALDDGQINAIVYMVSSSVAGLPPGNVTVVDQTGRLL 222

Query: 218 T-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI 276
           T ++   R++    L     +++  +  I   LA  +G  N  + V A+++  +++  + 
Sbjct: 223 TQSDSAGRDLNAAQLKFTNEVENRFQRRIETILAPMVGSGNVHAQVTAQVDFASREQTDE 282

Query: 277 VYDPDSKVERSIRLSKDAQRSE------TSQPESAVTVEQNMPHVSDRKVPLPRSL---- 326
            Y P+    +    S+    SE            A++ + +   V+  +VP P  +    
Sbjct: 283 EYKPNQAANQGAVRSQQTSNSEQLGGSNVGGVPGALSNQPSATPVAPIEVPQPAPVAGAA 342

Query: 327 ------------------------ENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVV 362
                                    +  + ++ +N+E++     T      ++RLS+AVV
Sbjct: 343 GAAANNANAANRPATTTAARSTATSSNSRHDQTTNFEVDRTIRHTQQQAGMVQRLSVAVV 402

Query: 363 VNKG--RLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN 420
           VN G  +  + +  S DQ      LA++  +   A G ++ RGDT+ + +  F  N   +
Sbjct: 403 VNYGSDKAGKPVALSKDQ------LAQVESLTREAMGFSTDRGDTLNVVNTPF--NATDD 454

Query: 421 SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL 480
              + + F    S  F  ++N   +L+  LLV ++     R+L     AKK ++  K+  
Sbjct: 455 GSGLSLPFWKQQS-FFDQLLNGGRYLL-ILLVAWI---LWRKLVRPMIAKK-QLADKAAA 508

Query: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540
           S   ++S V T         +  S +++    +N Q R+++ V  Q   R+  + + +  
Sbjct: 509 S---VNSMVQTAQTAE---TVKQSKEELALRKKN-QQRVSAEVQAQ---RIRELADKDPR 558

Query: 541 RFAKILRKW 549
             A ++R+W
Sbjct: 559 IVALVIRQW 567


>gi|309795955|ref|ZP_07690368.1| flagellar M-ring protein FliF [Escherichia coli MS 145-7]
 gi|308120405|gb|EFO57667.1| flagellar M-ring protein FliF [Escherichia coli MS 145-7]
          Length = 552

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 199/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L +G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPLGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|317048599|ref|YP_004116247.1| flagellar M-ring protein FliF [Pantoea sp. At-9b]
 gi|316950216|gb|ADU69691.1| flagellar M-ring protein FliF [Pantoea sp. At-9b]
          Length = 571

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 117/412 (28%), Positives = 197/412 (47%), Gaps = 53/412 (12%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I   L++ NI ++ ++NG ++ VP+  V + R+ LA QG
Sbjct: 48  WAKAPDYRVLYSNLSDEDGGAIVTQLTQMNIPYQFAENGGALMVPADKVHELRLRLAQQG 107

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL DK   FG++ F +++   RALEGE+ARTI+++  + +AR+H+ MP  
Sbjct: 108 LPKGGS-VGFELMDK-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARIHLAMPKP 165

Query: 162 GSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKL 216
             F +    P+ASV +     RA++       +A+ H+V+++VP L  G+VTV+D  G+L
Sbjct: 166 TLFVREQKAPSASVTLNLQPGRALDEG---QIQAVVHMVSSSVPGLPPGNVTVVDQAGRL 222

Query: 217 LTANEME-RNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           LT ++ E R++    L     ++   +  I   L   +G  N  + V A+LN D  +  +
Sbjct: 223 LTRSDSEGRDLNDAQLKYTAEVEGRYQQRIEAILNPIVGQGNVHAQVTAQLNFDRSEQTD 282

Query: 276 IVYDPDSKVERSIRLSKDAQRSE--------------TSQPESAVTVEQNMPHVSDRKV- 320
             Y P+   + S   S+    SE              ++QP  A T     P  ++    
Sbjct: 283 EKYQPNGSPDNSAIRSRQTSTSEQNGSPYPGGVPGALSNQPAPANTAPVTNPPANNANGQ 342

Query: 321 ---------------PLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNK 365
                              S  +  ++++  NYE++     T  +   ++RLS+AVVVN 
Sbjct: 343 NANGQNNAANGTNTSTTQNSGPSNSRRDDTVNYELDRTIRHTKLNVGDVQRLSVAVVVNY 402

Query: 366 GRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
                   R+ D+GK     D  + +I  +   A G +  RGD+I + +  F
Sbjct: 403 --------RADDKGKEVALNDQQIKQIEDLTREAMGYSQTRGDSINVVNSPF 446


>gi|257095338|ref|YP_003168979.1| flagellar MS-ring protein [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257047862|gb|ACV37050.1| flagellar M-ring protein FliF [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 578

 Score =  155 bits (392), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 123/438 (28%), Positives = 212/438 (48%), Gaps = 51/438 (11%)

Query: 19  RTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISD 78
           R ++L++ SV  V + L +AA   +    +  L+  +   D   I  AL + N+ ++ S+
Sbjct: 31  RQKVLLIVSVAAV-VTLLIAAATLLRQGEFKVLFSNIGERDGGAIIAALEQMNVPYKFSE 89

Query: 79  NGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGE 138
           +GS+I V  S V   R+ LAAQGLP   +  G+EL +    FG++ F +++   R LEGE
Sbjct: 90  SGSAILVHDSRVHDVRLRLAAQGLPRGGA-VGFELME-AQKFGVSQFAEQVNYQRGLEGE 147

Query: 139 IARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRH 193
           ++RTIQSI+ + AARVH+ +P    F +   +P+ASV++     R++ P   +    I++
Sbjct: 148 LSRTIQSIAAVQAARVHLAIPKPSVFMREELKPSASVLLNLYPGRSLEP---RQIAGIQN 204

Query: 194 LVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSL-----SIVQAIQHEIEMNINKA 248
           LVAA+VP L    VT+LD +G LL+  +M+  +L   L       +Q ++  +   +   
Sbjct: 205 LVAASVPQLAPTSVTLLDQSGALLS--QMKSKLLEAGLDPTQVKYIQEVEASVIKRVEDI 262

Query: 249 LAAFLGVDNFRSAVVAELNMDTQQIREIVYDPD-SKVERSIRLSKDAQRSETS------- 300
           LA  +G  N R  + A+++    +     + P+ +  E SIR  + ++ + TS       
Sbjct: 263 LAPIVGPGNARVQIAADIDFSQSEQTAETHRPNATPPEISIRSQQSSETASTSPAAQGVP 322

Query: 301 -----QPESAVTVEQNMPHV------SDRKVPLPRSLEN--------------TDKKEEQ 335
                QP    T     P V      +    P+P  +                +  K   
Sbjct: 323 GALSNQPPVPATAPLTQPPVPGAGGAAPATPPVPGQINVAGVQAPVASVGPPISTSKNST 382

Query: 336 SNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAA 395
            NYE++            ++RLS AVVVN+ +     G++ ++   D+ + +I+ +V  A
Sbjct: 383 VNYEVDKTIRHVRQAVGTIKRLSAAVVVNQRKEVAKDGKAVNKPLPDAEVKQISDLVKEA 442

Query: 396 TGINSRRGDTITITSMDF 413
            G N  RGDTI++ +  F
Sbjct: 443 MGFNKERGDTISVANAPF 460


>gi|332095496|gb|EGJ00512.1| flagellar M-ring protein FliF [Shigella dysenteriae 155-74]
          Length = 473

 Score =  155 bits (392), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 119/416 (28%), Positives = 200/416 (48%), Gaps = 36/416 (8%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+    ++   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTE--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +   L  S +Q      + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPDGKPLPLSNEQ------MKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|323948358|gb|EGB44345.1| flagellar M-ring protein FliF [Escherichia coli H120]
          Length = 552

 Score =  155 bits (392), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 200/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R+S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRVSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+    ++   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|90104474|gb|ABD86511.1| flagellar M-ring protein FliF [Rhodopseudomonas palustris BisB18]
          Length = 547

 Score =  155 bits (392), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 148/555 (26%), Positives = 254/555 (45%), Gaps = 36/555 (6%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           L+ F K    LG  R++ + +V    I  F      V +P    L+  L V D + I   
Sbjct: 12  LVSFLKG---LGAARLMAMIAVTAALIGFFAFVIMRVTTPQMTTLFTDLSVEDSSGIIKD 68

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L    I F I + GS I VP   V + R+ LA +G        GYE+FDK ++ G TSF+
Sbjct: 69  LERQAIPFEIRNEGSVIMVPKDKVTRLRMKLA-EGGLPKGGGVGYEIFDKSDALGSTSFV 127

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           Q I  +RALEGE+ARTI++I  I AARVH+V+P+   F +    P+AS+++R       +
Sbjct: 128 QNINHLRALEGELARTIRAIDRIQAARVHLVLPERPLFSRETPEPSASIVLRVRGALEPQ 187

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL----TANEMERNILGKSLSIVQAIQHEIE 242
              AIRH+VA+AV  L    V+++D  G+LL      +       G         +  + 
Sbjct: 188 QVRAIRHVVASAVNGLKPQRVSIVDEAGQLLADGAAGDPASDGATGDERR--AGFEKRMR 245

Query: 243 MNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQP 302
             +   +++ +G    R  + A+ + +        +DP+ +V RS +  +++ ++  +  
Sbjct: 246 NQVEAIVSSVVGSGRARVQLTADFDYNKVTQTSDKFDPEGRVLRSSQSREESSQTAAAN- 304

Query: 303 ESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVV 362
           +  VTV   +P           + + + K EE +NYEI+  +     +  ++ R+S+AV+
Sbjct: 305 DGQVTVNNELPGAQAGAG-AAVARDQSKKSEETNNYEISRVTKTEITEAGRVNRISVAVL 363

Query: 363 VNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNS- 421
           V+        G    Q +    L  I  +V +A G + +RGD + + ++ F E       
Sbjct: 364 VDGIYGKNDKGEMVYQERSKDQLDRIAALVRSAIGFDQKRGDQVEVVNLRFAEAPSVPPV 423

Query: 422 -------GTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEV 474
                  G VQ +  D++      VI   V ++  L+V F+ +  L R   I  A+ G  
Sbjct: 424 AEPGGLLGMVQFTKDDVM-----YVIELAVMMLLGLVVMFMVIRPLVR--RILAAEPGAA 476

Query: 475 GGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHM 534
           G   +   P ++ A  T + P D + L +   ++        +++   V  QS  R+  +
Sbjct: 477 GANGV---PALTDASGTAIGP-DGLPLVAPGPNMIDI-----AQVQGQVHAQSVHRVGEL 527

Query: 535 IEINEERFAKILRKW 549
            + N    A I+R+W
Sbjct: 528 ADRNPNETAAIVRQW 542


>gi|71906412|ref|YP_283999.1| flagellar MS-ring protein [Dechloromonas aromatica RCB]
 gi|71846033|gb|AAZ45529.1| Flagellar FliF M-ring protein [Dechloromonas aromatica RCB]
          Length = 584

 Score =  155 bits (392), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 131/452 (28%), Positives = 220/452 (48%), Gaps = 50/452 (11%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +   P +  L+  L   D   I+  L + NI  R S++G+ + VPS  V + R+ LA+Q
Sbjct: 52  LWSRQPDWKVLFSNLTEKDGGSIAAILEQQNIPHRYSNSGALL-VPSDRVHEVRLKLASQ 110

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP      G+EL +    FG++ F +++   R LEGE+ARTIQSI  + +ARVH+ +P 
Sbjct: 111 GLPRGGM-VGFELMEN-QKFGVSQFAEQVNYQRGLEGELARTIQSIGSVQSARVHLAIPK 168

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +   +PTASVM+           +   I HLV+++VP L   +VTVLD +G LL+
Sbjct: 169 PSVFVREEQKPTASVMLNLYPGRTLDGGQIAGITHLVSSSVPQLPASNVTVLDQSGALLS 228

Query: 219 ---ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNM-DTQQIR 274
              +   E  +    +  V  +++ I   I++ L+  LG DNF+  V A+++   T+Q  
Sbjct: 229 QLKSKLTEAGLDPTQIKYVHDVENSIIKRIDEILSPLLGADNFKVQVAADIDFSQTEQTA 288

Query: 275 EIVYDPDSKVER-SIRLSKDAQRSETSQP----ESAVTVEQNMPHVSDRKVPLPRSLENT 329
           E  Y P++  E  SIR  ++ + +  +Q       A+T +  +P  +    P   +    
Sbjct: 289 E-SYRPNNTPESTSIRSQQNNETANVNQAAGGVPGALTNQPPVPATAPLTQPATGTTPGQ 347

Query: 330 DKKEEQSNYEINT-----------KSIATTHD---NYKLE--------------RLSIAV 361
             K  +   +I+            + I+T+ +   NY+L+              RLS AV
Sbjct: 348 PAKPGEPQGKIDAAGVTAPLNAAGQPISTSKNATINYELDKTIRHTRQGMGNIRRLSAAV 407

Query: 362 VVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITI-----TSMDFLEN 416
           VVN  +  +  G+   +   D+ + +IN++V  A G    RGDT+++     T++D  EN
Sbjct: 408 VVNHRKDVDKTGKPLTKAIPDAEMKQINELVREAMGFTKERGDTLSVANAPFTAIDKSEN 467

Query: 417 QL-FNSGTVQVSFM-DILSRHFATVINALVFL 446
           +L        VS++ DIL       I A +++
Sbjct: 468 ELPIWKDPENVSYIKDILKYLLIAAIIAFLYI 499


>gi|296283238|ref|ZP_06861236.1| flagellar MS-ring protein [Citromicrobium bathyomarinum JL354]
          Length = 514

 Score =  155 bits (392), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 120/431 (27%), Positives = 209/431 (48%), Gaps = 30/431 (6%)

Query: 51  LYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSG 110
           LY  L+ +    I+  L   N+ F +S +G+++  P + + + R+ +A + L       G
Sbjct: 31  LYTDLDPTAAQAITEKLRAQNVPFSLSGDGTAVMAPENRLPELRMSMAGEQL---GGAIG 87

Query: 111 YELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGAR 170
           YE+ D   +FG++S  +++   RA+EGE+ R+I ++  IV ARVH+VMP+   F     +
Sbjct: 88  YEVLDTQQAFGVSSSREKMNETRAIEGELGRSIATLQSIVNARVHLVMPERALFAPEARK 147

Query: 171 PTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKS 230
            +ASV ++        + EAIR+LVAAAVP L    ++++D TG LL A   E    G S
Sbjct: 148 ASASVTVKTRGKLSSGNVEAIRYLVAAAVPELSPESISIVDQTGALL-ARAGEAGEAGAS 206

Query: 231 LSIVQAIQHE--IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKV-ERS 287
            +  + +  E  I   I   +   +GV   R+ V AE++ D  +    V+DPD++V  R 
Sbjct: 207 QADERQVATEARIRSQIEALIEPIVGVGKVRAEVSAEIDRDQTREESEVFDPDTQVIARQ 266

Query: 288 IRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENT-DKKEEQSNYEINTKSIA 346
           I +    Q  E +     VTV   +P   D       + E+  ++  E   ++ +++   
Sbjct: 267 ISVESGDQNRENAGATPGVTVGAQLPEGGDVMGGGGDTRESARNETSEDITFQNSSRRTL 326

Query: 347 TTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTI 406
           TT    K+ RL++AV+V+ G          +QG     +  + ++V  A G ++ RGD++
Sbjct: 327 TTRTPGKVSRLTVAVMVDGG----------EQGLPAPQVQRLTRLVENAVGYDAERGDSV 376

Query: 407 TITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLV-TFLGLHALR--RL 463
            + SM F +              D     ++ +    +F +G LLV   +GL  LR  R 
Sbjct: 377 IVESMPFAQPD---------EIADAEGDFWSDLPLGQLFDLGKLLVIAVVGLFVLRMLRP 427

Query: 464 HNIDDAKKGEV 474
            N+  +  G++
Sbjct: 428 KNVPASAAGQL 438


>gi|187926897|ref|YP_001893242.1| flagellar M-ring protein FliF [Ralstonia pickettii 12J]
 gi|241665226|ref|YP_002983585.1| flagellar M-ring protein FliF [Ralstonia pickettii 12D]
 gi|187728651|gb|ACD29815.1| flagellar M-ring protein FliF [Ralstonia pickettii 12J]
 gi|240867253|gb|ACS64913.1| flagellar M-ring protein FliF [Ralstonia pickettii 12D]
          Length = 611

 Score =  155 bits (392), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 131/483 (27%), Positives = 228/483 (47%), Gaps = 79/483 (16%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  L+  +  +D   I  AL + N+ +R +D G++I VP + V + R+ LA+QG
Sbjct: 67  WSRAPDYRVLFSNVSDADGGAIIAALQQMNVPYRFADGGTAIMVPEANVHETRLKLASQG 126

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP     +G+EL +    FG + F +++   RALEGE+ARTIQ++  + +ARVH+ +   
Sbjct: 127 LPKGGL-AGFELMEN-QKFGTSQFAEQVNYQRALEGELARTIQAMQEVQSARVHLALSKP 184

Query: 162 GSFRKIGARPTASVMIRAINPSVYKS-------AEAIRHLVAAAVPNLDMGDVTVLDSTG 214
             F +  A+P+ASV++     ++Y          +AI HLV+++VPNL + +VTV+D  G
Sbjct: 185 SVFVREQAKPSASVLL-----TLYPGRMLDRSQVQAIGHLVSSSVPNLPLANVTVVDQAG 239

Query: 215 KLLTANEMERNILG---KSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMD-T 270
           +LL+++  + N  G     L+ V+ I+      I   L   +G DN R+ V A++++D T
Sbjct: 240 RLLSSS-FQDNASGLDPTQLNYVREIEQGYIKRIEAILGPVVGDDNVRAQVTADVDLDNT 298

Query: 271 QQIREIV---YDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDR--------- 318
           +Q+ E      DP +   RS   ++  Q    +Q         N P  + R         
Sbjct: 299 EQMAETYRPNQDPSTAAVRSTHTAESTQNKADAQ-GGVPGALSNQPPTAPRMLPTAPAPA 357

Query: 319 -------------KVPLP---------RSLENTDKKEEQSNYEINTKSIATTHDNYKLER 356
                        +   P          +   +  ++  +NYE++     T      + R
Sbjct: 358 SQPAAAGPNGANGQAQQPAAANTNATTTNGATSSTRDTTTNYEVDKTVRRTRAAVGTVRR 417

Query: 357 LSIAVVVN---KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           LS+AVVVN    G+  + L         D+ +A++N +V  A G +++RGD++ + +  F
Sbjct: 418 LSVAVVVNYRADGKTWKPLS--------DAEMAKLNALVKDAVGFDAKRGDSVNVVNSQF 469

Query: 414 LENQLFNSGTVQVSFMDI-------LSRHFATVINALVFLVGTLLVTFLGLHALRRLHNI 466
                  SGT+ V   D+       + ++       L   +G L++ F  +  L R  N 
Sbjct: 470 -------SGTLPVPKDDLPLWKQPEMIQYAIQAAKYLALAIGFLILVFAVIRPLIRSLNK 522

Query: 467 DDA 469
            DA
Sbjct: 523 KDA 525


>gi|121608098|ref|YP_995905.1| flagellar M-ring protein FliF [Verminephrobacter eiseniae EF01-2]
 gi|121552738|gb|ABM56887.1| flagellar M-ring protein FliF [Verminephrobacter eiseniae EF01-2]
          Length = 562

 Score =  155 bits (392), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 120/393 (30%), Positives = 199/393 (50%), Gaps = 30/393 (7%)

Query: 44  NSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLP 103
           + P Y  L+  L   D   I   LS+ N+ +R+++ G +I VP+  V + R+ LA+QGLP
Sbjct: 60  HQPDYRVLFGNLSDKDGGTIVAQLSQMNVPYRLAEGGGAILVPADRVHEVRLRLASQGLP 119

Query: 104 SSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGS 163
             S   G+EL +  + FG+T F + +   R LEGE+ R+IQ++S + +ARVH+ +P+   
Sbjct: 120 KGSV-VGFELMES-SKFGVTQFQERLNFRRGLEGELTRSIQALSPVQSARVHLALPEQNG 177

Query: 164 FRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLT--- 218
           F +   +P+ASV++        + A+   I HLVAA+VP +    V+VLD TGKLL+   
Sbjct: 178 FFREQQKPSASVLVSLYPGRFLERAQLAGIVHLVAASVPEMAPSAVSVLDDTGKLLSRSP 237

Query: 219 --ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNM-----DTQ 271
             A + E N   + L  VQ I+ +    I   L   +G DN ++ V A+++       ++
Sbjct: 238 DGAADAEVN--AQQLLHVQRIEQQYTRRILDILEPVVGRDNVKAQVTADVDFTQTESSSE 295

Query: 272 QIREIVYDPDSKVERSIRL---SKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSL-- 326
           Q R     P+S   RS +L      A +  T  P  AV+ +  +P  +    P P     
Sbjct: 296 QFRP-NQQPESGAVRSQQLLESRSGANKLPTGIP-GAVSNQPPVPSTAPINGPNPAPNAG 353

Query: 327 ------ENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGK 380
                 E T+K+E  +NYE++            ++RLS AVVVN   + +  GR+  +  
Sbjct: 354 GQQGPDEQTNKRESTTNYELDRTVRVVRGSTGTVKRLSAAVVVNYQSVLDK-GRAVSRAL 412

Query: 381 IDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
               + ++  +V  + G +S RGD++ + +  F
Sbjct: 413 TPEQIGQMTALVRESIGFDSARGDSVNLMNTPF 445


>gi|91776330|ref|YP_546086.1| flagellar M-ring protein FliF [Methylobacillus flagellatus KT]
 gi|91710317|gb|ABE50245.1| flagellar M-ring protein FliF [Methylobacillus flagellatus KT]
          Length = 586

 Score =  155 bits (392), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 115/416 (27%), Positives = 190/416 (45%), Gaps = 51/416 (12%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +   P Y  L+      D   I  AL + N+ +RI+D GS+I VP++ V   R+ LA+Q
Sbjct: 51  LWSQKPEYRVLFSSYSDKDGGAIVAALEQMNVPYRIADGGSAILVPANHVHDVRLRLASQ 110

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP    N G+EL +    FG++ F++++   R LEGE+ RTIQSI  + AAR+H+ MP 
Sbjct: 111 GLPKGG-NIGFELLEN-QKFGVSQFVEQVNFQRGLEGELERTIQSIGAVQAARIHLAMPK 168

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +   +PTASVM+     RA++    +   AI HLVA++VP L   +VTV+D  G 
Sbjct: 169 PTVFTRDQQKPTASVMLNLHPGRALD---QRQVSAIVHLVASSVPELPTSNVTVVDQNGN 225

Query: 216 LLTANEME----RNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQ 271
           LL+ N  +      +    L  V  +Q  I   +   +A  +G  N  +   AE++    
Sbjct: 226 LLSDNGKDAGNHYQLDPTQLKYVDELQQNIARRVESIIAPLVGAKNVHAEASAEVDFSMV 285

Query: 272 QIREIVYDPDSKVERSIRLSKDAQRSE--------------TSQPESAVTVEQNMPHVSD 317
           +    +Y P+   + +   S     S+              T+QP +  T     P V+ 
Sbjct: 286 EQAAEIYKPNQAPDSAAIRSSQTNESQTLPGQGVGGVPGALTNQPPAPATA----PIVAP 341

Query: 318 RKVPLPRSLEN-------------------TDKKEEQSNYEINTKSIATTHDNYKLERLS 358
              P   +  N                     ++   +NYE++            ++RL+
Sbjct: 342 GTEPTTTTNANVVTTTTTTPPGTTVTTPVMNSERNTTTNYEVDKTIRYQQQPMGGIKRLT 401

Query: 359 IAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFL 414
           +AVVVN  +  +  G+   +   D    +I+ +   A G N  RGD++++ +  F+
Sbjct: 402 VAVVVNHKQEVDAQGKVITRPLTDDEKTQISDLAKQAMGFNEERGDSLSVVNGSFM 457


>gi|307312476|ref|ZP_07592110.1| flagellar M-ring protein FliF [Escherichia coli W]
 gi|306907647|gb|EFN38150.1| flagellar M-ring protein FliF [Escherichia coli W]
 gi|315061238|gb|ADT75565.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           W]
 gi|323378185|gb|ADX50453.1| flagellar M-ring protein FliF [Escherichia coli KO11]
          Length = 552

 Score =  155 bits (391), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 199/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R+S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRVSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|310767344|gb|ADP12294.1| flagellar MS-ring protein [Erwinia sp. Ejp617]
          Length = 569

 Score =  155 bits (391), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 141/554 (25%), Positives = 258/554 (46%), Gaps = 70/554 (12%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +   P Y  L+  L   D   I   L++ N+ ++  D G ++ VP++ V + R+ LA+Q
Sbjct: 46  LWAKQPDYRVLFSNLSNEDGGTIVTQLTQMNVPYKFDDQGGALLVPAAQVHELRLRLASQ 105

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL DK   FG++ F +++   RALEGE+ARTI ++  +  ARVH+ MP 
Sbjct: 106 GLPKGGA-VGFELLDK-EKFGISQFSEQVNYQRALEGELARTISTLGPVKDARVHLAMPK 163

Query: 161 MGSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +    P+ASV + A+ P          A+ H+V+++V  +  G+VTV+D  G+LL
Sbjct: 164 PTLFVREQKSPSASVTL-ALQPGRALDEGQINAVVHMVSSSVAGMPPGNVTVVDQAGRLL 222

Query: 218 TANEM-ERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI 276
           T N+   R++    L     ++   +  I   L   LG  N  + V A+++ + ++  + 
Sbjct: 223 TQNDSGGRDLNDTQLKYANDVETRYQQRIEAILGPILGNGNVHAQVTAQIDFNKREKTDE 282

Query: 277 VYDPDSKVERSIRLSKDAQRSETSQPESAVTVE---QNMPHVSDRKVPLP---------- 323
            Y P+S+ ++    S+    SE     SA  V     N P  ++     P          
Sbjct: 283 QYSPNSQPDQQAIRSRQTSNSEQLGGSSAGGVPGALSNQPAPANAAPVTPANNNANNANA 342

Query: 324 ----------------RSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGR 367
                           +++ +  + +  +NYE+N   + T  +  +++RLS+AVVVN   
Sbjct: 343 NANNGQPANNAANAAQKTVPSNTRSDNTTNYEVNRTILHTKMNVGEVQRLSVAVVVNY-- 400

Query: 368 LTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG- 422
                 R+   GK     D+ + +I  +   A G + +RGD++ + +  F +N    +  
Sbjct: 401 ------RADAAGKPIALKDAQIKQIENLTREAMGFSEQRGDSLNVVNSQFTDNSDLAAEL 454

Query: 423 --TVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL 480
               Q +F+D L        NA  +L+  L+V F+     R+L +    +K E    +  
Sbjct: 455 PFWKQPAFIDQL-------FNAGRWLL-VLIVAFI---LYRKLVSPQLRRKAEQQKAAEE 503

Query: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540
           +    + + T     ++ +A+ S ++D  +  R  Q R+++ V  Q   R+  M E +  
Sbjct: 504 AAINAARSSTR----DEGVAV-SLSKDELNQERKSQHRMSAEVLSQ---RIREMSENDPR 555

Query: 541 RFAKILRKWARSEI 554
             A ++R+W + E+
Sbjct: 556 VVALVIRQWMKDEL 569


>gi|300923899|ref|ZP_07139914.1| flagellar M-ring protein FliF [Escherichia coli MS 182-1]
 gi|300419862|gb|EFK03173.1| flagellar M-ring protein FliF [Escherichia coli MS 182-1]
          Length = 552

 Score =  155 bits (391), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 200/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R+S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRVSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKEARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+    ++   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPVPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|323977881|gb|EGB72967.1| flagellar M-ring protein FliF [Escherichia coli TW10509]
          Length = 552

 Score =  155 bits (391), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 199/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+    ++   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDKSQAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNNGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|312946531|gb|ADR27358.1| flagellar MS-ring protein [Escherichia coli O83:H1 str. NRG 857C]
          Length = 552

 Score =  155 bits (391), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 199/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+    ++   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|238920311|ref|YP_002933826.1| flagellar MS-ring protein [Edwardsiella ictaluri 93-146]
 gi|238869880|gb|ACR69591.1| flagellar M-ring protein FliF, putative [Edwardsiella ictaluri
           93-146]
          Length = 569

 Score =  155 bits (391), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 126/450 (28%), Positives = 222/450 (49%), Gaps = 53/450 (11%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           L+LAS + + I++ +A   +  +P Y  LY  +   D   I   L++ NI +R ++NG++
Sbjct: 35  LLLASAVAIAIVVVLA--LWARAPDYRVLYSNISDRDGGAIVTQLTQMNIPYRFANNGTT 92

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           + VP+S V   R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE+ART
Sbjct: 93  LMVPASDVYATRLKLAQQGLPRGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELART 150

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I+++  +V+ARV +  P    F +   +P+ASV +      V    +  AI ++V+++V 
Sbjct: 151 IETLGPVVSARVLLAEPKPSLFVREQKQPSASVTLTLEPGRVLDDGQINAIVYMVSSSVA 210

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VTV+D  G LL+  +   R++    L     ++  ++  I   L   LG  N  
Sbjct: 211 GLPPGNVTVVDQYGHLLSQPDGTGRDLNAAQLKFTAEVESRLQRRIETILQPMLGNGNVH 270

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS---QPESAVTVEQNMP--- 313
           + V A+L+  +++  +  Y P+    ++   SK   +S+ S   Q         N P   
Sbjct: 271 AQVTAQLDFASREQTDEEYTPNQPPNQAAVRSKQINQSDQSGGLQSGGVPGALSNEPAPA 330

Query: 314 ---HVSDRKVPLPRSLENTD----------------------KKEEQSNYEINTKSIATT 348
              H++ +    PRS +  +                      +++E  NYE++     T 
Sbjct: 331 PTGHINGK----PRSAQGGNGAANRSNAVSNNGRQSSRSENFRRDETINYEVDRTIRHTK 386

Query: 349 HDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITI 408
                +ERLS+AVVVN    T+    +  Q K+D    +IN +V  A G +  RGDT+++
Sbjct: 387 ARAGTIERLSVAVVVNYASDTKGKEVALSQQKMD----QINNLVREAMGFSQSRGDTLSV 442

Query: 409 TSMDFLENQLFNSG-----TVQVSFMDILS 433
            +  F  N + ++G       + +F+D+L+
Sbjct: 443 VNTPF--NSVEDNGGELPFWQKQAFIDLLT 470


>gi|156933442|ref|YP_001437358.1| flagellar MS-ring protein [Cronobacter sakazakii ATCC BAA-894]
 gi|156531696|gb|ABU76522.1| hypothetical protein ESA_01260 [Cronobacter sakazakii ATCC BAA-894]
          Length = 565

 Score =  154 bits (390), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 120/409 (29%), Positives = 198/409 (48%), Gaps = 48/409 (11%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +   P Y  LY  L   D   I   L++ NI +  +DNG+SI VP+  V   R+ LA QG
Sbjct: 46  WAKQPEYRVLYSNLSDQDGGAIVTQLTQMNIPYNFADNGASIMVPAEKVYDLRLRLAQQG 105

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  +  ARVH+ MP  
Sbjct: 106 LPKGGA-VGFELMDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKNARVHLAMPKP 163

Query: 162 GSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKL 216
             F +    P+ASV +     RA++        AI H+V++AV  L  G+VT++D TG+L
Sbjct: 164 SLFVREQKSPSASVTLNLQPGRALDDG---QVAAIVHMVSSAVAGLPPGNVTLVDQTGRL 220

Query: 217 LT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           LT +    R++    L     ++  I+  I   LA  +G  N  + V A+++   ++  E
Sbjct: 221 LTQSGTGARDLNDAQLKYASDVEGRIQRRIESILAPIVGTGNVHAQVTAQIDFSNKEQTE 280

Query: 276 IVY----DPDSKVERSIRLSKDAQ----------RSETSQPESAVTVEQNMP-------- 313
             Y    DP     RS +L+ + Q           + ++QP  A +   + P        
Sbjct: 281 EQYRPNSDPSQMAVRSRQLNTNDQVGGAYPGGVPGALSNQPAPANSAPIDAPAGQNNGQN 340

Query: 314 -------HVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG 366
                             S  ++ +++E +NYE++     T  +   ++RLS+AVVVN  
Sbjct: 341 ANGQNAQRTQSTSTAGASSGPHSSQRDETTNYEVDRTIRHTKMNVGDVQRLSVAVVVNYR 400

Query: 367 RL--TEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           +L   + L  +A+Q      L +I  +   A G + +RGDT+ + +  F
Sbjct: 401 QLGNGKPLALTAEQ------LKQIEDLTREAMGYSDKRGDTLNVVNSQF 443


>gi|317121815|ref|YP_004101818.1| flagellar M-ring protein FliF [Thermaerobacter marianensis DSM
           12885]
 gi|315591795|gb|ADU51091.1| flagellar M-ring protein FliF [Thermaerobacter marianensis DSM
           12885]
          Length = 560

 Score =  154 bits (390), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 112/340 (32%), Positives = 175/340 (51%), Gaps = 26/340 (7%)

Query: 44  NSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLP 103
            +P ++ L+ +L+ +D   I   L E  + ++++  G +I VP + V + R+ LAAQGLP
Sbjct: 59  GNPRWEPLFTRLDPADAAAIVSQLEEKGVPYQLAQGGQAILVPGTEVDRLRLELAAQGLP 118

Query: 104 SSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGS 163
              +  G EL D +   G T F +++  VR L+GE+ARTI  + G+ AARVH+V+P+   
Sbjct: 119 REGT-VGLELMDSI-PMGATEFERQVQYVRGLQGELARTISRLDGVEAARVHVVLPEDSP 176

Query: 164 FRKIGA-RPTASVMIRAINPSVYKSAEAIR---HLVAAAVPNLDMGDVTVLDSTGKLLTA 219
           F  +G  RP  + ++  + P    + E +R   HLVA+AV  L   DVTV+D+TG+LL+A
Sbjct: 177 F--VGQRRPATAAVLVQLKPGASLAPEQVRSIMHLVASAVEGLKPEDVTVVDTTGRLLSA 234

Query: 220 NEMERN-----ILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
                      + G    I +  + E++ ++   L   LG  N  + V AELN D Q I 
Sbjct: 235 EVPPEEGQGAVVQGDRFEIERRFEQELQQSLQTLLEQVLGPGNVIARVNAELNFDQQVIE 294

Query: 275 EIVYDPDSKVERSI-RLSKDAQRSETSQPESAVTVEQNMPHVSDRKVP-LPRSLENT--- 329
             ++ P +   + I R  ++ Q + T Q      V   +P   D  +P  P+ +  T   
Sbjct: 295 RHLFQPPADGGQGILRSIQELQETFTGQ-----GVPVGVP--GDSNIPTYPQLVGGTGQY 347

Query: 330 DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLT 369
            + E  +NYEIN            + RLS+AVVVN G LT
Sbjct: 348 QRTERTANYEINEVVDRVQVAPGAVRRLSVAVVVN-GDLT 386


>gi|323961982|gb|EGB57581.1| flagellar M-ring protein FliF [Escherichia coli H489]
          Length = 552

 Score =  154 bits (390), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 199/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKTPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+    ++   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|324005863|gb|EGB75082.1| flagellar M-ring protein FliF [Escherichia coli MS 57-2]
          Length = 552

 Score =  154 bits (390), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 199/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+    ++   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|15802373|ref|NP_288399.1| flagellar MS-ring protein [Escherichia coli O157:H7 EDL933]
 gi|15831931|ref|NP_310704.1| flagellar MS-ring protein [Escherichia coli O157:H7 str. Sakai]
 gi|168751866|ref|ZP_02776888.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4113]
 gi|168758251|ref|ZP_02783258.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4401]
 gi|168764438|ref|ZP_02789445.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4501]
 gi|168771544|ref|ZP_02796551.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4486]
 gi|168777364|ref|ZP_02802371.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4196]
 gi|168783334|ref|ZP_02808341.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4076]
 gi|168790304|ref|ZP_02815311.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str. EC869]
 gi|168802284|ref|ZP_02827291.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str. EC508]
 gi|195939244|ref|ZP_03084626.1| flagellar MS-ring protein [Escherichia coli O157:H7 str. EC4024]
 gi|208810543|ref|ZP_03252419.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4206]
 gi|208817037|ref|ZP_03258157.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4045]
 gi|208820542|ref|ZP_03260862.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4042]
 gi|209395809|ref|YP_002271054.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4115]
 gi|217328740|ref|ZP_03444821.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           TW14588]
 gi|254793588|ref|YP_003078425.1| flagellar MS-ring protein [Escherichia coli O157:H7 str. TW14359]
 gi|261227567|ref|ZP_05941848.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261254609|ref|ZP_05947142.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           O157:H7 str. FRIK966]
 gi|12516042|gb|AAG56953.1|AE005416_7 flagellar biosynthesis; basal-body MS(membrane and
           supramembrane)-ring and collar protein [Escherichia coli
           O157:H7 str. EDL933]
 gi|13362145|dbj|BAB36100.1| flagellar hook-basal body MS ring protein FliF [Escherichia coli
           O157:H7 str. Sakai]
 gi|187767394|gb|EDU31238.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4196]
 gi|188014158|gb|EDU52280.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4113]
 gi|188999271|gb|EDU68257.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4076]
 gi|189354893|gb|EDU73312.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4401]
 gi|189359720|gb|EDU78139.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4486]
 gi|189365550|gb|EDU83966.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4501]
 gi|189370217|gb|EDU88633.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str. EC869]
 gi|189375710|gb|EDU94126.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str. EC508]
 gi|208725059|gb|EDZ74766.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4206]
 gi|208731380|gb|EDZ80069.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4045]
 gi|208740665|gb|EDZ88347.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4042]
 gi|209157209|gb|ACI34642.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4115]
 gi|209766878|gb|ACI81751.1| flagellar hook-basal body MS ring protein FliF [Escherichia coli]
 gi|209766880|gb|ACI81752.1| flagellar hook-basal body MS ring protein FliF [Escherichia coli]
 gi|209766882|gb|ACI81753.1| flagellar hook-basal body MS ring protein FliF [Escherichia coli]
 gi|209766886|gb|ACI81755.1| flagellar hook-basal body MS ring protein FliF [Escherichia coli]
 gi|217318087|gb|EEC26514.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           TW14588]
 gi|254592988|gb|ACT72349.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           O157:H7 str. TW14359]
 gi|320191912|gb|EFW66559.1| Flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC1212]
 gi|326342348|gb|EGD66129.1| Flagellar M-ring protein FliF [Escherichia coli O157:H7 str. 1044]
 gi|326344853|gb|EGD68600.1| Flagellar M-ring protein FliF [Escherichia coli O157:H7 str. 1125]
          Length = 552

 Score =  154 bits (390), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 199/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSWRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+    ++   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|82543597|ref|YP_407544.1| flagellar MS-ring protein [Shigella boydii Sb227]
 gi|81245008|gb|ABB65716.1| FliF [Shigella boydii Sb227]
 gi|320186947|gb|EFW61661.1| Flagellar M-ring protein FliF [Shigella flexneri CDC 796-83]
 gi|332096898|gb|EGJ01887.1| flagellar M-ring protein FliF [Shigella boydii 3594-74]
          Length = 552

 Score =  154 bits (390), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 198/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTLSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|323186814|gb|EFZ72134.1| flagellar M-ring protein FliF [Escherichia coli RN587/1]
          Length = 552

 Score =  154 bits (389), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 199/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+    ++   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDETQAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPTNQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEALTREAMGFSEKRGDSLNVVNSPF 429


>gi|320182746|gb|EFW57630.1| Flagellar M-ring protein FliF [Shigella boydii ATCC 9905]
          Length = 552

 Score =  154 bits (389), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 199/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+    ++   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|218689933|ref|YP_002398145.1| flagellar MS-ring protein [Escherichia coli ED1a]
 gi|291283115|ref|YP_003499933.1| Flagellar M-ring protein FliF precursor [Escherichia coli O55:H7
           str. CB9615]
 gi|293415248|ref|ZP_06657891.1| flagellar M-ring protein FliF [Escherichia coli B185]
 gi|301644603|ref|ZP_07244592.1| flagellar M-ring protein FliF [Escherichia coli MS 146-1]
 gi|331677820|ref|ZP_08378495.1| flagellar M-ring protein FliF [Escherichia coli H591]
 gi|209766884|gb|ACI81754.1| flagellar hook-basal body MS ring protein FliF [Escherichia coli]
 gi|218427497|emb|CAR08270.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           ED1a]
 gi|290762988|gb|ADD56949.1| Flagellar M-ring protein FliF precursor [Escherichia coli O55:H7
           str. CB9615]
 gi|291432896|gb|EFF05875.1| flagellar M-ring protein FliF [Escherichia coli B185]
 gi|301077078|gb|EFK91884.1| flagellar M-ring protein FliF [Escherichia coli MS 146-1]
 gi|320641786|gb|EFX11174.1| flagellar MS-ring protein [Escherichia coli O157:H7 str. G5101]
 gi|320647145|gb|EFX15978.1| flagellar MS-ring protein [Escherichia coli O157:H- str. 493-89]
 gi|320652429|gb|EFX20727.1| flagellar MS-ring protein [Escherichia coli O157:H- str. H 2687]
 gi|320658031|gb|EFX25793.1| flagellar MS-ring protein [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320658603|gb|EFX26297.1| flagellar MS-ring protein [Escherichia coli O55:H7 str. USDA 5905]
 gi|320668501|gb|EFX35328.1| flagellar MS-ring protein [Escherichia coli O157:H7 str. LSU-61]
 gi|331074280|gb|EGI45600.1| flagellar M-ring protein FliF [Escherichia coli H591]
          Length = 552

 Score =  154 bits (389), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 199/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+    ++   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|297538194|ref|YP_003673963.1| flagellar M-ring protein FliF [Methylotenera sp. 301]
 gi|297257541|gb|ADI29386.1| flagellar M-ring protein FliF [Methylotenera sp. 301]
          Length = 551

 Score =  154 bits (389), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 113/392 (28%), Positives = 191/392 (48%), Gaps = 22/392 (5%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +   P Y  L+      D   I   L + N+ ++ SD+G++I VP+S V +AR+ LA+ 
Sbjct: 47  LWSQQPDYRVLFSNYTDKDGGAIVAELEKMNVPYKFSDSGTAILVPASQVHQARLKLASD 106

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP    N G+E+ +    FG++ F++++   RALEGE+ R+IQSI  +  AR+H+ +P 
Sbjct: 107 GLPKGG-NIGFEILEN-QKFGVSQFVEQVNFQRALEGELERSIQSIGAVETARIHLAIPK 164

Query: 161 MGSFRKIGARPTASVM--IRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL- 217
              F +    PTASV+  +RA      +   A+ HLVA++VPNL   +VTV+D  G LL 
Sbjct: 165 ASVFVRDQQSPTASVLLNLRAGRSLDAQQVGAVVHLVASSVPNLPAANVTVVDQNGNLLS 224

Query: 218 -TANEMERNILGKS-LSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
            T+ +M  N L  + L  +  IQ  I   +   +   +G  N R+   AE++  + +   
Sbjct: 225 DTSKKMGANNLDPTQLKYIDDIQQSIIKRVESIITPIVGAKNVRAEASAEIDFSSLEQAA 284

Query: 276 IVYDPDSKVERSIRLSKDAQRSETSQPESAVTVE---QNMPHVSDRKVPLPRSLEN---- 328
            +Y P+ K + +   S  +  S TS   +A  V     N P   +   P+          
Sbjct: 285 EIYKPNQKPDDAAIRSLQSNESLTSNGGAATGVPGALSNQPP-PNATAPITTPAGAAPGA 343

Query: 329 -------TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKI 381
                   ++K   +N+E++     +      ++RL++AVVVN   + +  G+   +   
Sbjct: 344 TAEAAPVNNQKNTTTNFEVDKTVRYSQQGMGGIKRLNVAVVVNNMPVVDKKGKVTYRPLT 403

Query: 382 DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
            +   +IN +   A G N  RGD +T+ +  F
Sbjct: 404 AAEKTQINDLAMQAMGFNKERGDALTVVNSSF 435


>gi|324114219|gb|EGC08192.1| flagellar M-ring protein FliF [Escherichia fergusonii B253]
          Length = 552

 Score =  154 bits (389), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 121/419 (28%), Positives = 201/419 (47%), Gaps = 42/419 (10%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +++ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVIVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D +G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNVH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS--------------QPESA 305
           + V A+L+  +++  E  Y P+    ++   S+    SE S              QP  A
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDQSQATLRSRQVNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 306 VTVEQNMP---------HVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLER 356
            +   + P           S      PRS +    + E SNYE++     T  +   ++R
Sbjct: 321 NSAPISTPPANQNNRQQQTSTSSNSGPRSTQ----RNETSNYEVDRTIRHTKMNVGDVQR 376

Query: 357 LSIAVVVNKGRLTE--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           LS+AVVVN     +   L  SA+Q      + +I  +   A G + +RGD++ + +  F
Sbjct: 377 LSVAVVVNYKATPDGKPLPLSAEQ------MKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|331653350|ref|ZP_08354355.1| flagellar M-ring protein FliF [Escherichia coli M718]
 gi|331049448|gb|EGI21520.1| flagellar M-ring protein FliF [Escherichia coli M718]
          Length = 552

 Score =  154 bits (389), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 198/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLTA-NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT  N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQFNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGKGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+    ++   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|317052367|ref|YP_004113483.1| flagellar M-ring protein FliF [Desulfurispirillum indicum S5]
 gi|316947451|gb|ADU66927.1| flagellar M-ring protein FliF [Desulfurispirillum indicum S5]
          Length = 558

 Score =  154 bits (389), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 129/419 (30%), Positives = 213/419 (50%), Gaps = 35/419 (8%)

Query: 17  LGRTRILILASVI---LVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANID 73
           L RT+ + LA VI   ++ I+  +      + P    L+  L + D   ++  L+E  + 
Sbjct: 19  LSRTQQITLALVIGASVITIITLIIWAVVASRPGNQVLFSNLAMEDAGEVAAKLAELRVP 78

Query: 74  FRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVR 133
           + I ++G +I VP ++V + R++LA QGLP   S  G+E+FD     G+T F+Q++   R
Sbjct: 79  YEIHNDGRTILVPGNVVHETRLNLAQQGLP-RGSGVGFEIFDSA-GIGMTEFIQKVNFRR 136

Query: 134 ALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIR- 192
           AL+GE+ RTI +I GI +ARVHI +P+   F        ASV +R ++P    S + ++ 
Sbjct: 137 ALQGELGRTISAIDGIESARVHIALPERSLFISQDRGAEASVALR-LSPHTRLSGDQVKG 195

Query: 193 --HLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAI-QHEIEMNINKA- 248
             HLV+++V  L    VTV+D  G++L     ER+    +LS+ Q + Q  +E N+  A 
Sbjct: 196 IIHLVSSSVEGLTPEGVTVVDEQGRILNDLIQERS-EESTLSVTQLMYQRNMERNLQIAL 254

Query: 249 ---LAAFLGVDNFRSAVVAELNMDT--QQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
              L + LG  N  S V  EL+ D   QQI    YDP + V RS       QR E  + E
Sbjct: 255 DNLLVSVLGQGNSYSNVSLELDFDKVEQQIE--AYDP-ANVPRS------EQRIE--ERE 303

Query: 304 SAVTVEQNMP----HVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
                +  +P    +++D+  P    +    ++ E +NYE+       T    +++RL++
Sbjct: 304 QGREAQGGIPGVRANIADQDDPEAGLMTTRSREVETTNYEVGRTLTQITRSRGQIKRLTV 363

Query: 360 AVVVNKGRLTEV---LGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLE 415
           AV VN   + +    + +   Q +    L +I  +V +A G N  RGD + +T++ F E
Sbjct: 364 AVAVNGNYVQQQADGVSQVVYQPRSSEELDKITALVQSAIGYNEGRGDRVVVTNLQFGE 422


>gi|312973845|ref|ZP_07788017.1| flagellar M-ring protein FliF [Escherichia coli 1827-70]
 gi|310332440|gb|EFP99675.1| flagellar M-ring protein FliF [Escherichia coli 1827-70]
          Length = 552

 Score =  154 bits (389), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 198/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLTA-NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT  N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQFNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGKGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+    ++   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|99082787|ref|YP_614941.1| flagellar MS-ring protein [Ruegeria sp. TM1040]
 gi|99039067|gb|ABF65679.1| Flagellar M-ring protein [Ruegeria sp. TM1040]
          Length = 571

 Score =  154 bits (389), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 128/398 (32%), Positives = 202/398 (50%), Gaps = 18/398 (4%)

Query: 19  RTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISD 78
           R R++ + + + V I  F       N P    LY  LE S    +  AL ++ +D+ +  
Sbjct: 27  RKRMMAIGATLAV-IFTFFLMSLVANKPSMQLLYAGLESSSAGDVVSALEQSGVDYEV-- 83

Query: 79  NGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGE 138
            G SI VPSS   + R+ LA+QGLP++    GYEL D ++ FG TS M +    RA EGE
Sbjct: 84  RGGSIYVPSSKRDELRMTLASQGLPANGGK-GYELLDSLSGFGTTSQMFDAAYWRAKEGE 142

Query: 139 IARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKS-AEAIRHLVAA 197
           +ARTI +   +  ARVHI       F++    PTASV +  +   +  S A AIR LVA+
Sbjct: 143 LARTIVANPHVSQARVHIANTGSNPFQRT-IEPTASVSVTPMGSPITPSQANAIRFLVAS 201

Query: 198 AVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDN 257
           AV  L + +V V+D+ G L+ + E        +    Q ++  +     + + A +G  N
Sbjct: 202 AVAGLAVDNVAVIDANGALIGSPEAAAAAGAGTDDRSQTLRERVL----RLVEARVGQGN 257

Query: 258 FRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESA-VTVEQNMPHVS 316
               +  E   DT+ IRE   DP S+V  S  +    +R ++SQ ++  VTV  N+P   
Sbjct: 258 AVVEISVETITDTESIREKRVDPQSRVAISTDVE---ERIDSSQNQAGEVTVASNIPDGD 314

Query: 317 DRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVL-GRS 375
                  ++  +T+   E+ NYEI+            ++RL++AV++N G  TE   G +
Sbjct: 315 AGNGEGSKA--STNATRERVNYEISETEKEIVRGPGAIKRLTVAVLIN-GVTTETAEGEA 371

Query: 376 ADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           A + + +  L  + +++SAA G ++ RGD IT+ SMD 
Sbjct: 372 AFEPRPEEELEALRELISAAVGFDAERGDVITLKSMDL 409


>gi|291288216|ref|YP_003505032.1| flagellar M-ring protein FliF [Denitrovibrio acetiphilus DSM 12809]
 gi|290885376|gb|ADD69076.1| flagellar M-ring protein FliF [Denitrovibrio acetiphilus DSM 12809]
          Length = 555

 Score =  154 bits (389), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 132/476 (27%), Positives = 233/476 (48%), Gaps = 27/476 (5%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           MA+ D   QF  +   L   + + +A+ +    +      ++ N P Y  L+  +   D 
Sbjct: 1   MALSDIASQFKDTYLKLSLLQKISVAAALAAVFISVAVIVYWANRPVYKTLFAGMTQDDA 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             +  +L E  I +++ D G+ I++P   V + R++LA + +P     +G ELFDK +SF
Sbjct: 61  ALVVDSLKEQRIPYKLEDGGAKITIPDQYVYETRLNLAKENIPRGGG-AGLELFDK-SSF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           G+T FMQ ++  RAL+GE+ARTI ++  I  ARVH+ +     F        A+V++R  
Sbjct: 119 GMTEFMQNVSYQRALQGELARTITALKEIQEARVHLTVSKDRLFIADEEASKAAVVLRLR 178

Query: 181 NPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN----ILGKSLSIV 234
           + +    AE  AI  LV+ AV  L   +V ++D+ G+LL+    E N    +    L   
Sbjct: 179 SGASLGRAEVQAIASLVSGAVKGLSPENVQIVDTQGRLLSEFLDEENSPLMMTQSQLEYT 238

Query: 235 QAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDA 294
           + I+ ++E  +N+ L A LG  N  + V AE++ + + + +  Y  D+ V RS    +  
Sbjct: 239 KKIERDLERKVNEILGATLGKGNAVAKVTAEIDFNKRDVTKEEYG-DTPVLRS---QQSM 294

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNY-K 353
           + S T++P+    +     ++++  +      +  +K E+  N+EIN K+I      Y  
Sbjct: 295 EISSTNKPDGPQGIPGVQSNLAEPDIGTAGRNQEYNKTEDTQNFEIN-KTITVEQKAYGT 353

Query: 354 LERLSIAVVVN--KGRLTEVLGRSA--DQGKIDSYLAEINKIVSAATGINSRRGDTITIT 409
           ++R+++AVVV+  K R  +  G S    Q + D  +  I  +V+ A G N  RGD I +T
Sbjct: 354 IDRVTVAVVVDDRKIRQQDDNGESTIVSQRRSDDEMRSIRNLVAMAVGYNEPRGDQIEVT 413

Query: 410 SMDFLENQLFNSGTVQVSFMDILSRHFATVINALV--FLVGTLLVTFLGLHALRRL 463
           ++ F         T +    D L R     +  +V  +L+  L+V       +RR+
Sbjct: 414 NISF-------DTTSKDHEYDTLKREKTMELVGMVSKYLLAALIVLLFYFLVIRRI 462


>gi|281179000|dbj|BAI55330.1| flagellar hook-basal body MS ring protein FliF [Escherichia coli
           SE15]
          Length = 552

 Score =  154 bits (389), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 198/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEALTREAMGFSEKRGDSLNVVNSPF 429


>gi|218705431|ref|YP_002412950.1| flagellar MS-ring protein [Escherichia coli UMN026]
 gi|293405421|ref|ZP_06649413.1| fliF [Escherichia coli FVEC1412]
 gi|298381064|ref|ZP_06990663.1| flagellar M-ring protein [Escherichia coli FVEC1302]
 gi|218432528|emb|CAR13421.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           UMN026]
 gi|291427629|gb|EFF00656.1| fliF [Escherichia coli FVEC1412]
 gi|298278506|gb|EFI20020.1| flagellar M-ring protein [Escherichia coli FVEC1302]
          Length = 552

 Score =  154 bits (389), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 198/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|300920157|ref|ZP_07136607.1| flagellar M-ring protein FliF [Escherichia coli MS 115-1]
 gi|300412814|gb|EFJ96124.1| flagellar M-ring protein FliF [Escherichia coli MS 115-1]
          Length = 552

 Score =  154 bits (389), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 198/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|91211156|ref|YP_541142.1| flagellar MS-ring protein [Escherichia coli UTI89]
 gi|215487138|ref|YP_002329569.1| flagellar MS-ring protein [Escherichia coli O127:H6 str. E2348/69]
 gi|218558795|ref|YP_002391708.1| flagellar MS-ring protein [Escherichia coli S88]
 gi|237705897|ref|ZP_04536378.1| flagellar MS-ring protein [Escherichia sp. 3_2_53FAA]
 gi|300940393|ref|ZP_07154978.1| flagellar M-ring protein FliF [Escherichia coli MS 21-1]
 gi|312967135|ref|ZP_07781353.1| flagellar M-ring protein FliF [Escherichia coli 2362-75]
 gi|91072730|gb|ABE07611.1| flagellar M-ring protein [Escherichia coli UTI89]
 gi|215265210|emb|CAS09600.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           O127:H6 str. E2348/69]
 gi|218365564|emb|CAR03291.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           S88]
 gi|226900654|gb|EEH86913.1| flagellar MS-ring protein [Escherichia sp. 3_2_53FAA]
 gi|294491623|gb|ADE90379.1| flagellar M-ring protein FliF [Escherichia coli IHE3034]
 gi|300454787|gb|EFK18280.1| flagellar M-ring protein FliF [Escherichia coli MS 21-1]
 gi|307626586|gb|ADN70890.1| flagellar MS-ring protein [Escherichia coli UM146]
 gi|312288599|gb|EFR16501.1| flagellar M-ring protein FliF [Escherichia coli 2362-75]
 gi|323952431|gb|EGB48304.1| flagellar M-ring protein FliF [Escherichia coli H252]
 gi|323956334|gb|EGB52077.1| flagellar M-ring protein FliF [Escherichia coli H263]
          Length = 552

 Score =  154 bits (389), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 198/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEALTREAMGFSEKRGDSLNVVNSPF 429


>gi|26248206|ref|NP_754246.1| flagellar MS-ring protein [Escherichia coli CFT073]
 gi|227885633|ref|ZP_04003438.1| flagellar MS-ring protein [Escherichia coli 83972]
 gi|300975548|ref|ZP_07173059.1| flagellar M-ring protein FliF [Escherichia coli MS 45-1]
 gi|301050702|ref|ZP_07197563.1| flagellar M-ring protein FliF [Escherichia coli MS 185-1]
 gi|306814239|ref|ZP_07448405.1| flagellar MS-ring protein [Escherichia coli NC101]
 gi|26108610|gb|AAN80813.1|AE016762_66 Flagellar M-ring protein [Escherichia coli CFT073]
 gi|227837206|gb|EEJ47672.1| flagellar MS-ring protein [Escherichia coli 83972]
 gi|300297625|gb|EFJ54010.1| flagellar M-ring protein FliF [Escherichia coli MS 185-1]
 gi|300410317|gb|EFJ93855.1| flagellar M-ring protein FliF [Escherichia coli MS 45-1]
 gi|305852398|gb|EFM52849.1| flagellar MS-ring protein [Escherichia coli NC101]
 gi|307553951|gb|ADN46726.1| flagellar M-ring protein FliF [Escherichia coli ABU 83972]
 gi|315290255|gb|EFU49633.1| flagellar M-ring protein FliF [Escherichia coli MS 153-1]
          Length = 552

 Score =  154 bits (389), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 198/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEALTREAMGFSEKRGDSLNVVNSPF 429


>gi|320175473|gb|EFW50572.1| Flagellar M-ring protein FliF [Shigella dysenteriae CDC 74-1112]
          Length = 552

 Score =  154 bits (388), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 198/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|218699502|ref|YP_002407131.1| flagellar MS-ring protein [Escherichia coli IAI39]
 gi|218369488|emb|CAR17255.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           IAI39]
          Length = 552

 Score =  154 bits (388), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 198/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEALTREAMGFSEKRGDSLNVVNSPF 429


>gi|191168288|ref|ZP_03030081.1| flagellar M-ring protein FliF [Escherichia coli B7A]
 gi|190901660|gb|EDV61416.1| flagellar M-ring protein FliF [Escherichia coli B7A]
          Length = 552

 Score =  154 bits (388), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 199/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVNQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+    ++   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|16129885|ref|NP_416448.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           str. K-12 substr. MG1655]
 gi|89108770|ref|AP_002550.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           str. K-12 substr. W3110]
 gi|157161409|ref|YP_001458727.1| flagellar MS-ring protein [Escherichia coli HS]
 gi|170081582|ref|YP_001730902.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           str. K-12 substr. DH10B]
 gi|170682432|ref|YP_001743307.1| flagellar MS-ring protein [Escherichia coli SMS-3-5]
 gi|193071157|ref|ZP_03052081.1| flagellar M-ring protein FliF [Escherichia coli E110019]
 gi|218554518|ref|YP_002387431.1| flagellar MS-ring protein [Escherichia coli IAI1]
 gi|238901143|ref|YP_002926939.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           BW2952]
 gi|253773113|ref|YP_003035944.1| flagellar MS-ring protein [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|260855913|ref|YP_003229804.1| flagellar basal-body MS-ring and collar protein FliF [Escherichia
           coli O26:H11 str. 11368]
 gi|300822292|ref|ZP_07102433.1| flagellar M-ring protein FliF [Escherichia coli MS 119-7]
 gi|301018212|ref|ZP_07182727.1| flagellar M-ring protein FliF [Escherichia coli MS 69-1]
 gi|331663434|ref|ZP_08364344.1| flagellar M-ring protein FliF [Escherichia coli TA143]
 gi|331668629|ref|ZP_08369477.1| flagellar M-ring protein FliF [Escherichia coli TA271]
 gi|2506421|sp|P25798|FLIF_ECOLI RecName: Full=Flagellar M-ring protein
 gi|1736604|dbj|BAA15763.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           str. K12 substr. W3110]
 gi|1788248|gb|AAC75005.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           str. K-12 substr. MG1655]
 gi|157067089|gb|ABV06344.1| flagellar M-ring protein FliF [Escherichia coli HS]
 gi|169889417|gb|ACB03124.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           str. K-12 substr. DH10B]
 gi|170520150|gb|ACB18328.1| flagellar M-ring protein FliF [Escherichia coli SMS-3-5]
 gi|192955552|gb|EDV86031.1| flagellar M-ring protein FliF [Escherichia coli E110019]
 gi|218361286|emb|CAQ98870.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           IAI1]
 gi|238861094|gb|ACR63092.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           BW2952]
 gi|253324157|gb|ACT28759.1| flagellar M-ring protein FliF [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|257754562|dbj|BAI26064.1| flagellar basal-body MS-ring and collar protein FliF [Escherichia
           coli O26:H11 str. 11368]
 gi|260448949|gb|ACX39371.1| flagellar M-ring protein FliF [Escherichia coli DH1]
 gi|284921846|emb|CBG34921.1| flagellar M-ring protein [Escherichia coli 042]
 gi|300399799|gb|EFJ83337.1| flagellar M-ring protein FliF [Escherichia coli MS 69-1]
 gi|300525175|gb|EFK46244.1| flagellar M-ring protein FliF [Escherichia coli MS 119-7]
 gi|309702227|emb|CBJ01544.1| flagellar M-ring protein [Escherichia coli ETEC H10407]
 gi|315136575|dbj|BAJ43734.1| flagellar MS-ring protein [Escherichia coli DH1]
 gi|323152731|gb|EFZ39003.1| flagellar M-ring protein FliF [Escherichia coli EPECa14]
 gi|323937208|gb|EGB33488.1| flagellar M-ring protein FliF [Escherichia coli E1520]
 gi|324118987|gb|EGC12876.1| flagellar M-ring protein FliF [Escherichia coli E1167]
 gi|331059233|gb|EGI31210.1| flagellar M-ring protein FliF [Escherichia coli TA143]
 gi|331063823|gb|EGI35734.1| flagellar M-ring protein FliF [Escherichia coli TA271]
          Length = 552

 Score =  154 bits (388), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 198/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|332161342|ref|YP_004297919.1| flagellar MS-ring protein [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325665572|gb|ADZ42216.1| flagellar MS-ring protein [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330863306|emb|CBX73430.1| flagellar M-ring protein [Yersinia enterocolitica W22703]
          Length = 559

 Score =  154 bits (388), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 135/536 (25%), Positives = 243/536 (45%), Gaps = 54/536 (10%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  SP Y  LY  L   D   I   L++ NI +R +DNG ++ +P+  V + R+ LA Q
Sbjct: 46  LWAKSPDYRVLYSNLNDRDGGDIVTQLTQLNIPYRFADNGGALLIPADKVHETRLRLAQQ 105

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI ++  ++  RVH+ MP 
Sbjct: 106 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIGTLGPVLNVRVHLAMPK 163

Query: 161 MGSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +    PTASV + A+ P          AI ++V+++V  L   +VTV+D TG+LL
Sbjct: 164 PSLFVREQKSPTASVTL-ALQPGRALDDGQINAIVYMVSSSVAGLPPANVTVVDQTGRLL 222

Query: 218 T-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI 276
           T ++   R++    L     +++  +  I   LA  +G  N  + V A+++  +++  + 
Sbjct: 223 TQSDSAGRDLNAAQLKFTNEVENRFQRRIETILAPMVGSGNVHAQVTAQVDFASREQTDE 282

Query: 277 VYDPDSKVERSIRLSKDAQRSE------------------TSQPESAVTVEQNMPHVSDR 318
            Y P+    +    S+    SE                  ++ P + + V Q  P     
Sbjct: 283 EYKPNQAANQGAVRSQQVSTSEQLGGTNVGGVPGALSNQPSATPVAPIEVPQATPAAGAG 342

Query: 319 KVPLPRSLENT---DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG--RLTEVLG 373
                     T    + ++ +N+E++     T      ++RLS+AVVVN G  +  + + 
Sbjct: 343 AAANAAKQTATSSNSRHDQTTNFEVDRTIRHTQQQAGMVQRLSVAVVVNYGSDKAGKPIA 402

Query: 374 RSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILS 433
            S DQ      LA++  +   A G ++ RGDT+ + +  F  N   ++    + F    S
Sbjct: 403 LSKDQ------LAQVESLTREAMGFSTVRGDTLNVVNTPF--NATDDASGSNLPFWQQPS 454

Query: 434 RHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGL 493
             F  ++N   +L+  L+   L    +R L  I   ++ +    S+ +    +    T  
Sbjct: 455 -FFDQLLNIGRYLLILLVAWILWRKLVRPL--IAKKQEADKAAASVNNIVQAAQTTETAK 511

Query: 494 MPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKW 549
              + +AL   N          Q R+++ V  Q   R+  + + +    A ++R+W
Sbjct: 512 QTKEELALRKKN----------QQRVSAEVQAQ---RIRELADKDPRIVALVIRQW 554


>gi|320194349|gb|EFW68980.1| Flagellar M-ring protein FliF [Escherichia coli WV_060327]
          Length = 552

 Score =  154 bits (388), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 119/416 (28%), Positives = 199/416 (47%), Gaps = 36/416 (8%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLT--EVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L   + L  S +Q      + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPGGKPLPLSNEQ------MKQIEALTREAMGFSEKRGDSLNVVNSPF 429


>gi|37525871|ref|NP_929215.1| flagellar MS-ring protein [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36785300|emb|CAE14241.1| flagellar basal-body M-ring protein [Photorhabdus luminescens
           subsp. laumondii TTO1]
          Length = 567

 Score =  154 bits (388), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 126/424 (29%), Positives = 207/424 (48%), Gaps = 40/424 (9%)

Query: 26  ASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISV 85
           A+V +V I LF+    ++ SP Y  LY  L   D   I   L++ NI +R ++NG++I +
Sbjct: 36  AAVAIV-IALFL----WLRSPDYRVLYSNLSDKDGGDIVTQLTQLNIPYRFAENGAAIMI 90

Query: 86  PSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQS 145
           P+  V + R+ LA QGLP   + +G+EL DK   FG++ F +++   RALEGE++RTI+S
Sbjct: 91  PAEQVHETRLRLAQQGLPKGGA-AGFELLDK-EKFGISQFSEQVNYQRALEGELSRTIES 148

Query: 146 ISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLD 203
           +  +  ARVH+ +P    F +    P+ASV +  +        +  AI H+V+++V  L 
Sbjct: 149 LGPVQNARVHLALPKPSLFVREQKSPSASVTVGLLQGRTLDEGQINAIVHMVSSSVAGLP 208

Query: 204 MGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAV 262
            G+VT++D TG+LLT A+   R++    L  +Q +++  +  I   L   +G  N  + V
Sbjct: 209 PGNVTIVDQTGRLLTQADATGRDLNTSQLKYIQEVENRFQHRIETILTPVVGRGNVHAQV 268

Query: 263 VAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS--------------QPESAV-- 306
            A+++   ++     Y P+    ++   SK    SE S              QP S    
Sbjct: 269 TAQVDFSRREETAEEYKPNQPPNQAAVRSKQLSESEQSGGPQVGGIPGALSNQPSSPPSA 328

Query: 307 ------TVEQNMPHVSDRKV-PLPRSLENT------DKKEEQSNYEINTKSIATTHDNYK 353
                 T E N    SD+K      S E T      ++++E +NYE++            
Sbjct: 329 PIDKPNTKENNKNDKSDKKASSAGNSNERTVNSNRNNRRDETTNYEVDRTIRHVQQQAGG 388

Query: 354 LERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           +ERLS+AVVVN     E       Q      L +I  +   A G +  RGD++ + +  F
Sbjct: 389 VERLSVAVVVNY-VTVEGKNGPETQALTPEQLTKIEALTREAMGFSKERGDSLNVVNTPF 447

Query: 414 LENQ 417
            E++
Sbjct: 448 TESK 451


>gi|205357292|ref|ZP_02346550.2| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205322643|gb|EDZ10482.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 585

 Score =  154 bits (388), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 122/415 (29%), Positives = 198/415 (47%), Gaps = 57/415 (13%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R+ LA Q
Sbjct: 63  LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQ 122

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 123 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 180

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D +G 
Sbjct: 181 PSLFVREQKSPSASVTVTLEPGRALD---EGQISAVVHLVSSAVAGLPPGNVTLVDQSGH 237

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  
Sbjct: 238 LLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT 297

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQP----ESAVTVE------- 309
           E  Y P+    ++   S+    SE              ++QP    E+ +          
Sbjct: 298 EEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNA 357

Query: 310 QNMPHVSDRKVPL---------PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           QN P  S               PRS +    + E SNYE++     T  +   +ERLS+A
Sbjct: 358 QNTPQTSTSTSTSTSTNSNSAGPRSTQ----RNETSNYEVDRTIRHTKMNVGDIERLSVA 413

Query: 361 VVVNKGRLTE--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           VVVN   L +   L  +ADQ K      +I  +   A G + +RGDT+ + +  F
Sbjct: 414 VVVNYKTLADGKPLPLTADQMK------QIEDLTREAMGFSDKRGDTLNVVNSPF 462


>gi|258404702|ref|YP_003197444.1| flagellar M-ring protein FliF [Desulfohalobium retbaense DSM 5692]
 gi|257796929|gb|ACV67866.1| flagellar M-ring protein FliF [Desulfohalobium retbaense DSM 5692]
          Length = 504

 Score =  154 bits (388), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 120/411 (29%), Positives = 201/411 (48%), Gaps = 29/411 (7%)

Query: 19  RTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISD 78
           R R L L  V L+ + +F           Y  LY  +   + + +   L ++N+ +++ D
Sbjct: 27  RRRKLSLLVVGLLCVAVFTFLILQARVADYQLLYADMTQQEASSVVDWLQDSNVSYQLRD 86

Query: 79  NGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGE 138
            GSSI VP+  V K R+ LA  GLP      G+E+FD+   FG+T F Q++   RAL+GE
Sbjct: 87  QGSSIYVPAGQVYKTRLDLAGDGLPQGQ-GVGFEIFDQ-QRFGVTQFTQQVNYQRALQGE 144

Query: 139 IARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVA 196
           +AR++ +++ + +ARVH+V+P+    R+   +  ASV++         S +   I  LV+
Sbjct: 145 LARSVATLTSVQSARVHLVLPERQFLREQQEKAKASVVVEFAPGQGLDSNQIKGIIRLVS 204

Query: 197 AAVPNLDMGDVTVLDSTGKLLTANEMERN---ILGKSLSIVQAIQHEIEMNINKALAAFL 253
            +V  +   +VTV+DS G +L+  E E +   I  + L   QA++ + E      L    
Sbjct: 205 GSVEGMAANNVTVVDSQGNVLSGGEEEDSGSPISPEKLEYKQAVEGQYEQRAQALLDRVF 264

Query: 254 GVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMP 313
           G +     V A ++  ++   E +YDPDS V RS          +TS+  S  T  +   
Sbjct: 265 GPNKALVRVTAAIDFVSKHTTEELYDPDSIVPRS---------EKTSESNSGTTAREE-- 313

Query: 314 HVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLG 373
             ++      RS E+T    E  NYEI+      T     ++ LS+AV+V +    + L 
Sbjct: 314 --TEGNAGGQRSSEST----ETVNYEISRTVNEITKTMGGVKNLSVAVLVGQ----QFLQ 363

Query: 374 RSADQGKIDSYLAE-INKIVSAATGINSRRGDTITITSMDFLENQLFNSGT 423
              + G  + +  E + ++VS+A G+   RGD+I + +M   E    +SGT
Sbjct: 364 NKGNGGAAEGHSVESLQRLVSSALGLQPDRGDSIEVVAMPVQEQAGLSSGT 414


>gi|218695543|ref|YP_002403210.1| flagellar MS-ring protein [Escherichia coli 55989]
 gi|218352275|emb|CAU98032.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           55989]
          Length = 552

 Score =  154 bits (388), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 117/418 (27%), Positives = 197/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+     V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVTGSAAVAVMVALI--LWAKTPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNEGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEALTREAMGFSEKRGDSLNVVNSPF 429


>gi|218549263|ref|YP_002383054.1| flagellar MS-ring protein [Escherichia fergusonii ATCC 35469]
 gi|218356804|emb|CAQ89432.1| flagellar basal-body MS-ring and collar protein [Escherichia
           fergusonii ATCC 35469]
 gi|325497680|gb|EGC95539.1| flagellar MS-ring protein [Escherichia fergusonii ECD227]
          Length = 552

 Score =  153 bits (387), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 121/419 (28%), Positives = 201/419 (47%), Gaps = 42/419 (10%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +++ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVIVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEVSGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D +G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNVH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS--------------QPESA 305
           + V A+L+  +++  E  Y P+    ++   S+    SE S              QP  A
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDQSQATLRSRQVNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 306 VTVEQNMP---------HVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLER 356
            +   + P           S      PRS +    + E SNYE++     T  +   ++R
Sbjct: 321 NSAPISTPPANQNNRQQQTSTSSNSGPRSTQ----RNETSNYEVDRTIRHTKMNVGDVQR 376

Query: 357 LSIAVVVNKGRLTE--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           LS+AVVVN     +   L  SA+Q      + +I  +   A G + +RGD++ + +  F
Sbjct: 377 LSVAVVVNYKATPDGKPLPLSAEQ------MKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|323940403|gb|EGB36594.1| flagellar M-ring protein FliF [Escherichia coli E482]
          Length = 552

 Score =  153 bits (387), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 197/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLTA-NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT  N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQFNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|157158866|ref|YP_001463240.1| flagellar MS-ring protein [Escherichia coli E24377A]
 gi|157080896|gb|ABV20604.1| flagellar M-ring protein FliF [Escherichia coli E24377A]
          Length = 552

 Score =  153 bits (387), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 119/418 (28%), Positives = 197/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I +I  +  ARVH+ MP    F +    P+ASV I  +        +  AI HLV++AV 
Sbjct: 141 IATIGPVKGARVHLAMPKPSLFVREQKSPSASVTINLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|167034925|ref|YP_001670156.1| flagellar MS-ring protein [Pseudomonas putida GB-1]
 gi|166861413|gb|ABY99820.1| flagellar M-ring protein FliF [Pseudomonas putida GB-1]
          Length = 592

 Score =  153 bits (387), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 140/564 (24%), Positives = 248/564 (43%), Gaps = 73/564 (12%)

Query: 33  IMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGK 92
           + +  A   +   P Y  LY  L   D  ++   L+ A+I + +  N  ++ V +  + +
Sbjct: 50  VAIGFAVVLWSQQPDYRPLYGSLSGMDTKQVMDTLAAADIPYNVEPNSGALLVKADDLSR 109

Query: 93  ARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAA 152
           AR+ LAA G+  S  N G+EL DK    G + FM+     R+LEGE+ART+ S++ + AA
Sbjct: 110 ARLKLAAAGVAPSDGNVGFELLDKEQGLGTSQFMEATRYRRSLEGELARTVSSLNNVKAA 169

Query: 153 RVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVL 210
           RVH+ +P    F +   +P+ASV++        ++ +  AI +LVA +VP LD   VTV+
Sbjct: 170 RVHLAIPKSSVFVRDERKPSASVLVELYPGRALEAGQVMAIVNLVATSVPELDKSQVTVV 229

Query: 211 DSTGKLLTANEMERNIL--GKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNM 268
           D  G LL+    + ++   GK     + ++  +   ++  L   LG D +++ V A+L+ 
Sbjct: 230 DQKGNLLSEQIQDSSLTQAGKQFDYSRRVESMLTQRVHNILQPVLGNDRYKAEVSADLDF 289

Query: 269 DTQQIREIVYDPDSKVERSIRLSKDAQRSET-----------SQPESAVTVEQ------- 310
              +     ++PD    RS + S D QR+ +           +QP  A +  Q       
Sbjct: 290 SAVESTSEQFNPDQPALRSEQ-SVDEQRASSQGPQGVPGALSNQPPGAASAPQTTGGAAT 348

Query: 311 --------------NMPHVSDRKVPLPRSLENTDKKEEQS--NYEINTKSIATTHDNYKL 354
                         N   + D     P        K +QS  N+E++     T     ++
Sbjct: 349 PASAIQPGQPLVDANGQQIMDPATGQPMLAPYPSDKRQQSTKNFELDRSISHTRQQQGRM 408

Query: 355 ERLSIAVVVN-KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
            RLS+AVVV+ + +L    G +         LA   ++V  A G ++ RGD++T+ ++ F
Sbjct: 409 TRLSVAVVVDDQVKLDPATGDATRAPWAAEDLARFTRLVQDAVGFDASRGDSVTVINVPF 468

Query: 414 LENQLFNSGTV----QVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA 469
             ++      +    Q  F DI+ +    V+  LV + G L            L+NI   
Sbjct: 469 AADRGEEIADIAFYQQPWFWDIV-KQVLGVVFILVLVFGVLRPV---------LNNITG- 517

Query: 470 KKGEVGGKSILSPPPISSAVTTGL---MPNDNIALDSSNQDIF-SHSRNLQSRINSYVSK 525
                GGK   S   +      GL   + ND ++L      +  S S   ++++N+    
Sbjct: 518 -----GGKQAASDSDMELGGMMGLDGELANDRVSLGGPTSILLPSPSEGYEAQLNA---- 568

Query: 526 QSDLRLLHMIEINEERFAKILRKW 549
                +  ++  +  R A++++ W
Sbjct: 569 -----IKGLVAEDPGRVAQVVKDW 587


>gi|170019729|ref|YP_001724683.1| flagellar MS-ring protein [Escherichia coli ATCC 8739]
 gi|188492347|ref|ZP_02999617.1| flagellar M-ring protein FliF [Escherichia coli 53638]
 gi|300951563|ref|ZP_07165396.1| flagellar M-ring protein FliF [Escherichia coli MS 116-1]
 gi|300956546|ref|ZP_07168828.1| flagellar M-ring protein FliF [Escherichia coli MS 175-1]
 gi|169754657|gb|ACA77356.1| flagellar M-ring protein FliF [Escherichia coli ATCC 8739]
 gi|188487546|gb|EDU62649.1| flagellar M-ring protein FliF [Escherichia coli 53638]
 gi|300316646|gb|EFJ66430.1| flagellar M-ring protein FliF [Escherichia coli MS 175-1]
 gi|300449190|gb|EFK12810.1| flagellar M-ring protein FliF [Escherichia coli MS 116-1]
 gi|332093105|gb|EGI98169.1| flagellar M-ring protein FliF [Shigella boydii 5216-82]
          Length = 552

 Score =  153 bits (387), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 197/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLTA-NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT  N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQFNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|110642044|ref|YP_669774.1| flagellar MS-ring protein [Escherichia coli 536]
 gi|191173305|ref|ZP_03034835.1| flagellar M-ring protein FliF [Escherichia coli F11]
 gi|110343636|gb|ABG69873.1| flagellar M-ring protein [Escherichia coli 536]
 gi|190906422|gb|EDV66031.1| flagellar M-ring protein FliF [Escherichia coli F11]
          Length = 552

 Score =  153 bits (387), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 125/442 (28%), Positives = 207/442 (46%), Gaps = 47/442 (10%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVSAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPTNQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDFLE 415
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F  
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEALTREAMGFSEKRGDSLNVVNSPF-- 429

Query: 416 NQLFNSGTV-----QVSFMDIL 432
           N    SG       Q +F+D L
Sbjct: 430 NSSDESGGALPFWQQQAFIDQL 451


>gi|256017869|ref|ZP_05431734.1| flagellar MS-ring protein [Shigella sp. D9]
 gi|332278895|ref|ZP_08391308.1| flagellar basal-body MS-ring and collar protein [Shigella sp. D9]
 gi|332101247|gb|EGJ04593.1| flagellar basal-body MS-ring and collar protein [Shigella sp. D9]
          Length = 552

 Score =  153 bits (387), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 117/418 (27%), Positives = 198/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R+S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRVSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLTANEME-RNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +    R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSSTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|331673452|ref|ZP_08374220.1| flagellar M-ring protein FliF [Escherichia coli TA280]
 gi|331069650|gb|EGI41037.1| flagellar M-ring protein FliF [Escherichia coli TA280]
          Length = 552

 Score =  153 bits (387), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 120/422 (28%), Positives = 199/422 (47%), Gaps = 48/422 (11%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+    ++   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPL---------------------PRSLENTDKKEEQSNYEINTKSIATTHDNYKLE 355
           +   P+                     PRS +    + E SNYE++     T  +   ++
Sbjct: 321 N-NAPISTPPANQNNRQQQANTTSNSGPRSTQ----RNETSNYEVDRTIRHTKMNVGDVQ 375

Query: 356 RLSIAVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSM 411
           RLS+AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + + 
Sbjct: 376 RLSVAVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNS 427

Query: 412 DF 413
            F
Sbjct: 428 PF 429


>gi|323968354|gb|EGB63761.1| flagellar M-ring protein FliF [Escherichia coli M863]
 gi|327253070|gb|EGE64724.1| flagellar M-ring protein FliF [Escherichia coli STEC_7v]
          Length = 552

 Score =  153 bits (387), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 116/418 (27%), Positives = 204/418 (48%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPAEKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ +P    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLALPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDS-KVERSIRLSK--DAQRSETSQPESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+  K + ++R  +  ++++S +  P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDKSQAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|17988496|ref|NP_541129.1| flagellar M-ring protein FLIF [Brucella melitensis bv. 1 str. 16M]
 gi|256042873|ref|ZP_05445819.1| flagellar MS-ring protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|260564110|ref|ZP_05834595.1| flagellar M-ring protein [Brucella melitensis bv. 1 str. 16M]
 gi|265989308|ref|ZP_06101865.1| flagellar M-ring protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|17984287|gb|AAL53393.1| flagellar m-ring protein flif [Brucella melitensis bv. 1 str. 16M]
 gi|260151753|gb|EEW86846.1| flagellar M-ring protein [Brucella melitensis bv. 1 str. 16M]
 gi|262999977|gb|EEZ12667.1| flagellar M-ring protein [Brucella melitensis bv. 1 str. Rev.1]
          Length = 333

 Score =  153 bits (387), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 105/315 (33%), Positives = 176/315 (55%), Gaps = 18/315 (5%)

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
           +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  ++ +
Sbjct: 4   SIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNNRND 63

Query: 304 SAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVV 363
           +A  VEQN+P    +      S E TD++EE +NYE+N+ +++T  D Y ++RLSIAVV+
Sbjct: 64  NATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSMTVSTVSDGYSIKRLSIAVVI 123

Query: 364 NKGRLTEVLGRSADQGK-IDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG 422
           ++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL++   +  
Sbjct: 124 DQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDSAGADME 183

Query: 423 TVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA-------KKGEVG 475
            V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       + GEV 
Sbjct: 184 PVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAGEVA 243

Query: 476 GKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHS-RNLQSRINSYVSKQSDLRLLHM 534
                +P  I  A + G      I   ++  D    S  +L+ R+       + LRL  M
Sbjct: 244 -----TPNFIGGAESVGEGVQAVIGGPAAYADQMKTSLSDLRQRMR----MPAKLRLEQM 294

Query: 535 IEINEERFAKILRKW 549
           IE++EER A +L++W
Sbjct: 295 IEMDEERVAAVLKQW 309


>gi|117923585|ref|YP_864202.1| flagellar M-ring protein FliF [Magnetococcus sp. MC-1]
 gi|117607341|gb|ABK42796.1| flagellar M-ring protein FliF [Magnetococcus sp. MC-1]
          Length = 551

 Score =  153 bits (386), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 129/466 (27%), Positives = 214/466 (45%), Gaps = 28/466 (6%)

Query: 10  FFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSE 69
            F S    GR  ++I A   +  + +  A  +F   P    LY  L   +  RI   L +
Sbjct: 22  LFGSLPLTGRNGVIIAA---MASVFILAAIIWFATRPSMKVLYSGLPDLESARIVEQLGK 78

Query: 70  ANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEI 129
             + + +   G++I +P   V   R+ +A  GLP S+   G+E+FD  +  G+T F+Q +
Sbjct: 79  LGVPYELGSGGTTIRIPEDKVYDVRLEMAKAGLPKSTDGVGFEIFDNQSLMGMTDFVQRM 138

Query: 130 TRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE 189
              RAL+GE+AR+++SI+ +  ARVH+V+P    F       TASV++   +       +
Sbjct: 139 NYQRALQGELARSVESIAAVEKARVHLVLPKKSMFAAEERTATASVVMELTHALNKTQID 198

Query: 190 AIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEME----RNILGKSLSIVQAIQHEIEMNI 245
            I H+VA+AV  L    VT+LD  G L+   + E    R     +L++    + +IE  +
Sbjct: 199 GITHMVASAVEGLSQDQVTLLDQKGNLIAGGKTEDLDGRMPTDDALALQSMKEKKIEERV 258

Query: 246 NKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRS--ETSQPE 303
              L   LG D     + AEL++D +Q +E  YDPD +V  S     ++ R    T    
Sbjct: 259 QSLLDRVLGPDKSIIRITAELDLDKKQRQEESYDPDGQVPLSTNTVTESSRGMFGTGGVP 318

Query: 304 SAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVV 363
             +  + N   V+        S +  D + EQ N+ +  K          + RLS+AV++
Sbjct: 319 GVIPNDPNQTAVAGGT----GSQQTRDVEREQVNFLVPKKVTTVQEAVGDIRRLSVAVMI 374

Query: 364 NKGRLTEVLGRSA--DQGKIDSY-------LAEINKIVSAATGINSRRGDTITITSMDF- 413
           + G    V  +    D  K   Y       + ++ +I+    G +++RGD+I +T+  F 
Sbjct: 375 D-GTYEAVKDKDGNIDPEKPAVYTPRSTEEMEQLKRIIMQTVGFDAKRGDSIEVTNTAFE 433

Query: 414 -LENQL-FNSGTVQVSFMDILSRHFATVINA--LVFLVGTLLVTFL 455
            L   L   S  +   F   ++++ A  + A  LVF V   LVT L
Sbjct: 434 PLPPPLDVKSPWLSREFQLEMAKYGAIALLAFLLVFFVMRPLVTKL 479


>gi|896313|gb|AAB06801.1| flagellar MS ring [Pseudomonas aeruginosa]
          Length = 599

 Score =  153 bits (386), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 120/463 (25%), Positives = 217/463 (46%), Gaps = 50/463 (10%)

Query: 33  IMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGK 92
           + +  A   +   P Y  LY  L   D NR+  AL+ A+I +++  N  ++ V +  +G+
Sbjct: 52  VAIGFAVVLWSQQPDYKPLYGSLNGVDANRVVEALTAADIPYKVEPNSGALLVKADDLGR 111

Query: 93  ARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAA 152
           AR+ +A+ G+  + +N G+E+ DK  + G + FM+     R LEGE+ART+ S++ + AA
Sbjct: 112 ARMKVASAGVAPTDNNVGFEILDKEQALGTSQFMEATNYRRGLEGELARTVSSLNNVKAA 171

Query: 153 RVHIVMPDMGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDV 207
           RVH+ +P    F +   +P+ASV++     R++ PS      AI +LVA +VP LD   V
Sbjct: 172 RVHLAIPKSSVFVRDDRKPSASVLVELYPGRSLEPS---QVMAIVNLVATSVPELDKSQV 228

Query: 208 TVLDSTGKLLTANE--MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAE 265
           TV+D  G LL+  +   E  +  K     + ++  +   ++  L   L     ++ V A+
Sbjct: 229 TVVDQKGNLLSDQQELSELTMADKQFDFTRRMEGLLTQRVHNILQPVLDNGRNKTEVSAD 288

Query: 266 LNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPH----------- 314
           ++    +    +Y+PD    RS + + + +R  +S P+       N P            
Sbjct: 289 VDFSAVESTSEMYNPDQPALRSEQHNNE-ERQNSSGPQGVPGALSNQPPGPASAPQQATA 347

Query: 315 --------------------VSDRKVPLPR-SLENTDKKEEQS-NYEINTKSIATTHDNY 352
                               + D K   P  +   TDK+++ + NYE++     T     
Sbjct: 348 SAPADYVAPGQPLKDANGQTIIDPKTGKPELAPYPTDKRDQTTRNYELDRSISYTKQQQG 407

Query: 353 KLERLSIAVVV-NKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSM 411
           +L RLS+AVV+ ++ ++    G  + Q      LA   ++V  + G ++ RGD++++ + 
Sbjct: 408 RLRRLSVAVVLDDQMKVDAKTGEVSHQPWSADELARFTRLVQDSVGYDASRGDSVSVINA 467

Query: 412 DFLENQLFNSGTV----QVSFMDILSRHFATVINALVFLVGTL 450
            F   Q     ++    Q  F DI+ +    V+  LV + G L
Sbjct: 468 PFAPAQAEEIDSIPFYSQPWFWDIV-KQVLGVLFILVLMFGVL 509


>gi|310816845|ref|YP_003964809.1| flagellar M-ring protein FliF, putative [Ketogulonicigenium vulgare
           Y25]
 gi|308755580|gb|ADO43509.1| flagellar M-ring protein FliF, putative [Ketogulonicigenium vulgare
           Y25]
          Length = 500

 Score =  153 bits (386), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 138/459 (30%), Positives = 226/459 (49%), Gaps = 29/459 (6%)

Query: 6   QLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISV 65
           Q L    SG SL R RI+++A+ + + + +   AR  V  P    LY  L+ +    +  
Sbjct: 2   QNLLALWSGFSL-RRRIILVAATLGIFLAVIGLARG-VGRPDMALLYAGLDPAASAEVVA 59

Query: 66  ALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSF 125
           A+ +  + F +   G +I VP++     R+ LA  GLP+  +  GYEL D ++ FG T+ 
Sbjct: 60  AVEQQRLPFEV--RGDAIYVPAASRDLLRMTLAGAGLPAPGAQ-GYELLDNLSGFGTTAQ 116

Query: 126 MQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV- 184
           M +    RA EGE+ARTI ++ G+ AARVHI  P    F++ G   TA+V +   + S  
Sbjct: 117 MFDAAYWRAKEGELARTILAVPGLQAARVHISPPAARVFQQ-GEPATAAVTVTMASGSAS 175

Query: 185 YKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMN 244
            + A+A R L+AAAVP LD G+V V+D+   L+ A +        +  +    Q E+   
Sbjct: 176 QQQAQAFRSLIAAAVPGLDPGNVAVIDAKAGLIAAPD--------NAQLADTRQDELRNR 227

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPES 304
           +   L A +G  N    +  E   DT+ I E   DP+ +V  S  +S+ A+RS+ +  + 
Sbjct: 228 VRSLLEARVGAGNAVVELAVETVTDTESIFERRLDPEGRVVVSNDVSETARRSQGNA-DG 286

Query: 305 AVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVN 364
           +VTV  N+P  +  +     S     +    +NYE++  S         + RL++AV+VN
Sbjct: 287 SVTVASNLPDGAANQE-AGSSSSEDRESRNVTNYELSETSREVLRAPGAVRRLTVAVLVN 345

Query: 365 KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTV 424
           +    E   R+ D+      L  + ++V++A G ++ RGD IT+ +M F+   +  +  V
Sbjct: 346 EPTGPEAAPRAPDE------LEALRELVASAVGFDAARGDVITLRAMPFVAPPVLGTEAV 399

Query: 425 QVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL 463
                   +R F   +  + F    L+   LGL  LR L
Sbjct: 400 AAP-----ARLF-DPMQLVQFGALALVALILGLFVLRPL 432


>gi|118581826|ref|YP_903076.1| flagellar M-ring protein FliF [Pelobacter propionicus DSM 2379]
 gi|118504536|gb|ABL01019.1| flagellar M-ring protein FliF [Pelobacter propionicus DSM 2379]
          Length = 528

 Score =  153 bits (386), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 127/429 (29%), Positives = 213/429 (49%), Gaps = 35/429 (8%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           L +L++ F    +L   + +++A V ++ +  F    F  N   Y  L+  L   D   I
Sbjct: 5   LQRLIEPF---MALSPGKRMLIAGVAILSVAAFAVLIFVANRVDYRPLFTNLSTEDAAEI 61

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
              L +    ++I+ +G  I VP+ +V + R+ LA++GLP      G+E+FD+ N FG+T
Sbjct: 62  VKKLKDNKTPYQITADGKGIMVPADLVYEQRLALASEGLPQGG-GVGFEIFDRKN-FGMT 119

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS 183
            F+Q+I   RAL+GE++RTI  ++G+  AR+H+V+P+   F++     TAS++++  +  
Sbjct: 120 EFVQKINYQRALQGELSRTISQLNGVEQARIHLVIPEKSLFKENEKPSTASIVLKMKSGR 179

Query: 184 VYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEI 241
             +  E   I HLVA+++  ++   VTVLDS GK+L     + +   K+ S++Q  Q   
Sbjct: 180 SLRQNEVQGIVHLVASSIEGMEADQVTVLDSRGKVLNKGGGDPDPTSKATSVMQETQRIY 239

Query: 242 EMNINKALAAFLG--VDNFRSAVVAELNMDTQQIR--EIVYDPDSKVERSIRLSKDAQRS 297
           E N+ + + + L   V + R+        D +Q+   E  +DP+S   RS       QRS
Sbjct: 240 EKNVEERIQSMLDPVVGSGRAIARVSALFDFKQVERLEEKFDPESIAVRS------EQRS 293

Query: 298 ETSQPESAVTVEQNMPHVSDRKVPLPR-------SLENTDKKEEQSNYEINTKSIATTHD 350
           E    + A  V  N   V   +  L R             K +E  NYE++  +      
Sbjct: 294 EE---KGATAV--NAAGVPGVQTNLGRTGAGGATQAGGAAKNDETLNYEVSRTTAKIIEP 348

Query: 351 NYKLERLSIAVVVN-KGRLTEVL--GRSADQGKIDSYLAEINKI---VSAATGINSRRGD 404
              L RLS+AV+V+ K  L   +  G++A    I     E+ KI   V +A G N+ RGD
Sbjct: 349 VGALSRLSVAVLVDGKYALPTAVKDGQTATPKYIPRSPEELQKIEALVKSAVGFNAERGD 408

Query: 405 TITITSMDF 413
            + I ++ F
Sbjct: 409 QLAIQNIPF 417


>gi|209919360|ref|YP_002293444.1| flagellar MS-ring protein [Escherichia coli SE11]
 gi|293446318|ref|ZP_06662740.1| flagellar M-ring protein FliF [Escherichia coli B088]
 gi|209912619|dbj|BAG77693.1| flagellar hook-basal body MS ring protein FliF [Escherichia coli
           SE11]
 gi|291323148|gb|EFE62576.1| flagellar M-ring protein FliF [Escherichia coli B088]
          Length = 552

 Score =  153 bits (386), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 197/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPAEKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I +I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IATIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|27355280|dbj|BAC52264.1| fliF [Bradyrhizobium japonicum USDA 110]
          Length = 519

 Score =  153 bits (386), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 115/394 (29%), Positives = 199/394 (50%), Gaps = 13/394 (3%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           +I  +  LV    F+  R  V +P    L+  L V D + I   L    I F + + G+ 
Sbjct: 1   MIAVTAALVGFFAFVIMR--VTTPQMTTLFTDLSVEDSSSIIKDLERQAIQFELRNEGTI 58

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP   V + R+ LA +G        GYE+FDK ++ G TSF+Q I  +RALEGE+ART
Sbjct: 59  IMVPKDKVTRLRMKLA-EGGLPKGGGVGYEVFDKSDALGTTSFVQNINHLRALEGELART 117

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNL 202
           I++I  I AARVH+V+P+   F +    P+AS+++R       +   AIRHLVA+AV  L
Sbjct: 118 IRAIDRIQAARVHLVLPERPLFSREAPEPSASIVVRVRGALEAQQIRAIRHLVASAVNGL 177

Query: 203 DMGDVTVLDSTGKLL---TANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
               V+++D  G+LL    A + E+ +  +  +     +  +   +   +++ +G    R
Sbjct: 178 KPQRVSIVDEAGQLLADGAATDPEQALGDERRT---TFEKRMRKQVEDIVSSVVGSGRAR 234

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRK 319
             + A+ + +        +DP+ +V RS +  +++  S T+     VTV   +P   +++
Sbjct: 235 VQLSADFDFNKITQTSDKFDPEGRVLRSTQTREES--SMTADNNGQVTVNNELP--GNQQ 290

Query: 320 VPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQG 379
                + + + K EE +NYEI+  +     +  ++ R+S+AV+V+        G  A Q 
Sbjct: 291 NNGVAAKDQSKKTEETNNYEISRTTKTEVTEAGRVNRISVAVLVDGIYSKNDKGELAYQD 350

Query: 380 KIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           +    L  I  +V +A G + +RGD + + ++ F
Sbjct: 351 RTKEQLDRIATLVRSAIGFDQKRGDQVEVVNLRF 384


>gi|238798572|ref|ZP_04642049.1| Flagellar M-ring protein [Yersinia mollaretii ATCC 43969]
 gi|238717592|gb|EEQ09431.1| Flagellar M-ring protein [Yersinia mollaretii ATCC 43969]
          Length = 572

 Score =  153 bits (386), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 140/549 (25%), Positives = 253/549 (46%), Gaps = 67/549 (12%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  SP Y  LY  L   D   I   L++ NI +R +DNG ++ +P+  V + R+ LA Q
Sbjct: 46  LWAKSPDYRVLYSNLSDRDGGEIVTQLTQLNIPYRFADNGGALLIPAEKVHETRLRLAQQ 105

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI ++  ++  RVH+ MP 
Sbjct: 106 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIGTLGPVLNVRVHLAMPK 163

Query: 161 MGSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +    PTASV + A+ P          AI ++V+++V  L  G+VTV+D TG+LL
Sbjct: 164 PSLFVREQKSPTASVTL-ALQPGRALDDGQINAIVYMVSSSVAGLPPGNVTVVDQTGRLL 222

Query: 218 T-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI 276
           T ++   R++    L     +++  +  I   LA  +G  N  + V A+++  +++  + 
Sbjct: 223 TQSDSAGRDLNAAQLKFTNEVENRFQRRIETILAPMVGNGNVHAQVTAQVDFASREQTDE 282

Query: 277 VYDPDSKVERSIRLSKDAQRSE------TSQPESAVTVEQNMPHVSDRKVPLP------- 323
            Y P+    +    S+    SE            A++ + +   V+  +VP P       
Sbjct: 283 EYKPNQAANQGAVRSQQTSNSEQLGGSNVGGVPGALSNQPSATPVAPIEVPQPAPAAGAA 342

Query: 324 ---------------------RSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVV 362
                                 +  +  + ++ +N+E++     T      ++RLS+AVV
Sbjct: 343 GATANNANAANRPAATTAARSTATSSNSRHDQTTNFEVDRTIRHTQQQAGIVQRLSVAVV 402

Query: 363 VNKG--RLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN 420
           VN G  +  + +  S DQ      LA++  +   A G ++ RGDT+ + +  F  N   +
Sbjct: 403 VNYGSDKAGKPVALSKDQ------LAQVESLTREAMGFSTDRGDTLNVVNTPF--NATDD 454

Query: 421 SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL 480
                + F    S  F  ++NA  +L+  LLV ++    L R        K ++  K+  
Sbjct: 455 GSGSSLPFWQQQS-FFDQLLNAGRYLL-ILLVAWILWRKLVRPM----ITKKQIADKAAA 508

Query: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540
           S   ++S V T         +  S +++    +N Q R+++ V  Q   R+  + + +  
Sbjct: 509 S---VNSMVQTAQTAE---TVKQSKEELALRKKN-QQRVSAEVQAQ---RIRELADKDPR 558

Query: 541 RFAKILRKW 549
             A ++R+W
Sbjct: 559 IVALVIRQW 567


>gi|157145268|ref|YP_001452587.1| flagellar MS-ring protein [Citrobacter koseri ATCC BAA-895]
 gi|157082473|gb|ABV12151.1| hypothetical protein CKO_01005 [Citrobacter koseri ATCC BAA-895]
          Length = 558

 Score =  152 bits (385), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 122/426 (28%), Positives = 203/426 (47%), Gaps = 54/426 (12%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V I++ M    +  +P Y  L+  L   D   I   L++ NI +R ++   +
Sbjct: 28  LIVAGSAAVAIIVAMV--LWAKAPDYRTLFSNLSDQDGGAIVTQLTQMNIPYRFTEGSGA 85

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE+ART
Sbjct: 86  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELART 143

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAA 197
           I+++  +  ARVH+ MP    F +    P+ASV +     RA++        A+ HLV++
Sbjct: 144 IETLGPVKRARVHLAMPKPSLFVREQKSPSASVTVNLEPGRALDEG---QISAVVHLVSS 200

Query: 198 AVPNLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVD 256
           AV  L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  
Sbjct: 201 AVAGLPPGNVTLVDQGGHLLTQSNTSSRDLNDAQLKYASDVEGRIQRRIESILSPIVGNG 260

Query: 257 NFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE--------------TSQP 302
           N  + V A+L+   ++  E  Y P+    +++  S+    SE              ++QP
Sbjct: 261 NVHAQVTAQLDFANKEQTEEQYRPNGDASQAVLRSRQLNESEQIGSGYPGGVPGALSNQP 320

Query: 303 ESAVTVEQNMPHVSDRKVP-----------LPRSLENTDKKEEQSNYEINTKSIATTHDN 351
             A     + P  + +              +PR   NT ++ E SNYE++     T  + 
Sbjct: 321 APANAAPISTPPANQQNAQNTQTTNNTNSNVPR---NT-QRNETSNYEVDRTIRHTKLNV 376

Query: 352 YKLERLSIAVVVNKGRLTEVLGRSADQGK----IDSYLAEINKIVSAATGINSRRGDTIT 407
             ++RLS+AVVVN         R+   GK        + +I  +   A G + +RGDT+ 
Sbjct: 377 GDVQRLSVAVVVNY--------RALPDGKPLPLTTEQMKQIEDLTREAMGFSDKRGDTLN 428

Query: 408 ITSMDF 413
           + +  F
Sbjct: 429 VVNSPF 434


>gi|331647532|ref|ZP_08348624.1| flagellar M-ring protein FliF [Escherichia coli M605]
 gi|330911744|gb|EGH40254.1| flagellar M-ring protein FliF [Escherichia coli AA86]
 gi|331043256|gb|EGI15394.1| flagellar M-ring protein FliF [Escherichia coli M605]
          Length = 552

 Score =  152 bits (385), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 198/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRILFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEALTREAMGFSEKRGDSLNVVNSPF 429


>gi|193066388|ref|ZP_03047436.1| flagellar M-ring protein FliF [Escherichia coli E22]
 gi|194429948|ref|ZP_03062458.1| flagellar M-ring protein FliF [Escherichia coli B171]
 gi|301327725|ref|ZP_07220930.1| flagellar M-ring protein FliF [Escherichia coli MS 78-1]
 gi|192925973|gb|EDV80619.1| flagellar M-ring protein FliF [Escherichia coli E22]
 gi|194412037|gb|EDX28349.1| flagellar M-ring protein FliF [Escherichia coli B171]
 gi|300845725|gb|EFK73485.1| flagellar M-ring protein FliF [Escherichia coli MS 78-1]
 gi|320198628|gb|EFW73228.1| Flagellar M-ring protein FliF [Escherichia coli EC4100B]
 gi|323158583|gb|EFZ44597.1| flagellar M-ring protein FliF [Escherichia coli E128010]
 gi|323183922|gb|EFZ69309.1| flagellar M-ring protein FliF [Escherichia coli 1357]
          Length = 552

 Score =  152 bits (385), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 197/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I +I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IATIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|319790420|ref|YP_004152053.1| flagellar M-ring protein FliF [Thermovibrio ammonificans HB-1]
 gi|317114922|gb|ADU97412.1| flagellar M-ring protein FliF [Thermovibrio ammonificans HB-1]
          Length = 532

 Score =  152 bits (385), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 126/437 (28%), Positives = 222/437 (50%), Gaps = 41/437 (9%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           D+L  F +   +  R  +L+L ++ LV  +  +  R + N   Y  LY  L   D   I 
Sbjct: 8   DKLTAFLREKAN-PRNIVLVLGALTLVVFLSLVLVRSYSNQ-EYAVLYTHLSPDDAGEIL 65

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L +  I +++  +GS I VP   V + R+ LAA+GLP      G+E+FDK    G+T 
Sbjct: 66  TVLQQEKIPYKVEGDGSIILVPKDKVYEVRLQLAAKGLPHGKV-VGFEIFDK-PKLGITQ 123

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI-----RA 179
           F Q +  +RALEGE+ RTI+ +  + +A+V+I +P    F +    P ASV++     R 
Sbjct: 124 FQQNVEYLRALEGELERTIEQLDAVRSAKVNIALPKDSIFVRPEQEPKASVLVDLWPGRD 183

Query: 180 INPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT----ANEMERNILGKSLSIVQ 235
           + P   K   AI  LV+ AVP L   +VTV+D+ G++L+    ++     +  K L I +
Sbjct: 184 LTPEQVK---AIIFLVSHAVPGLKPENVTVVDTRGRVLSDLVESDNSTYAVSSKELKIKR 240

Query: 236 AIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQI--REIVYDPDSKVERSIRLSKD 293
            ++ +IE  +   L+  LG    +  V A + ++T ++  ++ +YDPD     S R  ++
Sbjct: 241 QLERDIERKVESMLSQVLG--GGKVVVRASVEVETGKVETQKEIYDPDMTAVVSQRKVQE 298

Query: 294 AQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYK 353
            + +   QP+ A     N+P V +   P  + ++  +KK+  +NY+++     +    ++
Sbjct: 299 KEVATQKQPQGAPGTTTNVPPVVNFG-PNAKVVQK-EKKDVTTNYDVSKTIERSVTPVFR 356

Query: 354 LERLSIAVVVNKGRLTEVLG-----------RSADQGKIDSYLAEINKIVSAATGINSRR 402
           ++R+++ V+V+ GR  +V G           RS  +  I +Y     +IV +  G + +R
Sbjct: 357 IKRITVGVLVD-GRYEKVKGPKGTVEYKFVPRSPQE--IKTY----EEIVKSVIGYDPKR 409

Query: 403 GDTITITSMDFLENQLF 419
           GD +T+ S+ F E QL 
Sbjct: 410 GDRVTVASVPF-ETQLL 425


>gi|260844337|ref|YP_003222115.1| flagellar basal-body MS-ring and collar protein FliF [Escherichia
           coli O103:H2 str. 12009]
 gi|257759484|dbj|BAI30981.1| flagellar basal-body MS-ring and collar protein FliF [Escherichia
           coli O103:H2 str. 12009]
          Length = 552

 Score =  152 bits (385), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 118/418 (28%), Positives = 197/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I +I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IATIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMMQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|322421735|ref|YP_004200958.1| flagellar M-ring protein FliF [Geobacter sp. M18]
 gi|320128122|gb|ADW15682.1| flagellar M-ring protein FliF [Geobacter sp. M18]
          Length = 524

 Score =  152 bits (385), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 117/391 (29%), Positives = 188/391 (48%), Gaps = 33/391 (8%)

Query: 44  NSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLP 103
           N   Y  L+  L   D   I   L E  + ++I+ +G +I VPS  V   R+ +A+ GLP
Sbjct: 42  NKTDYRPLFANLTSEDAGEIVKKLKEQKVPYQIAADGKAIMVPSDKVYDLRLSMASDGLP 101

Query: 104 SSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGS 163
                 GYE+FD+ N FG+T F+Q++   RAL+GE++RTI  I+G+ +ARVH+ +P+   
Sbjct: 102 QGG-GIGYEIFDRKN-FGMTEFVQKLNYQRALQGELSRTISQIAGVESARVHLAIPEKTL 159

Query: 164 FRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTAN- 220
           F+      TASV+++  +  + + AE   I HLVA+++  +D   VTVLDS GK+L+ N 
Sbjct: 160 FKDAEKPATASVVLKMKSNRMLREAEVQGIVHLVASSIEGMDPEQVTVLDSRGKMLSGNT 219

Query: 221 --EMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
             +    + G      +  +   E  +   L   +G     + V A  +    +  E  Y
Sbjct: 220 PSDTASKLTGSRQETQRNFEKTQEEKLQTLLDRVVGSGKCVARVSAAFDFKQVEKYEERY 279

Query: 279 DPDSKVERSIRLSKDAQRSE-----TSQPESAVTVEQNMPHVSDRKVP-LPRSLENTDKK 332
           DP+S   RS       QRSE     T+       V+ N+     R  P  P       K 
Sbjct: 280 DPESAAVRS------EQRSEEKGGVTATASGVPGVQSNL----GRSAPGAPGQTGGGSKT 329

Query: 333 EEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSY-------L 385
           +E  NYE++  +         L ++S+AV+V+ G+    L   A  G    Y       +
Sbjct: 330 DETLNYEVSRSTARIIEPVGALSKVSVAVLVD-GKYD--LPAGAKPGATPKYQPRTPDEM 386

Query: 386 AEINKIVSAATGINSRRGDTITITSMDFLEN 416
            +I  +V +A G ++ RGD +T+ ++ F E 
Sbjct: 387 QKIEALVKSAVGFSAERGDQVTVANIPFQET 417


>gi|195952552|ref|YP_002120842.1| flagellar M-ring protein FliF [Hydrogenobaculum sp. Y04AAS1]
 gi|195932164|gb|ACG56864.1| flagellar M-ring protein FliF [Hydrogenobaculum sp. Y04AAS1]
          Length = 500

 Score =  152 bits (385), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 121/417 (29%), Positives = 212/417 (50%), Gaps = 31/417 (7%)

Query: 3   ILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNR 62
           IL+ L + F++   L +T+ +I+ S+ +V  +L     F  +  HY  LY  L   D+  
Sbjct: 6   ILNNLKERFQA---LNKTQQIIVLSIPVVLALLTGLIFFLTSRVHYAVLYGDLNNRDMAA 62

Query: 63  ISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGL 122
           I+  L + N+ ++I+ +G +I VP     + R+ LAA GLP+     G++L +K+   G+
Sbjct: 63  IAEQLEKDNVKYKITQDGRTILVPKQEARQLRLKLAAMGLPTKGY-PGFKLLNKM-PLGM 120

Query: 123 TSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP 182
           T FMQ +   RALE E++ TI     I  A+V++ +P    F     +P+ASV I  + P
Sbjct: 121 TDFMQHVEYQRALEEELSNTILGFRNIEKAKVNLAIPKPSIFITQSQKPSASVFIE-LKP 179

Query: 183 S---VYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA--NEMERNILGKSLSIVQAI 237
                 +   AIR+LVAA+VP+L    VTV+DS G  LT   N     +  + L +   +
Sbjct: 180 GASITRRQVIAIRNLVAASVPDLTPNRVTVVDSNGVDLTEELNNPSSYLTNEQLRVKTDL 239

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRS 297
           ++ I  ++ + L   LG +N R AV  E +    + +   Y+P++    +I   +  Q +
Sbjct: 240 ENSITKHLEQVLGQALGYNNVRVAVDVEPDFSQVETKSKNYNPNTT---AIVSQQKKQET 296

Query: 298 ETSQPESAVT-VEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLER 356
            T    S V     N+P +S  +   P +   + KKE  +NY+++ +         +++R
Sbjct: 297 TTGTSVSGVPGTASNIPPMSGLR---PNANFQSTKKEVTTNYDVSVEKTHVVDKTIRIKR 353

Query: 357 LSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           +S+ V+VN           AD   ++  L  I ++V AA G++ +RGDT+++ ++ F
Sbjct: 354 MSVGVIVN-----------ADLKNVN--LNSIRQLVIAAAGVDPKRGDTVSVIAVPF 397


>gi|300904828|ref|ZP_07122654.1| flagellar M-ring protein FliF [Escherichia coli MS 84-1]
 gi|301305281|ref|ZP_07211378.1| flagellar M-ring protein FliF [Escherichia coli MS 124-1]
 gi|300403255|gb|EFJ86793.1| flagellar M-ring protein FliF [Escherichia coli MS 84-1]
 gi|300839487|gb|EFK67247.1| flagellar M-ring protein FliF [Escherichia coli MS 124-1]
 gi|315257230|gb|EFU37198.1| flagellar M-ring protein FliF [Escherichia coli MS 85-1]
          Length = 552

 Score =  152 bits (385), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 117/418 (27%), Positives = 197/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+     V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVTGSAAVAVMVALI--LWAKTPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEALTREAMGFSEKRGDSLNVVNSPF 429


>gi|260598447|ref|YP_003211018.1| flagellar MS-ring protein [Cronobacter turicensis z3032]
 gi|260217624|emb|CBA31913.1| Flagellar M-ring protein [Cronobacter turicensis z3032]
          Length = 571

 Score =  152 bits (384), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 119/413 (28%), Positives = 196/413 (47%), Gaps = 50/413 (12%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +   P Y  LY  L   D   I   L++ NI +  +DNG+SI VP+  V   R+ LA QG
Sbjct: 46  WAKQPEYRVLYSNLSDQDGGAIVTQLTQMNIPYNFADNGASIMVPAEKVYDLRLRLAQQG 105

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP  
Sbjct: 106 LPKGGA-VGFELMDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPKP 163

Query: 162 GSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
             F +    P+ASV + ++ P          A+ H+V++AV  L  G+VT++D  G+LLT
Sbjct: 164 SLFVREQKSPSASVTL-SLQPGRTLDDGQVAAVVHMVSSAVAGLPPGNVTLVDQAGRLLT 222

Query: 219 -ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIV 277
            +    R++    L     ++  I+  I   LA  +G  N  + V A+++   ++  E  
Sbjct: 223 QSGTGARDLNDAQLKYASDVEGRIQRRIESILAPIVGSGNVHAQVTAQIDFSNKEQTEEQ 282

Query: 278 Y----DPDSKVERSIRLSKDAQRSE----------TSQPESAVTVE-------------- 309
           Y    DP     RS +L+ + Q             ++QP  A +                
Sbjct: 283 YRPNSDPSQMAVRSRQLNTNDQVGAGNPGGVPGALSNQPAPANSAPIDAPAGQNANGQNA 342

Query: 310 -------QNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVV 362
                  QN             S  ++ +++E +NYE++     T  +   ++RLS+AVV
Sbjct: 343 NGQNANGQNAQRTQSTSTTGASSGPHSSQRDETTNYEVDRTIRHTKMNVGDVQRLSVAVV 402

Query: 363 VNKGRL--TEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           VN  +L   + L  +ADQ      L +I  +   A G + +RGDT+ + +  F
Sbjct: 403 VNYRQLGNGKPLALTADQ------LKQIEDLTREAMGYSDKRGDTLNVVNSPF 449


>gi|256112170|ref|ZP_05453091.1| flagellar MS-ring protein [Brucella melitensis bv. 3 str. Ether]
 gi|256261971|ref|ZP_05464503.1| flagellar M-ring protein FliF [Brucella melitensis bv. 2 str. 63/9]
 gi|265993596|ref|ZP_06106153.1| flagellar M-ring protein FliF [Brucella melitensis bv. 3 str.
           Ether]
 gi|262764466|gb|EEZ10498.1| flagellar M-ring protein FliF [Brucella melitensis bv. 3 str.
           Ether]
 gi|263091455|gb|EEZ15991.1| flagellar M-ring protein FliF [Brucella melitensis bv. 2 str. 63/9]
 gi|326411310|gb|ADZ68374.1| flagellar MS-ring protein [Brucella melitensis M28]
 gi|326554599|gb|ADZ89238.1| flagellar MS-ring protein [Brucella melitensis M5-90]
          Length = 333

 Score =  152 bits (384), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 105/315 (33%), Positives = 175/315 (55%), Gaps = 18/315 (5%)

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
           +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  ++ +
Sbjct: 4   SIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNNRND 63

Query: 304 SAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVV 363
           +A  VEQN+P    +      S E TD++EE +NYE+N+ +++T  D Y ++RLSIAVV+
Sbjct: 64  NATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSMTVSTVSDGYSIKRLSIAVVI 123

Query: 364 NKGRLTEVLGRSADQGK-IDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG 422
           ++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+    +  
Sbjct: 124 DQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDPAGADME 183

Query: 423 TVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA-------KKGEVG 475
            V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       + GEV 
Sbjct: 184 PVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAGEVA 243

Query: 476 GKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHS-RNLQSRINSYVSKQSDLRLLHM 534
                +P  I  A + G      I   ++  D    S  +L+ R+       + LRL  M
Sbjct: 244 -----TPNFIGGAESVGEGVQAVIGGPAAYADQMKTSLSDLRQRMR----MPAKLRLEQM 294

Query: 535 IEINEERFAKILRKW 549
           IE++EER A +L++W
Sbjct: 295 IEMDEERVAAVLKQW 309


>gi|194439576|ref|ZP_03071649.1| flagellar M-ring protein FliF [Escherichia coli 101-1]
 gi|194421485|gb|EDX37499.1| flagellar M-ring protein FliF [Escherichia coli 101-1]
 gi|323972762|gb|EGB67962.1| flagellar M-ring protein FliF [Escherichia coli TA007]
          Length = 552

 Score =  152 bits (384), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 117/418 (27%), Positives = 197/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+     V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVTGSAAVAVMVALI--LWAKTPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|331657984|ref|ZP_08358946.1| flagellar M-ring protein FliF [Escherichia coli TA206]
 gi|331056232|gb|EGI28241.1| flagellar M-ring protein FliF [Escherichia coli TA206]
          Length = 552

 Score =  152 bits (384), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 117/418 (27%), Positives = 197/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+     V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVTGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEALTREAMGFSEKRGDSLNVVNSPF 429


>gi|315296472|gb|EFU55769.1| flagellar M-ring protein FliF [Escherichia coli MS 16-3]
          Length = 552

 Score =  152 bits (384), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 117/418 (27%), Positives = 197/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ L  QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLTQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRTLDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEALTREAMGFSEKRGDSLNVVNSPF 429


>gi|324013493|gb|EGB82712.1| flagellar M-ring protein FliF [Escherichia coli MS 60-1]
          Length = 552

 Score =  152 bits (384), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 124/442 (28%), Positives = 207/442 (46%), Gaps = 47/442 (10%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  +   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNISDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVSAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPTNQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDFLE 415
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F  
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEALTREAMGFSEKRGDSLNVVNSPF-- 429

Query: 416 NQLFNSGTV-----QVSFMDIL 432
           N    SG       Q +F+D L
Sbjct: 430 NSSDESGGALPFWQQQAFIDQL 451


>gi|332343664|gb|AEE56998.1| flagellar M-ring protein FliF [Escherichia coli UMNK88]
          Length = 552

 Score =  152 bits (384), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 117/418 (27%), Positives = 197/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+     V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVTGSAAVAVMVALI--LWAKTPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|307138605|ref|ZP_07497961.1| flagellar MS-ring protein [Escherichia coli H736]
 gi|331642559|ref|ZP_08343694.1| flagellar M-ring protein FliF [Escherichia coli H736]
 gi|331039357|gb|EGI11577.1| flagellar M-ring protein FliF [Escherichia coli H736]
          Length = 552

 Score =  152 bits (384), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 117/418 (27%), Positives = 197/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+     V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVTGSAAVAVMVALI--LWAKTPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEALAREAMGFSEKRGDSLNVVNSPF 429


>gi|88813200|ref|ZP_01128440.1| flagellar M-ring protein [Nitrococcus mobilis Nb-231]
 gi|88789522|gb|EAR20649.1| flagellar M-ring protein [Nitrococcus mobilis Nb-231]
          Length = 580

 Score =  152 bits (384), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 120/402 (29%), Positives = 194/402 (48%), Gaps = 34/402 (8%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +   P Y  LY  L   D + ++ AL  ANI  R+  N  +I VP+  + +AR+ LA Q
Sbjct: 62  MWAQEPTYRALYANLPTQDASAVADALQTANIPHRLDTNSGAILVPAQRLSEARLKLAGQ 121

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP  +   G+E   +   FG + FM+     RALE E+ARTI ++  +  +RVH+ +P+
Sbjct: 122 GLP-HTGGVGFESLRQEQGFGTSQFMETARFQRALETELARTIDALDPVARSRVHLAIPE 180

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+A+V I      V  S +  AI HLVA+AVP +    VT++D  G+LL+
Sbjct: 181 RSVFVRDRKTPSAAVSIGLYPGRVLSSGQVLAIAHLVASAVPAMTASAVTIVDQRGRLLS 240

Query: 219 --ANEMERNILGKSLSIVQ-AIQHEIE----MNINKALAAFLGVDNFRSAVVAELNMDTQ 271
             ANE E    G + ++ Q A +H +E      I   L   +G  + ++ V A ++   Q
Sbjct: 241 RVANEGE----GLNATVQQLAFRHRVEEAYARRIEDLLTPIVGAGHVKAQVNARVDFSAQ 296

Query: 272 QIREIVYDPDSKVERSIRLSKD-AQRSE---------TSQPESAVTVEQNMPHVSDRKVP 321
           +  E +Y P+  V RS +  K+  +RS+         ++QP    T++   P  S + V 
Sbjct: 297 ERTEELYQPEQSVVRSEQSMKERTERSQKAIGVPGALSNQPPGTGTLQPAQPGKSGKPVD 356

Query: 322 LPRSLENTDKKE-------EQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRL---TEV 371
              +   T   E          NYEI+            + RLS+AV++++  +   T+ 
Sbjct: 357 QQEAANQTSAPELVDSRISHTRNYEISKTIHHVRTPRGAITRLSVAVLLDRPAIAAKTKD 416

Query: 372 LGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
             ++  Q      LAE+ ++V    G ++ RGDTI + S  F
Sbjct: 417 KTQAPPQVDPQVELAELTELVKQVVGFDADRGDTINLISSPF 458


>gi|256022404|ref|ZP_05436269.1| flagellar MS-ring protein [Escherichia sp. 4_1_40B]
 gi|301029395|ref|ZP_07192489.1| flagellar M-ring protein FliF [Escherichia coli MS 196-1]
 gi|299877699|gb|EFI85910.1| flagellar M-ring protein FliF [Escherichia coli MS 196-1]
          Length = 552

 Score =  152 bits (384), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 117/418 (27%), Positives = 197/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+     V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVTGSAAVAVMVALI--LWAKTPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEALTREAMGFSEKRGDSLNVVNSPF 429


>gi|224373126|ref|YP_002607498.1| flagellar MS-ring protein [Nautilia profundicola AmH]
 gi|223589285|gb|ACM93021.1| flagellar M-ring protein FliF [Nautilia profundicola AmH]
          Length = 561

 Score =  152 bits (384), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 137/440 (31%), Positives = 225/440 (51%), Gaps = 35/440 (7%)

Query: 3   ILDQLLQFFKSGTSLGRTRILILASVI-LVPIMLFMAARFFVNSPH----YDNLYVKLEV 57
           +  Q++ F K+     R +I+I+++++ LV I+ F+   F   S      Y  L+  L  
Sbjct: 6   LFKQIIAFTKNLNK--RQKIVIISAIVALVAIISFLVV-FNTTSSKTKTGYAILFDNLSS 62

Query: 58  SDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKV 117
            D   I   L +  I + I ++G  I VP  +V K R+ +AAQGLP SS   G+ELFDK 
Sbjct: 63  KDAALIVQYLDKKQIPYVIPEDGV-IEVPKDVVQKIRLDVAAQGLPKSSK-VGFELFDK- 119

Query: 118 NSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI 177
           NSFG+T F Q++  +RALEGE+ RTI+S+  + +A V+I +P    F +    PTASV+I
Sbjct: 120 NSFGITDFEQKVKYLRALEGELGRTIESLDAVESATVNIAIPKDSVFVEKQTPPTASVVI 179

Query: 178 RAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTAN-EMERN--ILGKSL 231
           + + P++    K  + I++LVAAAVP +   +V ++D  G LL  N E+ +N  +L   +
Sbjct: 180 K-LKPNMVLTPKQIQGIKYLVAAAVPKMKPENVKIIDQYGNLLGENDELTQNNELLKAEI 238

Query: 232 SIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQ----QIREIVYDPDSKVERS 287
              + ++  +E  I   LA  +G  N    VVA++N+D      + +  +Y PD+     
Sbjct: 239 IYKKRMEKALEDKIVSILAPVIGGKN---KVVAKVNLDIDFSQVKSKSTIYSPDN----V 291

Query: 288 IRLSKDAQRSETS-QPESAVTVEQNMPHVSDRKVPLPRSLENTD---KKEEQSNYEINTK 343
           +R  +  + S T  +P+    V   + +V    V   +S E  D   K +  +NYEI+T 
Sbjct: 292 VRSEQTLEESRTGYKPKEVGGVPGAVSNVGP--VQGTKSNEVKDKYTKSQTTTNYEISTT 349

Query: 344 SIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRG 403
                    K++R++ AVVV+     +  G+          L  I  +V    G + +RG
Sbjct: 350 VKDVKEPLAKIKRITAAVVVDGHYKEDKDGKKEFVPLTKLELTNIENLVKNTIGYDPKRG 409

Query: 404 DTITITSMDFLENQLFNSGT 423
           D+++++S  F  N   N  T
Sbjct: 410 DSVSVSSFQFTGNSANNEPT 429


>gi|331683490|ref|ZP_08384091.1| flagellar M-ring protein FliF [Escherichia coli H299]
 gi|331079705|gb|EGI50902.1| flagellar M-ring protein FliF [Escherichia coli H299]
          Length = 552

 Score =  152 bits (384), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 117/418 (27%), Positives = 197/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+     V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVTGSAAVAVMVALI--LWAKTPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDKGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEALTREAMGFSEKRGDSLNVVNSPF 429


>gi|253990094|ref|YP_003041450.1| flagellar MS-ring protein [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253781544|emb|CAQ84707.1| flagellar basal-body m-ring protein [Photorhabdus asymbiotica]
          Length = 567

 Score =  152 bits (383), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 123/427 (28%), Positives = 205/427 (48%), Gaps = 45/427 (10%)

Query: 26  ASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISV 85
           ++ I + I LF+    ++ SP Y  LY  L   D   I   L++ NI +R ++NGS+I +
Sbjct: 35  SAAIAIVIALFL----WLRSPDYRVLYSNLSDKDGGEIVTQLTQLNIPYRFAENGSAIMI 90

Query: 86  PSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQS 145
           P+  V + R+ LA QGLP   + +G+EL DK   FG++ F +++   RALEGE++RTI+S
Sbjct: 91  PAGQVHETRLRLAQQGLPKGGA-AGFELLDK-EKFGISQFSEQVNYQRALEGELSRTIES 148

Query: 146 ISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLD 203
           +  +  ARVH+ +P    F +    P+ASV +  +        +  AI H+V+++V  L 
Sbjct: 149 LGPVQNARVHLALPKPSLFVREQKSPSASVTVGLLQGRTLDEGQINAIVHMVSSSVAGLP 208

Query: 204 MGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAV 262
             +VT++D  G+LLT A+   R++    L  +Q +++  +  I   L   +G  N  + V
Sbjct: 209 PSNVTIVDQAGRLLTQADATGRDLNTSQLKYIQEVENRFQQRIEAILTPVVGRGNVHAQV 268

Query: 263 VAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS--------------QP------ 302
            A+++   ++     Y P+    ++   SK    SE S              QP      
Sbjct: 269 TAQVDFSRREETAEEYKPNQPPNQAAVRSKQLSESEQSGGPLVGGIPGALSNQPSPPPSA 328

Query: 303 --ESAVTVEQNMPHVSDRKVPLPRSLENTDKK----------EEQSNYEINTKSIATTHD 350
             E   T E N    SD+K     S  N++++          +E +NYE++         
Sbjct: 329 PIEKPNTKESNKSDKSDKKT---SSSGNSNERMVNNNRNNRRDETTNYEVDRTIRHVQQQ 385

Query: 351 NYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITS 410
              +ERLS+AVVVN     E       Q      LA+I  +   A G +  RGD++ + +
Sbjct: 386 AGGVERLSVAVVVNY-VTVEGKNGPETQALTPEQLAKIEALTREAMGFSKERGDSLNVVN 444

Query: 411 MDFLENQ 417
             F E++
Sbjct: 445 TPFTESK 451


>gi|270262379|ref|ZP_06190651.1| flagellar M-ring protein FliF [Serratia odorifera 4Rx13]
 gi|270044255|gb|EFA17347.1| flagellar M-ring protein FliF [Serratia odorifera 4Rx13]
          Length = 567

 Score =  152 bits (383), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 115/414 (27%), Positives = 202/414 (48%), Gaps = 44/414 (10%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  SP Y  LY  L   D   I   L++ NI +R ++NG+++ +P+  V + R+ LA Q
Sbjct: 46  LWAKSPDYRVLYSNLNDRDGGAIVTQLTQMNIPYRFAENGAALMIPADKVHETRLRLAQQ 105

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F ++I   RALEGE++RTI+S+  +  ARVH+ +P 
Sbjct: 106 GLPKGGA-VGFELLDQ-EKFGISQFSEQINYQRALEGELSRTIESLGPVQNARVHLALPK 163

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        AI ++V+++V  L  G+VTV+D  G+
Sbjct: 164 PSLFVREQKSPSASVTLTLQPGRALDDG---QINAIVYMVSSSVAGLPPGNVTVVDQAGR 220

Query: 216 LLTANE-MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT ++   R++    L     +++  +  I   LA  +G  N  + V A+++  T++  
Sbjct: 221 LLTQSDGAGRDLNAAQLKYANEVENRYQRRIEAILAPMVGNANVHAQVTAQIDFATREQT 280

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQPESAVTVE----------- 309
           +  Y P+    ++   S+   +SE              ++QP +  T             
Sbjct: 281 DEEYQPNQLPNQAAVRSQQMSQSEQLGGPQVGGVPGALSNQPSAPATAPIETAKTNAAAG 340

Query: 310 ----QNMPH-VSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVN 364
                  P+  + R      S     +++E +NYE++     T      ++RLS+AVVVN
Sbjct: 341 NNANGAKPNAAATRSTAANGSGPQNTRRDETTNYEVDRTIRHTQQKAGTVQRLSVAVVVN 400

Query: 365 KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQL 418
             R  +  G+     K    LA+I  +V  + G +S RGDT+ + +  F + ++
Sbjct: 401 Y-RGVDKDGKPLPMSK--EQLAQIESLVRESMGFSSSRGDTLNVVNTPFTDTEV 451


>gi|148546737|ref|YP_001266839.1| flagellar MS-ring protein [Pseudomonas putida F1]
 gi|148510795|gb|ABQ77655.1| flagellar M-ring protein FliF [Pseudomonas putida F1]
          Length = 592

 Score =  152 bits (383), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 143/571 (25%), Positives = 253/571 (44%), Gaps = 87/571 (15%)

Query: 33  IMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGK 92
           + +  A   +   P Y  LY  L   D  ++   L+ A+I + +  N  ++ V +  + +
Sbjct: 50  VAIGFAVVLWSQQPDYRPLYGSLSGMDTKQVMDTLAAADIPYNVEPNSGALLVKADDLSR 109

Query: 93  ARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAA 152
           AR+ LAA G+  S  N G+EL DK    G + FM+     R+LEGE+ART+ S++ + AA
Sbjct: 110 ARLKLAAAGVAPSDGNVGFELLDKEQGLGTSQFMEATRYRRSLEGELARTVSSLNNVKAA 169

Query: 153 RVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVL 210
           RVH+ +P    F +   +P+ASV++        ++ +  AI +LVA +VP LD   VTV+
Sbjct: 170 RVHLAIPKSSVFVRDERKPSASVLVELYPGRALEAGQVMAIVNLVATSVPELDKSQVTVV 229

Query: 211 DSTGKLLTANEMERNIL---GKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELN 267
           D  G LL+  +++ + L   GK     + ++  +   ++  L   LG D +++ V A+L+
Sbjct: 230 DQKGNLLS-EQIQDSALTQAGKQFDYSRRVESMLTQRVHNILLPVLGNDRYKAEVSADLD 288

Query: 268 MDTQQIREIVYDPDSKVERSIRLSKDAQRSET-----------SQPESAVTVEQ------ 310
               +     ++PD    RS + S D QR+ +           +QP  A +  Q      
Sbjct: 289 FSAVESTSEQFNPDQPALRSEQ-SVDEQRASSQGPQGVPGALSNQPPGAASAPQTTGGAA 347

Query: 311 ---------------NMPHVSDRKVPLPRSLENTDKKEEQS--NYEINTKSIATTHDNYK 353
                          N   + D     P        K +QS  N+E++     T     +
Sbjct: 348 TPAAAIQPGQPLVDANGQQIMDPATGQPMLAPYPSDKRQQSTKNFELDRSISHTRQQQGR 407

Query: 354 LERLSIAVVVN-KGRLTEVLGRS--ADQGKIDSYLAEINKIVSAATGINSRRGDTITITS 410
           + RLS+AVVV+ + ++    G +  A  G  D  LA   ++V  A G ++ RGD++T+ +
Sbjct: 408 MTRLSVAVVVDDQVKIDPATGDTTRAPWGAED--LARFTRLVQDAVGFDASRGDSVTVIN 465

Query: 411 MDFLENQLFNSGTV----QVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNI 466
           + F  ++      +    Q  F DI+ +    V+  LV + G L            L+NI
Sbjct: 466 VPFAADRGEEIADIAFYQQPWFWDIV-KQVLGVVFILVLVFGVLRPV---------LNNI 515

Query: 467 DDAKKG-------EVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIF-SHSRNLQSR 518
               K        E+GG   L           G + ND ++L      +  S S   +++
Sbjct: 516 TGGGKQAAPDSDMELGGMMGLD----------GELANDRVSLGGPTSILLPSPSEGYEAQ 565

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKW 549
           +N+         +  ++  +  R A++++ W
Sbjct: 566 LNA---------IKGLVAEDPGRVAQVVKDW 587


>gi|238788332|ref|ZP_04632126.1| Flagellar M-ring protein [Yersinia frederiksenii ATCC 33641]
 gi|238723578|gb|EEQ15224.1| Flagellar M-ring protein [Yersinia frederiksenii ATCC 33641]
          Length = 569

 Score =  151 bits (382), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 136/546 (24%), Positives = 247/546 (45%), Gaps = 64/546 (11%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  SP Y  LY  L   D   I   L++ NI +R +D+G ++ +P+  V + R+ LA Q
Sbjct: 46  LWAKSPDYRVLYSNLSDRDGGDIVTQLTQLNIPYRFADHGGALLIPADKVHETRLRLAQQ 105

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI ++  ++  RVH+ MP 
Sbjct: 106 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIGTLGPVLNVRVHLAMPK 163

Query: 161 MGSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +    PTASV + A+ P          AI ++V+++V  L   +VTV+D TG+LL
Sbjct: 164 PSLFVREQKSPTASVTL-ALQPGRALDDGQINAIVYMVSSSVAGLPPANVTVVDQTGRLL 222

Query: 218 T-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI 276
           T ++   R++    L     +++  +  I   LA  +G  N  + V A+++  +++  + 
Sbjct: 223 TQSDSAGRDLNAAQLKFTNEVENRFQRRIETILAPMVGSGNVHAQVTAQVDFASREQTDE 282

Query: 277 VYDPDSKVERSIRLSKDAQRSE--------------TSQPESAVTVEQNMPHVSDRKVPL 322
            Y P+    +    S+    SE              ++QP +       +P  +      
Sbjct: 283 EYKPNQAANQGAVRSQQVSSSEQLGGSNVGGVPGALSNQPSATPVAPIEVPQPAAAPGAT 342

Query: 323 ------------PRSLENT-----DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNK 365
                       P +  +T      + ++ +N+E++     T      ++RLS+AVVVN 
Sbjct: 343 GAAANNANAANSPATTRSTATSSNSRHDQTTNFEVDRTIRHTQQQAGMVQRLSVAVVVNY 402

Query: 366 G--RLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGT 423
           G  +  + +  + DQ      LA++  +   A G ++ RGDT+ + +  F  N   N+  
Sbjct: 403 GSDKAGKPIALTKDQ------LAQVESLTREAMGFSTDRGDTLNVVNTPF--NATDNASG 454

Query: 424 VQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPP 483
             + F    S  F  ++NA  +L+  L+   L    +R L  I   +  +    S+ +  
Sbjct: 455 NALPFWQQPS-FFDQLLNAGRYLLILLVAWILWRKLVRPL--IAKKQIADKAAASVNNIV 511

Query: 484 PISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFA 543
             + A  T     + +AL   N          Q R+++ V  Q   R+  + + +    A
Sbjct: 512 QTAQATETAKQSKEELALRKKN----------QQRVSAEVQAQ---RIRELADKDPRVVA 558

Query: 544 KILRKW 549
            ++R+W
Sbjct: 559 LVIRQW 564


>gi|26991058|ref|NP_746483.1| flagellar MS-ring protein [Pseudomonas putida KT2440]
 gi|24986091|gb|AAN69947.1|AE016633_5 flagellar basal-body M-ring protein FliF [Pseudomonas putida
           KT2440]
          Length = 592

 Score =  151 bits (382), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 143/571 (25%), Positives = 253/571 (44%), Gaps = 87/571 (15%)

Query: 33  IMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGK 92
           + +  A   +   P Y  LY  L   D  ++   L+ A+I + +  N  ++ V +  + +
Sbjct: 50  VAIGFAVVLWSQQPDYRPLYGSLSGMDTKQVMDTLAAADIPYNVEPNSGALLVKADDLSR 109

Query: 93  ARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAA 152
           AR+ LAA G+  S  N G+EL DK    G + FM+     R+LEGE+ART+ S++ + AA
Sbjct: 110 ARLKLAAAGVAPSDGNVGFELLDKEQGLGTSQFMEATRYRRSLEGELARTVSSLNNVKAA 169

Query: 153 RVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVL 210
           RVH+ +P    F +   +P+ASV++        ++ +  AI +LVA +VP LD   VTV+
Sbjct: 170 RVHLAIPKSSVFVRDERKPSASVLVELYPGRALEAGQVMAIVNLVATSVPELDKSQVTVV 229

Query: 211 DSTGKLLTANEMERNIL---GKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELN 267
           D  G LL+  +++ + L   GK     + ++  +   ++  L   LG D +++ V A+L+
Sbjct: 230 DQKGNLLS-EQIQDSALTQAGKQFDYSRRVESMLTQRVHNILQPVLGNDRYKAEVSADLD 288

Query: 268 MDTQQIREIVYDPDSKVERSIRLSKDAQRSET-----------SQPESAVTVEQ------ 310
               +     ++PD    RS + S D QR+ +           +QP  A +  Q      
Sbjct: 289 FSAVESTSEQFNPDQPALRSEQ-SVDEQRASSQGPQGVPGALSNQPPGAASAPQTTGGAA 347

Query: 311 ---------------NMPHVSDRKVPLPRSLENTDKKEEQS--NYEINTKSIATTHDNYK 353
                          N   + D     P        K +QS  N+E++     T     +
Sbjct: 348 TPAAAIQPGQPLVDANGQQIMDPATGQPMLAPYPSDKRQQSTKNFELDRSISHTRQQQGR 407

Query: 354 LERLSIAVVVN-KGRLTEVLGRS--ADQGKIDSYLAEINKIVSAATGINSRRGDTITITS 410
           + RLS+AVVV+ + ++    G +  A  G  D  LA   ++V  A G ++ RGD++T+ +
Sbjct: 408 MARLSVAVVVDDQVKIDPATGDTTRAPWGAED--LARFTRLVQDAVGFDASRGDSVTVIN 465

Query: 411 MDFLENQLFNSGTV----QVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNI 466
           + F  ++      +    Q  F DI+ +    V+  LV + G L            L+NI
Sbjct: 466 VPFAADRGEEIADIAFYQQPWFWDIV-KQVLGVVFILVLVFGVLRPV---------LNNI 515

Query: 467 DDAKKG-------EVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIF-SHSRNLQSR 518
               K        E+GG   L           G + ND ++L      +  S S   +++
Sbjct: 516 TGGGKQAAPDSDMELGGMMGLD----------GELANDRVSLGGPTSILLPSPSEGYEAQ 565

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKW 549
           +N+         +  ++  +  R A++++ W
Sbjct: 566 LNA---------IKGLVAEDPGRVAQVVKDW 587


>gi|318605263|emb|CBY26761.1| flagellar M-ring protein FliF [Yersinia enterocolitica subsp.
           palearctica Y11]
          Length = 559

 Score =  151 bits (382), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 134/536 (25%), Positives = 243/536 (45%), Gaps = 54/536 (10%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  SP Y  LY  L   D   I   L++ NI +R +DNG ++ +P+  V + R+ LA Q
Sbjct: 46  LWAKSPDYRVLYSNLNDRDGGDIVTQLTQLNIPYRFADNGGALLIPADKVHETRLRLAQQ 105

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI ++  ++  RVH+ MP 
Sbjct: 106 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIGTLGPVLNVRVHLAMPK 163

Query: 161 MGSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +    PTASV + A+ P          AI ++V+++V  L   +VTV++ TG+LL
Sbjct: 164 PSLFVREQKSPTASVTL-ALQPGRALDDGQINAIVYMVSSSVAGLPPANVTVVNQTGRLL 222

Query: 218 T-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI 276
           T ++   R++    L     +++  +  I   LA  +G  N  + V A+++  +++  + 
Sbjct: 223 TQSDSAGRDLNAAQLKFTNEVENRFQRRIETILAPMVGSGNVHAQVTAQVDFASREQTDE 282

Query: 277 VYDPDSKVERSIRLSKDAQRSE------------------TSQPESAVTVEQNMPHVSDR 318
            Y P+    +    S+    SE                  ++ P + + V Q  P     
Sbjct: 283 EYKPNQAANQGAVRSQQVSTSEQLGGTNVGGVPGALSNQPSATPVAPIEVPQATPAAGAG 342

Query: 319 KVPLPRSLENT---DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG--RLTEVLG 373
                     T    + ++ +N+E++     T      ++RLS+AVVVN G  +  + + 
Sbjct: 343 AAANAAKQTATSSNSRHDQTTNFEVDRTIRHTQQQAGMVQRLSVAVVVNYGSDKAGKPIA 402

Query: 374 RSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILS 433
            S DQ      LA++  +   A G ++ RGDT+ + +  F  N   ++    + F    S
Sbjct: 403 LSKDQ------LAQVESLTREAMGFSTVRGDTLNVVNTPF--NATDDASGSNLPFWQQPS 454

Query: 434 RHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGL 493
             F  ++N   +L+  L+   L    +R L  I   ++ +    S+ +    +    T  
Sbjct: 455 -FFDQLLNIGRYLLILLVAWILWRKLVRPL--IAKKQEADKAAASVNNIVQAAQTTETAK 511

Query: 494 MPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKW 549
              + +AL   N          Q R+++ V  Q   R+  + + +    A ++R+W
Sbjct: 512 QTKEELALRKKN----------QQRVSAEVQAQ---RIRELADKDPRIVALVIRQW 554


>gi|238751780|ref|ZP_04613268.1| Flagellar M-ring protein [Yersinia rohdei ATCC 43380]
 gi|238710051|gb|EEQ02281.1| Flagellar M-ring protein [Yersinia rohdei ATCC 43380]
          Length = 564

 Score =  151 bits (382), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 140/543 (25%), Positives = 250/543 (46%), Gaps = 63/543 (11%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  SP Y  LY  L   D   I   L++ NI +R +D+G ++ +P+  V + R+ LA Q
Sbjct: 46  LWAKSPDYRVLYSNLSDRDGGDIVTQLTQLNIPYRFADSGGALLIPADKVHETRLRLAQQ 105

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI ++  ++  RVH+ MP 
Sbjct: 106 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIGTLGPVLNVRVHLAMPK 163

Query: 161 MGSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +    PTASV + A+ P          AI ++V+++V  L   +VTV+D TG+LL
Sbjct: 164 PSLFVREQKSPTASVTL-ALQPGRALDDGQINAIVYMVSSSVAGLPPANVTVVDQTGRLL 222

Query: 218 T-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI 276
           T ++   R++    L     +++  +  I   LA  +G  N  + V A+++  +++  + 
Sbjct: 223 TQSDSAGRDLNAAQLKFTNEVENRFQRRIETILAPMVGSGNVHAQVTAQVDFASREQTDE 282

Query: 277 VYDPDSKVE----RSIRLSKDAQ--------------RSETSQPESAVTVEQNMPHVSDR 318
            Y P+        RS ++S   Q                 ++ P + + V Q     +  
Sbjct: 283 EYKPNQSANQGAVRSAQISTSEQLGGSNVGGVPGALSNQPSATPVAPIEVTQPAGANNAN 342

Query: 319 KVPLPR--------SLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG--RL 368
               P         +  +  + ++ +NYE++     T      ++RLS+AVVVN G  + 
Sbjct: 343 AAARPAATPAARSTATSSNSRHDQTTNYEVDRTIRHTQQQAGMVQRLSVAVVVNYGSDKA 402

Query: 369 TEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSF 428
            + +  + DQ      LA++  +   A G ++ RGDT+ + +  F  N   ++    + F
Sbjct: 403 GKPIALTKDQ------LAQVESLTREAMGFSTNRGDTLNVVNTPF--NATDDTTGRALPF 454

Query: 429 MDILSRHFATVINALVFLVGTLLVTFLGLHALRR--LHNIDDAKKGEVGGKSILSPPPIS 486
               S  F  ++NA  +L+  LLVT++    L R  L   + A K      S++    ++
Sbjct: 455 WQQQS-FFDQLLNAGRYLL-ILLVTWILWRKLVRPMLAKKNVADKAAASVNSMVQAAQVT 512

Query: 487 SAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKIL 546
             V       + +AL   N          Q RI++ V  Q   R+  + + +    A ++
Sbjct: 513 ETVKQS---KEELALRKKN----------QQRISAEVQAQ---RIRELADKDPRVVALVI 556

Query: 547 RKW 549
           R+W
Sbjct: 557 RQW 559


>gi|51246508|ref|YP_066392.1| flagellar M-ring protein (FliF) [Desulfotalea psychrophila LSv54]
 gi|50877545|emb|CAG37385.1| related to flagellar M-ring protein (FliF) [Desulfotalea
           psychrophila LSv54]
          Length = 545

 Score =  151 bits (382), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 120/417 (28%), Positives = 211/417 (50%), Gaps = 42/417 (10%)

Query: 20  TRILILASVILVPIMLFMAARFFVNSPHYDN--LYVKLEVSDVNRISVALSEANIDFRIS 77
           +R L L +V+++ +  F  A   + +   D   LY  L  +D   ++  L    I + + 
Sbjct: 41  SRQLSLGAVLILCLAAF--ATIIIQTRTVDQQLLYANLSATDAAAVTEWLKGQKIPYSLK 98

Query: 78  DNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEG 137
           D+G S+ + S+ + +AR+ LAA GLPS     G+E+FDK N F LT+++Q+I   RAL+G
Sbjct: 99  DSGKSVWIGSNKIYQARLDLAANGLPSGG-GVGFEVFDKQN-FALTNYVQKINYSRALQG 156

Query: 138 EIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVY--KSAEAIRHLV 195
           E+ARTI S++ I + RVH+ +P+   F+    + TASV++  +       +  E I +LV
Sbjct: 157 ELARTISSLAPIESTRVHLAIPEKRLFKNQQKQATASVILSLVPGKTLSQEQVEGIAYLV 216

Query: 196 AAAVPNLDMGDVTVLDSTGKLLTANEM---ERNILGKSLSIVQAIQHEIEMNINKALAAF 252
           A +VP L+  +V VLDS+G +L   E    +R +    L+  + I+ ++EM     L   
Sbjct: 217 AGSVPGLETDNVKVLDSSGVILGDREQNGGDRALSSDMLAFQKEIETQMEMRAQDLLTRT 276

Query: 253 LGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNM 312
           +G D+    V A ++    +  E  +D D  V RS +++ ++ R   ++      VE N+
Sbjct: 277 MGADHALVRVTATVDFAKVEKTEEFFDADDPVIRSEQINNESSRG--AEAGGIPGVESNL 334

Query: 313 PHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVL 372
                +    P +++N       +NYEI+       +    +++LS++V+V         
Sbjct: 335 QGTQKKSGTGPSAVKNG----RTTNYEISKTISHIVNPVGTVKKLSVSVLV--------- 381

Query: 373 GRSADQGKID------SY-------LAEINKIVSAATGINSRRGDTITITSMDFLEN 416
              AD+ K+D      SY       L  +  +V++A G+ + RGD I + SM F ++
Sbjct: 382 ---ADRQKLDPDTQEPSYTPFSTTELKALENMVASAIGLVATRGDVINVISMPFFQD 435


>gi|205352337|ref|YP_002226138.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205272118|emb|CAR36971.1| flagellar basal-body M-ring protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|326627387|gb|EGE33730.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 558

 Score =  151 bits (382), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 128/430 (29%), Positives = 206/430 (47%), Gaps = 54/430 (12%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R  LA Q
Sbjct: 44  LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELR--LAQQ 101

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 102 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 159

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D +G 
Sbjct: 160 PSLFVREQKSPSASVTVTLEPGRALD---EGQISAVVHLVSSAVAGLPPGNVTLVDQSGH 216

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  I+  I   L+  +G  N  + V A+L+   +   
Sbjct: 217 LLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKDQT 276

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQP----ESAVTVE------- 309
           E  Y P+    ++   S+    SE              ++QP    E+ +          
Sbjct: 277 EEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNA 336

Query: 310 QNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLT 369
           QN P  S           NT ++ E SNYE++     T  +   +ERLS+AVVVN   L 
Sbjct: 337 QNTPQTSTSTNSNSAGPRNT-QRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLA 395

Query: 370 E--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG----- 422
           +   L  +ADQ K      +I  +   A G + +RGDT+ + +  F  + + N+G     
Sbjct: 396 DGKPLPLTADQMK------QIEDLTREAMGFSDKRGDTLNVVNSPF--SAVDNTGGELPF 447

Query: 423 TVQVSFMDIL 432
             Q SF+D L
Sbjct: 448 WQQQSFIDQL 457


>gi|313901521|ref|ZP_07834968.1| flagellar M-ring protein FliF [Thermaerobacter subterraneus DSM
           13965]
 gi|313468216|gb|EFR63683.1| flagellar M-ring protein FliF [Thermaerobacter subterraneus DSM
           13965]
          Length = 551

 Score =  151 bits (382), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 110/339 (32%), Positives = 174/339 (51%), Gaps = 24/339 (7%)

Query: 44  NSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLP 103
           + P +  L+ +L+ +D   I+  L E  I F+++  G +I VP+  V + R+ LAAQGLP
Sbjct: 48  SGPQWAPLFTQLDPTDAAAIAGQLEEQGIPFQLAQGGQAILVPAEQVDRLRLDLAAQGLP 107

Query: 104 SSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGS 163
              +  G EL + +   G T F +++  +R L+GE+ARTI  + G+ AARVH+V P+   
Sbjct: 108 RQGT-VGLELLENM-PMGATEFERQVQYLRGLQGELARTIGRLEGVEAARVHVVRPERSP 165

Query: 164 FRKIGARPTASVMIRAINPSVYKSAEAIR---HLVAAAVPNLDMGDVTVLDSTGKLLTAN 220
           F       TA+V+++ + P      E +R   HLVA+AV  L   DVTV+D+TG+LL+A 
Sbjct: 166 FVSQQRPATAAVLVQ-LKPGAELEPEQVRSIMHLVASAVEGLKPEDVTVVDTTGRLLSAG 224

Query: 221 -----EMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
                E    + G    + +  + E++ ++   L   LG  N  + V AELN D Q +  
Sbjct: 225 VELAQEGTAVVPGDRFEVERRFEAELQRSLQTLLEQVLGPGNVIARVNAELNFDQQVVER 284

Query: 276 IVYDPDSKVERSI-RLSKDAQRSETSQP-ESAVTVEQNMPHVSDRKVPLPRSLENT---D 330
            +++P +   + I R  ++ Q + T QP    V  + N+P         P+    T    
Sbjct: 285 HLFEPPADGGQGILRSIQELQETFTGQPAPGGVPGDSNIPT-------YPQVGGGTLDYQ 337

Query: 331 KKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLT 369
           + E  +NYE+N            + RLS+AVVVN G LT
Sbjct: 338 RSERTANYEVNQVVDRVQVAPGAVRRLSVAVVVN-GDLT 375


>gi|89094455|ref|ZP_01167395.1| flagellar M-ring protein [Oceanospirillum sp. MED92]
 gi|89081347|gb|EAR60579.1| flagellar M-ring protein [Oceanospirillum sp. MED92]
          Length = 554

 Score =  151 bits (382), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 131/497 (26%), Positives = 228/497 (45%), Gaps = 33/497 (6%)

Query: 33  IMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGK 92
           + +  A   +   P    L+  L  SD N+I   L   N+ +    +G +I VP   V +
Sbjct: 35  VAIGFAVVLWSQKPEQRVLFSNLTFSDANQIIEQLRLYNVPYTFDADGRAILVPDEHVHQ 94

Query: 93  ARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAA 152
           AR+ LAA+G  +S    G+E+ D+  S G + FM+     R LEGE+ARTI S++ +  A
Sbjct: 95  ARLKLAAEGF-TSDKTVGFEILDREQSLGTSQFMETTKYRRGLEGELARTISSMTSVRNA 153

Query: 153 RVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVL 210
           RVH+ +P    F +   +PTASV +   +    +  +  +I +LVA+++P LD+ DVTV+
Sbjct: 154 RVHLAIPKDTVFIRDTRKPTASVFLELFSGRKLERDQVASIANLVASSIPALDVKDVTVV 213

Query: 211 DSTGKLLTANEMERNIL--GKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNM 268
           D  G+LL   + + +++   K L   ++I+  +   +N  L   +G+  FR+ V A+++ 
Sbjct: 214 DQRGRLLNMRDKDVDVVLAAKQLEYTRSIEDTLLNRVNSILQPVVGMGRFRAEVSADVDF 273

Query: 269 DTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLE- 327
            + +  + +Y+PD    RS + + D  R     P        N P      VP   S E 
Sbjct: 274 TSVEQTDELYNPDLPALRSEQ-TMDESRVGNGAPVGIPGALSNQPP-GQSSVPEQASGEG 331

Query: 328 --------NTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNK-GRLTEVLGRSADQ 378
                    + +K+   N+E++     T H   ++ RL++AVVV+    +    G ++  
Sbjct: 332 VIAGNGQPGSSRKQATRNFELDRTISYTKHQQGRVRRLTVAVVVDDLASVNAETGETSRT 391

Query: 379 GKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTV----QVSFMDILSR 434
               + L  +  +V  A G ++ RGD++ + +  F   +   +  +    Q   MD++ +
Sbjct: 392 PWDQNELERLRILVQDAVGFSTLRGDSVNVVNTPFAAEEPIVTEEIPLWKQEWVMDVMKQ 451

Query: 435 HFATVINALVFLVGTLLVTFLGLHALRRLHNIDD-AKKGEV--------GGKSILSPPPI 485
             A +   LV + G L      L A     N+      GEV        GG    S   +
Sbjct: 452 VMAAIF-VLVLVFGILRPILRNLAAAGTAGNVAGLGAAGEVSAELEGLEGGD--FSADSV 508

Query: 486 SSAVTTGLMPNDNIALD 502
           +     GL+P  N + D
Sbjct: 509 TFGSDDGLLPTPNESFD 525


>gi|313497796|gb|ADR59162.1| FliF [Pseudomonas putida BIRD-1]
          Length = 592

 Score =  151 bits (382), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 143/571 (25%), Positives = 253/571 (44%), Gaps = 87/571 (15%)

Query: 33  IMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGK 92
           + +  A   +   P Y  LY  L   D  ++   L+ A+I + +  N  ++ V +  + +
Sbjct: 50  VAIGFAVVLWSQQPDYRPLYGSLSGMDTKQVMDTLAAADIPYNVEPNSGALLVKADDLSR 109

Query: 93  ARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAA 152
           AR+ LAA G+  S  N G+EL DK    G + FM+     R+LEGE+ART+ S++ + AA
Sbjct: 110 ARLKLAAAGVAPSDGNVGFELLDKEQGLGTSQFMETTRYRRSLEGELARTVSSLNNVKAA 169

Query: 153 RVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVL 210
           RVH+ +P    F +   +P+ASV++        ++ +  AI +LVA +VP LD   VTV+
Sbjct: 170 RVHLAIPKSSVFVRDERKPSASVLVELYPGRALEAGQVMAIVNLVATSVPELDKSQVTVV 229

Query: 211 DSTGKLLTANEMERNIL---GKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELN 267
           D  G LL+  +++ + L   GK     + ++  +   ++  L   LG D +++ V A+L+
Sbjct: 230 DQKGNLLS-EQIQDSALTQAGKQFDYSRRVESMLTQRVHNILQPVLGNDRYKAEVSADLD 288

Query: 268 MDTQQIREIVYDPDSKVERSIRLSKDAQRSET-----------SQPESAVTVEQ------ 310
               +     ++PD    RS + S D QR+ +           +QP  A +  Q      
Sbjct: 289 FSAVESTSEQFNPDQPALRSEQ-SVDEQRASSQGPQGVPGALSNQPPGAASAPQTTGGAA 347

Query: 311 ---------------NMPHVSDRKVPLPRSLENTDKKEEQS--NYEINTKSIATTHDNYK 353
                          N   + D     P        K +QS  N+E++     T     +
Sbjct: 348 TPAAAIQPGQPLVDANGQQIMDPATGQPMLAPYPSDKRQQSTKNFELDRSISHTRQQQGR 407

Query: 354 LERLSIAVVVN-KGRLTEVLGRS--ADQGKIDSYLAEINKIVSAATGINSRRGDTITITS 410
           + RLS+AVVV+ + ++    G +  A  G  D  LA   ++V  A G ++ RGD++T+ +
Sbjct: 408 MTRLSVAVVVDDQVKIDPATGDTTRAPWGAED--LARFTRLVQDAVGFDASRGDSVTVIN 465

Query: 411 MDFLENQLFNSGTV----QVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNI 466
           + F  ++      +    Q  F DI+ +    V+  LV + G L            L+NI
Sbjct: 466 VPFAADRGEEIADIAFYQQPWFWDIV-KQVLGVVFILVLVFGVLRPV---------LNNI 515

Query: 467 DDAKKG-------EVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIF-SHSRNLQSR 518
               K        E+GG   L           G + ND ++L      +  S S   +++
Sbjct: 516 TGGGKQAAPDSDMELGGMMGLD----------GELANDRVSLGGPTSILLPSPSEGYEAQ 565

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKW 549
           +N+         +  ++  +  R A++++ W
Sbjct: 566 LNA---------IKGLVAEDPGRVAQVVKDW 587


>gi|241763655|ref|ZP_04761705.1| flagellar M-ring protein FliF [Acidovorax delafieldii 2AN]
 gi|241367130|gb|EER61496.1| flagellar M-ring protein FliF [Acidovorax delafieldii 2AN]
          Length = 561

 Score =  151 bits (382), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 124/434 (28%), Positives = 204/434 (47%), Gaps = 35/434 (8%)

Query: 46  PHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSS 105
           P Y  L+  L   D   I   LS+ N+ ++ +D G +I +PS  V   R+ LA QGLP  
Sbjct: 53  PDYRVLFANLSDKDGGAIVAQLSQMNVPYKYADGGGAILIPSDRVHDVRLRLATQGLPKG 112

Query: 106 SSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFR 165
           S  +G+EL +  N FG+T F + +   R LEGE+ R+IQ++S +  ARVH+ +P+   F 
Sbjct: 113 SV-AGFELMES-NRFGITQFQERLNFQRGLEGELTRSIQALSSVQGARVHLALPNQNGFF 170

Query: 166 KIGARPTASVMIRAINPS-VYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE- 221
           +   +P+ASV++ +++P  +   A+   I HLVA++VP L    V+VLD TGKLL+ +  
Sbjct: 171 REQQKPSASVLV-SLHPGRILDRAQLAGIVHLVASSVPELAPSAVSVLDDTGKLLSQSPD 229

Query: 222 --MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNM----DTQQIRE 275
                 +  + L  VQ I+ +    I   L   +G +N ++ V AE++      T +   
Sbjct: 230 TAAGTGVDAQQLLYVQQIEQQYTRRIMDILEPVVGRNNVKAQVSAEVDFSQTESTSEQHR 289

Query: 276 IVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKV-----PLPR------ 324
               PD+   RS ++ +         P        N P  +         P P       
Sbjct: 290 PNQSPDASAVRSQQVVESNGPQGNPLPTGVPGAASNQPPAASTAPINGANPAPTAAGGQQ 349

Query: 325 --SLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKID 382
             +L    K+E   NYE++     T   +  ++RL+ AVVVN  +  E  G++  +    
Sbjct: 350 QGALGAGSKRESVINYEVDKTVRVTRGGSGAVKRLTAAVVVNY-QSAEDKGKTVAKALTP 408

Query: 383 SYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSF-----MDILSRHFA 437
             L ++  +V    G N  RGD++ + +  F   Q+  +    V       M  L++ FA
Sbjct: 409 EQLEQMTALVRETIGFNKERGDSVNLMNTPF---QVDVTPANDVPLWKQPEMLELAKSFA 465

Query: 438 TVINALVFLVGTLL 451
             + A++F    LL
Sbjct: 466 WPVGAVLFAALVLL 479


>gi|319944162|ref|ZP_08018438.1| flagellar basal-body M-ring protein FliF [Lautropia mirabilis ATCC
           51599]
 gi|319742457|gb|EFV94868.1| flagellar basal-body M-ring protein FliF [Lautropia mirabilis ATCC
           51599]
          Length = 574

 Score =  151 bits (381), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 127/466 (27%), Positives = 221/466 (47%), Gaps = 49/466 (10%)

Query: 20  TRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDN 79
           T+I   A VI +   + ++A  +   P +  LY  L   +   +   L + N+ ++ ++ 
Sbjct: 30  TKIKAGAGVIAL-GAVAVSAWLWSQQPDWKVLYNNLPDREGGAVIAQLVQMNVPYKYTEG 88

Query: 80  GSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEI 139
           G +I VP++MV  AR+ LAAQGLP+S + +GYEL +K   FG T F + +   R LEGE+
Sbjct: 89  GGAIMVPANMVNDARLRLAAQGLPASDT-TGYELLEK-QRFGTTQFQERLNFQRGLEGEL 146

Query: 140 ARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKS-------AEAIR 192
           AR+IQS++ +  ARVH+ MP    F +   +P+ASVM+     ++Y          + I 
Sbjct: 147 ARSIQSLAAVKQARVHLAMPVQSGFLREQQKPSASVML-----TLYPGRTLERGQVQGIL 201

Query: 193 HLVAAAVPNLDMGDVTVLDSTGKLLT---ANEMERNILGKSLSIVQAIQHEIEMNINKAL 249
            LVA++VP++    V+V+D  GKLL+    +  E N     ++    I+  +   I+  L
Sbjct: 202 ALVASSVPDMSPKQVSVVDQYGKLLSDLDGDGSEMNT--AQINYRNRIESTLTRRIDDLL 259

Query: 250 AAFLGVDNFRSAVVAELNMDTQQIREIVY----DPDSKVERSIRL--SKDAQRSE----- 298
           A  +G  N R+ V A+++    +     Y    +P +   RS +   S+D   +      
Sbjct: 260 APIVGDGNIRAQVAADIDFTQSEATAETYAPNQNPGAAAMRSQQTMASRDGSGASDAAGG 319

Query: 299 -----TSQPESAVTVEQNMPHVSDRKVPLPRSLEN----TDKKEEQSNYEINTKSIATTH 349
                ++QP + V+   N    + R      S +     + ++E  +NYE++     T +
Sbjct: 320 VPGALSNQPPATVSAPINGAAQATRAAGSASSADGGTGVSTRQESVTNYEVDRTVKVTRN 379

Query: 350 DNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITIT 409
               + RLS+AV+VN+ +     G+          +  I  +V  A G ++ RGD++ + 
Sbjct: 380 QTGTIRRLSVAVLVNQKQTKGDDGKEVSTPLTPLEMQSIEALVKQAVGFSAERGDSVQVV 439

Query: 410 SMDFL--------ENQLFNSGTVQVSFMDILSRHFATVINALVFLV 447
           +  F         E  L+      VS    L + F  V+ AL+ L+
Sbjct: 440 NAAFTKRPEVVDPEVPLWKDPET-VSLAKDLGKQFGFVLLALIILM 484


>gi|301168113|emb|CBW27699.1| flagellar basal-body M-ring protein [Bacteriovorax marinus SJ]
          Length = 554

 Score =  151 bits (381), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 119/437 (27%), Positives = 209/437 (47%), Gaps = 40/437 (9%)

Query: 3   ILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNR 62
           I+    +FF    SL   + + L S+    +  F+    + +    D LY +L   D  +
Sbjct: 8   IIRNFTEFF---NSLDLNKKIGLVSIAAFIVACFVGIVIWASKTRMDVLYTELNREDSKK 64

Query: 63  ISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGL 122
           I+V L E  I + +S++G +IS+P  ++ K R+ +A  G+ + S   GYE+FDK  SFG 
Sbjct: 65  IAVLLEEKKIPYEMSNDGKTISIPEELINKWRLEIATLGV-NFSGTVGYEVFDK-QSFGT 122

Query: 123 TSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR---- 178
           TSF+Q++ + RALEGE+ +TI+ I G+  ARVH+ +P+   F      P+ASV++     
Sbjct: 123 TSFVQKVNKQRALEGELVKTIKYIRGVKRARVHLSIPESSPFVSEKKAPSASVVVDLERG 182

Query: 179 -AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAI 237
             + P   K    +  LV++++  +   +V +LD  GK L+ N      +G  ++   A 
Sbjct: 183 VTLTPDEIK---GVASLVSSSIDGMRNENVVILDDRGKKLSEN------IGDPMTAYTAN 233

Query: 238 QHEIEMNINKA--------LAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIR 289
           +  +E  +N+         L+  +G     + V   L+       +  +D ++K   S  
Sbjct: 234 RMALEGKVNRKYEKQIEDILSKVVGAGKVIAKVTVNLDFTESVSTKTEFDGENKAVLSEV 293

Query: 290 LSKDAQRSETSQPESAVTVEQNMPHVSDRKVP-LPRSLENTDKKEEQSNYEINTKSIATT 348
            +          P+       N+P   ++  P +P +  N DK     NY + +K   + 
Sbjct: 294 SNTQKLNGSRPSPQGIPGARSNLP--GEQPQPGIPETRNNVDKSLATRNYNVPSKVTKSK 351

Query: 349 HDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSY-------LAEINKIVSAATGINSR 401
           +    + ++S AV+++ GR  +V G  AD      Y       LA  + IVS+  GI++R
Sbjct: 352 NPTAGIRKISAAVMID-GRRVQVKG--ADGAISTQYERWSEADLANFSAIVSSTLGIDAR 408

Query: 402 RGDTITITSMDFLENQL 418
           RGD I I +M+F +  +
Sbjct: 409 RGDQIVIKNMEFAQEDM 425


>gi|188534120|ref|YP_001907917.1| flagellar MS-ring protein [Erwinia tasmaniensis Et1/99]
 gi|188029162|emb|CAO97034.1| Flagellar basal-body M-ring protein [Erwinia tasmaniensis Et1/99]
          Length = 571

 Score =  151 bits (381), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 114/415 (27%), Positives = 198/415 (47%), Gaps = 50/415 (12%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +   P Y  LY  L   D   I   L++ N+ ++  D G ++ VP++ V + R+ LA+Q
Sbjct: 46  LWAKQPDYRVLYNNLSNEDGGAIVTQLTQMNVPYKFDDRGGALLVPAAQVHELRLRLASQ 105

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL DK   FG++ F ++I   RALEGE+ARTI ++  +  ARVH+ MP 
Sbjct: 106 GLPKGGA-VGFELLDK-EKFGISQFSEQINYQRALEGELARTIATLGPVKDARVHLAMPK 163

Query: 161 MGSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +    P+ASV + A+ P          A+ H+V+++V  +  G+VTV+D +G+LL
Sbjct: 164 PTLFVREQKSPSASVTL-ALQPGRALDEGQINAVVHMVSSSVAGMPQGNVTVVDQSGRLL 222

Query: 218 TANEME-RNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI 276
           T N+   R++    L     ++   +  I   L   +G  N  + V A+++ + ++  + 
Sbjct: 223 TQNDTTGRDLNDAQLKYASDVETRYQQRIEAILGPIVGNSNVHAQVTAQIDFNKREKTDE 282

Query: 277 VYDPDSKVERSIRLSKDAQRSETSQPESAVTVE---QNMPHVSDR-KVPLP--------- 323
            Y P+S  E+    S+    SE    +SA  V     N P  ++   V  P         
Sbjct: 283 QYAPNSNPEQQAVRSRQTSNSEQLGGQSAGGVPGALSNQPAPANAGPVTTPNNTNANGAN 342

Query: 324 ------------------RSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNK 365
                             ++  +  + +  +NYE+N   + T  +  +++RLS+AVVVN 
Sbjct: 343 GANANNGQPANNAASGAQKTSPSNTRSDNTTNYEVNRTILHTKMNVGEVQRLSVAVVVNY 402

Query: 366 GRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDFLEN 416
                   RS   GK     ++ + +I  +   A G + +RGD++ + +  F +N
Sbjct: 403 --------RSDAAGKPIALNEAQIKQIEDLTREAMGYSEKRGDSLNVVNSPFTQN 449


>gi|74312478|ref|YP_310897.1| flagellar MS-ring protein [Shigella sonnei Ss046]
 gi|73855955|gb|AAZ88662.1| flagellar basal-body MS(membrane and supramembrane)-ring and collar
           protein [Shigella sonnei Ss046]
 gi|323168943|gb|EFZ54623.1| flagellar M-ring protein FliF [Shigella sonnei 53G]
          Length = 552

 Score =  151 bits (381), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 117/418 (27%), Positives = 197/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +  S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYCFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D  G LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+     +   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|320325114|gb|EFW81183.1| flagellar MS-ring protein [Pseudomonas syringae pv. glycinea str.
           B076]
          Length = 594

 Score =  151 bits (381), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 149/556 (26%), Positives = 236/556 (42%), Gaps = 98/556 (17%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  +I   L
Sbjct: 24  LSFLENLSEMTMLRQIGLMVGLAASVAIGFAVVLWSQQPDYRPLYGSLAGMDSKQIMDTL 83

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + ANI++ +  N  ++ V S  V +ARI LA  G+  + +N G+E+ DK    G + FM+
Sbjct: 84  TAANINYTVEPNSGALLVKSDDVQRARIQLAQAGVVQNDANIGFEILDKDQGLGTSQFME 143

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI-----RAINP 182
                R LEGE+ARTI +++ +  ARVH+ +P    F +   +P+ASV++     R++ P
Sbjct: 144 ATRYRRGLEGELARTISALNNVKGARVHLAIPKSSVFVRDDRKPSASVLVELYAGRSLEP 203

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT--ANEMERNILGKSLSIVQAIQHE 240
           S      AI +LVA +VP L    +TV+D  G LL+  A   E  + GK     + ++  
Sbjct: 204 S---QVMAIINLVATSVPELSKSQITVVDQKGALLSDQAENSELTMAGKQFDYSRRMEGM 260

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           +   +   L   LG D +++ V A ++    +     ++PD    RS + S + QRS +S
Sbjct: 261 LTQRVQNILQPILGNDRYKAEVSAVVDFSAVESTAESFNPDQPALRSEQ-SVNEQRSSSS 319

Query: 301 -----------QPESAVTVEQNM----------------------PHVSDRKVPLPRSLE 327
                      QP    T  QN                         + D     P    
Sbjct: 320 GTGGVPGALSNQPPGPATAPQNATAGAAGAAGPIAPGQPLLDANGQQIMDPATGQPALAP 379

Query: 328 NTDKKEEQS--NYEINTKSIATTHDNYKLERLSIAVVVN--------KGRLTEVLGRSAD 377
               K  QS  N+E++     T     +L RLS+AVVV+         G +T     +AD
Sbjct: 380 YPADKRVQSTKNFELDRSISHTKQQQGRLTRLSVAVVVDDMVKTNAANGEVTRAPWSAAD 439

Query: 378 QGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF-------LENQLFNSGTVQVSFMD 430
                  LA   ++V  A G ++ RGD++++ ++ F       L    F S   Q  F D
Sbjct: 440 -------LARFTRLVQDAVGFDASRGDSVSVINVPFSSERAEVLPEASFYS---QPWFWD 489

Query: 431 ILSRHFATVINALVFLVGTL--------------LVTFLGLHALRRLHNIDDAKKGEV-- 474
           I+ +    VI  L+ + G L              L  F G   L R+  +D    GE+  
Sbjct: 490 IV-KQAVGVIFILILVFGVLRPVLTNITTGKSKELAGFGGDAELGRMGGLD----GELSN 544

Query: 475 ------GGKSILSPPP 484
                 G +SIL P P
Sbjct: 545 DRVSLGGPQSILLPSP 560


>gi|320329373|gb|EFW85366.1| flagellar MS-ring protein [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330880568|gb|EGH14717.1| flagellar MS-ring protein [Pseudomonas syringae pv. glycinea str.
           race 4]
          Length = 594

 Score =  150 bits (380), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 149/556 (26%), Positives = 236/556 (42%), Gaps = 98/556 (17%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  +I   L
Sbjct: 24  LSFLENLSEMTMLRQIGLMVGLAASVAIGFAVVLWSQQPDYRPLYGSLAGMDSKQIMDTL 83

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + ANI++ +  N  ++ V S  V +ARI LA  G+  + +N G+E+ DK    G + FM+
Sbjct: 84  TAANINYTVEPNSGALLVKSDDVQRARIQLAQAGVVQNDANIGFEILDKDQGLGTSQFME 143

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI-----RAINP 182
                R LEGE+ARTI +++ +  ARVH+ +P    F +   +P+ASV++     R++ P
Sbjct: 144 ATRYRRGLEGELARTISALNNVKGARVHLAIPKSSVFVRDDRKPSASVLVELYAGRSLEP 203

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT--ANEMERNILGKSLSIVQAIQHE 240
           S      AI +LVA +VP L    +TV+D  G LL+  A   E  + GK     + ++  
Sbjct: 204 S---QVMAIINLVATSVPELSKSQITVVDQKGALLSDQAENSELTMAGKQFDYSRRMEGM 260

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           +   +   L   LG D +++ V A ++    +     ++PD    RS + S + QRS +S
Sbjct: 261 LTQRVQNILQPILGNDRYKAEVSAVVDFSAVESTAESFNPDQPALRSEQ-SVNEQRSSSS 319

Query: 301 -----------QPESAVTVEQNM----------------------PHVSDRKVPLPRSLE 327
                      QP    T  QN                         + D     P    
Sbjct: 320 STGGVPGALSNQPPGPATAPQNATAGAAGAAGPIAPGQPLLDANGQQIMDPATGQPALAP 379

Query: 328 NTDKKEEQS--NYEINTKSIATTHDNYKLERLSIAVVVN--------KGRLTEVLGRSAD 377
               K  QS  N+E++     T     +L RLS+AVVV+         G +T     +AD
Sbjct: 380 YPADKRVQSTKNFELDRSISHTKQQQGRLTRLSVAVVVDDMVKTNAANGEVTRAPWSAAD 439

Query: 378 QGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF-------LENQLFNSGTVQVSFMD 430
                  LA   ++V  A G ++ RGD++++ ++ F       L    F S   Q  F D
Sbjct: 440 -------LARFTRLVQDAVGFDASRGDSVSVINVPFSSERAEVLPEASFYS---QPWFWD 489

Query: 431 ILSRHFATVINALVFLVGTL--------------LVTFLGLHALRRLHNIDDAKKGEV-- 474
           I+ +    VI  L+ + G L              L  F G   L R+  +D    GE+  
Sbjct: 490 IV-KQAVGVIFILILVFGVLRPVLTNITTGKSKELAGFGGDAELGRMGGLD----GELSN 544

Query: 475 ------GGKSILSPPP 484
                 G +SIL P P
Sbjct: 545 DRVSLGGPQSILLPSP 560


>gi|261344120|ref|ZP_05971764.1| flagellar M-ring protein FliF [Providencia rustigianii DSM 4541]
 gi|282567712|gb|EFB73247.1| flagellar M-ring protein FliF [Providencia rustigianii DSM 4541]
          Length = 564

 Score =  150 bits (380), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 144/549 (26%), Positives = 258/549 (46%), Gaps = 77/549 (14%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  SP Y  L   L   D   I   L++ N+ ++I+DNGS+I VP+  V + R+ LA  G
Sbjct: 47  WFRSPDYRVLLSNLSAKDGGDIVGQLTQMNVPYQIADNGSAILVPADKVHELRLKLAQSG 106

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP    N+G+EL DK   FG++ F ++I   RALEGE++RTI+S+S + +ARVH+ +P  
Sbjct: 107 LPKGG-NTGFELLDK-EQFGISQFSEQINYQRALEGELSRTIESLSPVQSARVHLAIPKP 164

Query: 162 GSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    PTASV +  +   V    +  AI H+V+++V  L   +V ++D TG+LLT 
Sbjct: 165 TLFVREQKLPTASVTVGLLPGRVLDEGQISAIVHMVSSSVTGLTAANVIIVDQTGRLLTN 224

Query: 220 NE-MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
           N+  +++     + + + ++  ++  I   L+  +G  N  + V A+++    +     Y
Sbjct: 225 NDNSQQSANSAQIKMTKEMETHLKERIEDILSPLVGRANIHAQVTAQMDFSKVEQTSEEY 284

Query: 279 D----PDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTD---- 330
                PD+   RS + S+  Q S    P        N P VS    P+    EN D    
Sbjct: 285 KPNQTPDAAAIRSRQNSESMQNSNGG-PGGVPGALSNQP-VSAPSAPI--EAENKDNTGK 340

Query: 331 ---------------KKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRS 375
                          +++E +NYE++ K   T      ++RLS+AV+VN           
Sbjct: 341 NNQNTTTTRNGTLNSQRDETTNYEVDRKISHTQRQIGVVDRLSVAVIVN---------YQ 391

Query: 376 ADQGK--------IDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVS 427
           A +G+            + +I+ +   A G +++RGD++ IT      N LF S    + 
Sbjct: 392 AQEGEKGVEMKPLPPEMIKQIDALTREAMGYSTQRGDSLNIT------NSLFTSDAPAIE 445

Query: 428 FMDIL-SRHFATVINALVF---LVGTLLVTFLGLHALR-RLHNIDDAKKGEVGGKSILSP 482
              +L S  F  V  AL +   ++  ++  F+    ++ +      A++ +   ++    
Sbjct: 446 ETSLLNSPQF--VSQALDYGKIILIAIIAWFMWRFGIKPQWVKYRKAQQAQADAETF--- 500

Query: 483 PPISSAVTTGLMPNDNIALDSSNQDIFSHSRN--LQSRINSYVSKQSDLRLLHMIEINEE 540
             I++  TT  +  + I     N+D+   +R    + R+++ +  Q   R+  M E + +
Sbjct: 501 --IATQSTTPFVVEEEI-----NEDMDEKTRRRLTRQRVSAEIQSQ---RIREMAEKDPQ 550

Query: 541 RFAKILRKW 549
             A ++R+W
Sbjct: 551 VVAMVIRQW 559


>gi|149203111|ref|ZP_01880082.1| flagellar M-ring protein FliF [Roseovarius sp. TM1035]
 gi|149143657|gb|EDM31693.1| flagellar M-ring protein FliF [Roseovarius sp. TM1035]
          Length = 535

 Score =  150 bits (380), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 149/544 (27%), Positives = 254/544 (46%), Gaps = 31/544 (5%)

Query: 19  RTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISD 78
           R RI+++ +  ++   +   AR   ++P    LY  LE S    +  AL +  + + + +
Sbjct: 14  RNRIIVIGAAFVMFWAVLALARM-ASTPSMTLLYAGLESSAAGEVVAALEQQGVTYEVRN 72

Query: 79  NGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGE 138
           +  +I V S+   + R+ LA +GLP S + SGYEL D ++ FG TS M +    RA EGE
Sbjct: 73  D--AILVDSTRRDELRMILAGEGLPRSGT-SGYELLDGLSGFGTTSQMFDAAYWRAKEGE 129

Query: 139 IARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV-YKSAEAIRHLVAA 197
           +ARTI S   IVAARVHI       F++   R +ASV +     +V  K A A++ LVA+
Sbjct: 130 LARTIVSHPAIVAARVHIASTGANPFQRNVHR-SASVSVSTNGAAVSAKHARALQFLVAS 188

Query: 198 AVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDN 257
           AV +L   DV+++D+ G LL+  E  +       +        + +   + L A +G  N
Sbjct: 189 AVADLTPDDVSIIDAEGTLLSGAEEAKT------NTADERAEGLRLRAQRLLEARVGHGN 242

Query: 258 FRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSD 317
               +  E    T+  RE  +DP+ +V  S    + A  S  +  ++ VTV  N+P   D
Sbjct: 243 AVVEIALETVTQTESTRERRFDPEGRVAISTDTEERANTSNGT--DNGVTVASNLPD-GD 299

Query: 318 RKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSAD 377
                  + ENT+ + E+ NYE+++           ++R+++A+++N     +  G    
Sbjct: 300 AAAAATSASENTETR-ERVNYEVSSTEREVIQQPGAIKRMTVAILINGITTPDASGTPIF 358

Query: 378 QGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFA 437
             + +  L  +  +V +A G++  RGD +TI ++ F E        V+   ++ L+    
Sbjct: 359 APRPEEELTALGDLVGSAVGLDETRGDALTIRTLQF-EPSAPTGTLVEAGLLERLAIDTM 417

Query: 438 TVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVT--TGLMP 495
           T++ +LV  +  L+   LGL  LR + +             I   P    A+T  +G++ 
Sbjct: 418 TLVQSLVLAIVALV---LGLFVLRPILSRPVPLATPQLSAPIRRAPVQDPALTPLSGVIE 474

Query: 496 NDNIAL----DSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWAR 551
           + +I +    D S     S    L    +  VS     RL  +I   +E   +ILR W  
Sbjct: 475 DGDIDVAGLSDVSEAPQISLRPRLDGGTDDPVS-----RLRALIGQRQEETVEILRNWLE 529

Query: 552 SEIE 555
           +E E
Sbjct: 530 AEEE 533


>gi|315286666|gb|EFU46099.1| flagellar M-ring protein FliF [Escherichia coli MS 110-3]
          Length = 510

 Score =  150 bits (380), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 114/398 (28%), Positives = 188/398 (47%), Gaps = 38/398 (9%)

Query: 43  VNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGL 102
            N P Y  L+  L   D   I   L++ NI +R S+   +I VP+  V + R+ LA QGL
Sbjct: 1   ANPPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGL 60

Query: 103 PSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMG 162
           P   +  G+EL D+   FG++ F +++   RALEGE++RTI++I  +  ARVH+ MP   
Sbjct: 61  PKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPS 118

Query: 163 SFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLT-A 219
            F +    P+ASV +  +        +  AI HLV++AV  L  G+VT++D  G LLT +
Sbjct: 119 LFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQS 178

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
           N   R++    L     ++  I+  I   L+  +G  N  + V A+L+  +++  E  Y 
Sbjct: 179 NTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYR 238

Query: 280 PDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQ- 335
           P+     +   S+    SE S    P        N P  ++   P+     N + +++Q 
Sbjct: 239 PNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPAN-NAPISTPPANQNNRQQQA 297

Query: 336 ----------------SNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQG 379
                           SNYE++     T  +   ++RLS+AVVVN   L +        G
Sbjct: 298 STTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPD--------G 349

Query: 380 KI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           K     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 350 KPLPLSNEQMKQIEALTREAMGFSEKRGDSLNVVNSPF 387


>gi|300899195|ref|ZP_07117471.1| flagellar M-ring protein FliF [Escherichia coli MS 198-1]
 gi|300357176|gb|EFJ73046.1| flagellar M-ring protein FliF [Escherichia coli MS 198-1]
          Length = 511

 Score =  150 bits (380), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 114/398 (28%), Positives = 188/398 (47%), Gaps = 38/398 (9%)

Query: 43  VNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGL 102
            N P Y  L+  L   D   I   L++ NI +R S+   +I VP+  V + R+ LA QGL
Sbjct: 2   ANPPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGL 61

Query: 103 PSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMG 162
           P   +  G+EL D+   FG++ F +++   RALEGE++RTI++I  +  ARVH+ MP   
Sbjct: 62  PKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPS 119

Query: 163 SFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLT-A 219
            F +    P+ASV +  +        +  AI HLV++AV  L  G+VT++D  G LLT +
Sbjct: 120 LFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQS 179

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
           N   R++    L     ++  I+  I   L+  +G  N  + V A+L+  +++  E  Y 
Sbjct: 180 NTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYR 239

Query: 280 PDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQ- 335
           P+     +   S+    SE S    P        N P  ++   P+     N + +++Q 
Sbjct: 240 PNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPAN-NAPISTPPANQNNRQQQA 298

Query: 336 ----------------SNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQG 379
                           SNYE++     T  +   ++RLS+AVVVN   L +        G
Sbjct: 299 STTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPD--------G 350

Query: 380 KI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           K     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 351 KPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 388


>gi|268678860|ref|YP_003303291.1| flagellar M-ring protein FliF [Sulfurospirillum deleyianum DSM
           6946]
 gi|268616891|gb|ACZ11256.1| flagellar M-ring protein FliF [Sulfurospirillum deleyianum DSM
           6946]
          Length = 574

 Score =  150 bits (379), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 137/458 (29%), Positives = 226/458 (49%), Gaps = 51/458 (11%)

Query: 28  VILVPIMLFMAARFFVNSPH-----YDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           V+L+  ++F+    + N+       Y  L+ K    D   I   L +  + +++ D G+ 
Sbjct: 30  VVLIGFLVFLM--LYKNTSSSSMSGYTILFEKTTAGDSALIIQQLEKDKVPYKVLDEGT- 86

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I+VP+ MV K RI +AA G+P +S   G+E+FDK   FG T F Q+I  +RALEGE+ART
Sbjct: 87  IAVPNDMVHKQRIAIAALGIPKNS-KVGFEIFDK-TEFGATDFEQKIKYIRALEGELART 144

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVM--IRAINPSVYKSAEAIRHLVAAAVP 200
           I+S+  I  A VHI +P    F +     TAS++  IR       K    IR+LVAA++ 
Sbjct: 145 IESLGPIANASVHIAIPKESVFAQKQVPATASIVLNIRQGMALSVKQIVGIRNLVAASIA 204

Query: 201 NLDMGDVTVLDSTGKLL---TANEMERNILGKSLSIVQAIQHEIEMNINKALAAFL-GVD 256
           NL   +V++++  G+ L    +N  +  ++   +   +  +H IE  I   LA  + GVD
Sbjct: 205 NLPAENVSIVNQDGEPLGDEESNLFQGELVKSQIRYKKEFEHNIEQKIINVLAPVIGGVD 264

Query: 257 NFRSAVVAELNMDTQQIREIVYDPDS--KVERSIRLSKDAQRSETSQPESAVTVEQNMPH 314
              + V  + +   Q     VYDP+S  + E+S+      ++ E  +P+    V   + +
Sbjct: 265 KVNAKVTIDFDFSQQDYVSEVYDPNSVPRSEQSVE-----EKREGKEPQDVGGVPGAISN 319

Query: 315 VSDRKVPLPRSLENTDKKE------EQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRL 368
           +     P+ + LE+T K E        +NYEI+ K + +  +  K++RL+ AVVV+    
Sbjct: 320 IG----PV-QGLESTKKGETYQKSSTTTNYEISKKVVNSKDEFAKIKRLTAAVVVDG--- 371

Query: 369 TEVLGRSADQGKIDSY---------LAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           T   G  AD  K +           +  I  +V    G N+ RGD +T+++++F    L 
Sbjct: 372 TYKYGLDADGNKKNELEYFPLSKEQMDAIRDVVRQTVGYNATRGDEVTVSNLEF--KPLS 429

Query: 420 NSGT--VQVSFMDILSRHFATVINALVF-LVGTLLVTF 454
           + GT     SFM+ +  +   +   L + LV  LL  F
Sbjct: 430 SDGTRVPPKSFMEEVLSYLIKLTPLLKYILVAGLLFIF 467


>gi|163732487|ref|ZP_02139932.1| flagellar M-ring protein FliF, putative [Roseobacter litoralis Och
           149]
 gi|161393847|gb|EDQ18171.1| flagellar M-ring protein FliF, putative [Roseobacter litoralis Och
           149]
          Length = 504

 Score =  150 bits (379), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 135/430 (31%), Positives = 214/430 (49%), Gaps = 31/430 (7%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
              +P+   LY  LE      +  AL +    F +   G SI V SS   + R+ LA++G
Sbjct: 1   MATAPNMTLLYAGLENGAAGDVVTALEQRGAVFEV--RGGSIFVDSSQRDELRMTLASEG 58

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP++S+  GYEL D ++ FG TS M +    RA EGE+ARTI S   I  ARVHI     
Sbjct: 59  LPANSTR-GYELLDTLSGFGTTSQMFDAAYWRAKEGELARTIVSSPHIAMARVHIASTGS 117

Query: 162 GSFRKIGARPTASVMIR----AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
             F++ G  P AS+ +     AI P   +  +AIR LV++AV  L   DV V+D+ G L+
Sbjct: 118 NPFQR-GVTPKASISVTPSGAAITP---QQGKAIRFLVSSAVAGLASEDVAVIDANGALI 173

Query: 218 -TANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI 276
             A+E+   I G+  + V      ++  + + L A +G  N    V  +   +++ IRE 
Sbjct: 174 GNADEVAPTIGGEDKADV------LKARVQRLLEARVGFGNSVVEVSVDTVTESESIRER 227

Query: 277 VYDPDSKVERSIRLSKDAQRSETSQPESA---VTVEQNMPHVSDRKVPLPRSLENTDKKE 333
            +DP+S+V     +S D +   TS  E+    VTV  N+P   D       S +N + + 
Sbjct: 228 TFDPESRV----AISTDTEERNTSSSEAGGGDVTVASNLPD-EDGAGGENSSSQNNETR- 281

Query: 334 EQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVS 393
           E+ NYE++        +   ++R+++AV+VN+  LT+  G      + ++ L  +  +V+
Sbjct: 282 ERVNYEVSETEREVLREPGAIKRVTVAVLVNEMTLTDEAGEQTVAPRDENELEALRDLVA 341

Query: 394 AATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVT 453
           +A G +  RGD ITI SM      L   GT   +   ++S     V++A+   +  L+  
Sbjct: 342 SAVGFDEARGDIITIKSMGLQSVPL--QGT--AAGTSLMSNFNIDVMSAVQMAILALVTL 397

Query: 454 FLGLHALRRL 463
            LGL  +R L
Sbjct: 398 ILGLFVVRPL 407


>gi|89899361|ref|YP_521832.1| flagellar M-ring protein FliF [Rhodoferax ferrireducens T118]
 gi|89344098|gb|ABD68301.1| flagellar M-ring protein FliF [Rhodoferax ferrireducens T118]
          Length = 588

 Score =  150 bits (379), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 122/462 (26%), Positives = 209/462 (45%), Gaps = 48/462 (10%)

Query: 22  ILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGS 81
           +++  ++ ++ +M+   A + V       LY  L   D   I   L+  N+ ++ +D G 
Sbjct: 60  LVVFVAIGIIGLMMGRQAEWRV-------LYANLADKDGGAIVAQLTTMNVPYKYADGGG 112

Query: 82  SISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIAR 141
           +I VP+  V   R+ LA+QGLP  +  +G+E  D  N FG+T F + +   R LEGE+ R
Sbjct: 113 AILVPADKVYDTRLRLASQGLPKGAV-AGFETMD-ANRFGMTQFQERLAFQRGLEGELTR 170

Query: 142 TIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAV 199
           +IQ++S + +ARVH+ +P+   F +   +P+ASV++          A+   I HLV+++V
Sbjct: 171 SIQALSSVQSARVHLALPNQNGFFREQQKPSASVLVSLNAGRTLDRAQLAGIVHLVSSSV 230

Query: 200 PNLDMGDVTVLDSTGKLLTANE----MERNILGKSLSIVQAIQHEIEMNINKALAAFLGV 255
           P ++   V+VLD +GKLL+              + L  VQ ++      I   L   +G 
Sbjct: 231 PEMNASAVSVLDDSGKLLSTPPEGADGAGGGDAQQLQYVQQLEQLYSRRILDILEPVVGR 290

Query: 256 DNFRSAVVAELNM----DTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQN 311
            N R+ V AEL+      T +  +    PDS   RS ++S+ +  S  S P S V     
Sbjct: 291 GNARAQVTAELDFSQTESTSESHKPNQTPDSSAIRSQQVSESSNGSGISGPPSGV----- 345

Query: 312 MPHVSDRKVPLPRSLE------------------NTDKKEEQSNYEINTKSIATTHDNYK 353
            P  +  K P P S                       ++E   NYE++            
Sbjct: 346 -PGATSNKPPGPSSAPINGAPQTLTAAGAGASAGAGGRRESIINYEVDKTVKVVRGGTGI 404

Query: 354 LERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           ++R+S AVVVN   +T+  G++         + ++  +V    G N  RGD++ + +  F
Sbjct: 405 VKRISAAVVVNHQSVTDAKGKTTTTPLSAQQIEQMTALVRETVGFNKERGDSVNLMNAPF 464

Query: 414 LENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFL 455
              ++     V + F          +  +L + +GTLL   L
Sbjct: 465 TTERVV---PVDLPFWK--QSEIQDLARSLAWPLGTLLFGAL 501


>gi|291085209|ref|ZP_06352408.2| flagellar M-ring protein FliF [Citrobacter youngae ATCC 29220]
 gi|291072341|gb|EFE10450.1| flagellar M-ring protein FliF [Citrobacter youngae ATCC 29220]
          Length = 557

 Score =  150 bits (379), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 116/406 (28%), Positives = 195/406 (48%), Gaps = 48/406 (11%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ N+ +R ++   +I VP+  V + R+ LA Q
Sbjct: 44  LWAKAPDYRTLFSNLSDQDGGAIVTQLTQMNVPYRFTEGSGAIEVPADKVHELRLRLAQQ 103

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  +  ARVH+ +P 
Sbjct: 104 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIETLGPVKRARVHLALPK 161

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +    P+ASV +     RA++        A+ HLV++AV  L  G+VT++D  G 
Sbjct: 162 PSLFVREQKAPSASVTVNLEPGRALDEG---QISAVTHLVSSAVAGLPPGNVTLVDQAGH 218

Query: 216 LLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIR 274
           LLT +N   R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  
Sbjct: 219 LLTQSNTSSRDLNDAQLKYASDVEGRIQRRIESILSPIVGNGNVHAQVTAQLDFANKEQT 278

Query: 275 EIVYDPDSKVERSIRLSKDAQRSE--------------TSQPESAVTVEQNMPHVSDRKV 320
           E  Y P+    +++  S+    SE              ++QP  A T     P  + +  
Sbjct: 279 EEQYRPNGDDSQAVLRSRQLNVSEQIGSGAPGGVPGALSNQPAPANTAPIATPPANQQNA 338

Query: 321 PL-----------PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLT 369
                        PRS +    + E SNYE++     T  +   ++RLS+AVVVN   L 
Sbjct: 339 QTTQTTNNSSNAGPRSTQ----RNETSNYEVDRTIRHTKMNVGDVQRLSVAVVVNYKTLP 394

Query: 370 E--VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           +   L  +A+Q K      +I  +   A G + +RGDT+ + +  F
Sbjct: 395 DGKPLPLTAEQMK------QIEDLTREAMGFSDKRGDTLNVVNSPF 434


>gi|222033677|emb|CAP76418.1| flagellar M-ring protein [Escherichia coli LF82]
          Length = 552

 Score =  150 bits (379), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 117/418 (27%), Positives = 198/418 (47%), Gaps = 40/418 (9%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           LI+A    V +M+ +    +  +P Y  L+  L   D   I   L++ NI +R S+   +
Sbjct: 25  LIVAGSAAVAVMVALI--LWAKAPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGA 82

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE++RT
Sbjct: 83  IEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRT 140

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVP 200
           I++I  +  ARVH+ MP    F +    P+ASV +  +        +  AI HLV++AV 
Sbjct: 141 IETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVA 200

Query: 201 NLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFR 259
            L  G+VT++D    LLT +N   R++    L     ++  I+  I   L+  +G  N  
Sbjct: 201 GLPPGNVTLVDQGLHLLTQSNTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIH 260

Query: 260 SAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVS 316
           + V A+L+  +++  E  Y P+    ++   S+    SE S    P        N P  +
Sbjct: 261 AQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNESEQSGSGYPGGVPGALSNQPAPA 320

Query: 317 DRKVPLPRSLENTDKKEEQ-----------------SNYEINTKSIATTHDNYKLERLSI 359
           +   P+     N + +++Q                 SNYE++     T  +   ++RLS+
Sbjct: 321 N-NAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSV 379

Query: 360 AVVVNKGRLTEVLGRSADQGKI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           AVVVN   L +        GK     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 380 AVVVNYKTLPD--------GKPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 429


>gi|289627784|ref|ZP_06460738.1| flagellar MS-ring protein [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289651625|ref|ZP_06482968.1| flagellar MS-ring protein [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|298487835|ref|ZP_07005875.1| Flagellar M-ring protein fliF [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298157560|gb|EFH98640.1| Flagellar M-ring protein fliF [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330866444|gb|EGH01153.1| flagellar MS-ring protein [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330986489|gb|EGH84592.1| flagellar MS-ring protein [Pseudomonas syringae pv. lachrymans str.
           M301315]
 gi|331011063|gb|EGH91119.1| flagellar MS-ring protein [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 594

 Score =  150 bits (379), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 152/603 (25%), Positives = 258/603 (42%), Gaps = 98/603 (16%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  +I   L
Sbjct: 24  LSFLENLSEMTMLRQIGLMVGLAASVAIGFAVVLWSQQPDYRPLYGSLAGMDSKQIMDTL 83

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + ANI++ +  N  ++ V S  V +ARI LA  G+  + +N G+E+ DK    G + FM+
Sbjct: 84  TAANINYTVEPNSGALLVKSDDVQRARIQLAQAGVVQNDANIGFEILDKDQGLGTSQFME 143

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI-----RAINP 182
                R LEGE+ARTI +++ +  ARVH+ +P    F +   +P+ASV++     R++ P
Sbjct: 144 ATRYRRGLEGELARTISALNNVKGARVHLAIPKSSVFVRDDRKPSASVLVELYAGRSLEP 203

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT--ANEMERNILGKSLSIVQAIQHE 240
           S      AI +LVA +VP L    +TV+D  G LL+  A   E  + GK     + ++  
Sbjct: 204 S---QVMAIINLVATSVPELSKSQITVVDQKGALLSDQAENSELTMAGKQFDYSRRMEGM 260

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           +   +   L   LG D +++ V A ++    +     ++PD    RS + S + QRS +S
Sbjct: 261 LTQRVQNILQPILGNDRYKAEVSAVVDFSAVESTAESFNPDQPALRSEQ-SVNEQRSSSS 319

Query: 301 -----------QPESAVTVEQNM----------------------PHVSDRKVPLPRSLE 327
                      QP    T  QN                         + D     P    
Sbjct: 320 STGGVPGALSNQPPGPATAPQNATAGAAGAAGPIAPGQPLLDANGQQIMDPATGQPALAP 379

Query: 328 NTDKKEEQS--NYEINTKSIATTHDNYKLERLSIAVVVN--------KGRLTEVLGRSAD 377
               K  QS  N+E++     T     +L RLS+AVVV+         G +T     +AD
Sbjct: 380 YPADKRVQSTKNFELDRSISHTKQQQGRLTRLSVAVVVDDMVKTNAANGEVTRAPWSAAD 439

Query: 378 QGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF-------LENQLFNSGTVQVSFMD 430
                  LA   ++V  A G ++ RGD++++ ++ F       L    F S   Q  F D
Sbjct: 440 -------LARFTRLVQDAVGFDASRGDSVSVINVPFSSERAEVLPEASFYS---QPWFWD 489

Query: 431 ILSRHFATVINALVFLVGTL--LVTFLGLHALRRLHNI-DDAKKGEVGGKSILSPPPISS 487
           I+ +    VI  L+ + G L  ++T +     + L     DA+ G +GG           
Sbjct: 490 IV-KQAVGVIFILILVFGVLRPVLTNITTGKSKELAGFGGDAELGGMGG----------- 537

Query: 488 AVTTGLMPNDNIALDSSNQDIF-SHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKIL 546
               G + ND ++L      +  S +    +++N+  S         ++  +  R A+++
Sbjct: 538 --LDGELSNDRVSLGGPQSILLPSPTEGYDAQLNAIKS---------LVAEDPGRVAQVV 586

Query: 547 RKW 549
           ++W
Sbjct: 587 KEW 589


>gi|238794015|ref|ZP_04637633.1| Flagellar M-ring protein [Yersinia intermedia ATCC 29909]
 gi|238726647|gb|EEQ18183.1| Flagellar M-ring protein [Yersinia intermedia ATCC 29909]
          Length = 572

 Score =  150 bits (378), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 140/553 (25%), Positives = 255/553 (46%), Gaps = 75/553 (13%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  SP Y  LY  L   D   I   L++ NI +R +DNG ++ +P+  V + R+ LA Q
Sbjct: 46  LWAKSPDYRVLYSNLNDRDGGDIVTQLTQLNIPYRFADNGGALLIPADKVHETRLRLAQQ 105

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE++RTI ++  ++  RVH+ MP 
Sbjct: 106 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRTISTLGPVMNVRVHLAMPK 163

Query: 161 MGSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +    PTASV + A+ P          AI ++V+++V  L  G+VTV+D TG+LL
Sbjct: 164 PSLFVREQKSPTASVTL-ALQPGRALDDGQINAIVYMVSSSVAGLPPGNVTVVDQTGRLL 222

Query: 218 T-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI 276
           T ++   R++    L     +++  +  I   LA  +G  N  + V A+++  +++  + 
Sbjct: 223 TQSDSAGRDLNAAQLKFTNEVENRFQRRIETILAPMVGNGNVHAQVTAQVDFASREQTDE 282

Query: 277 VYDPDSKVERSIRLSKDAQRSE--------------TSQPESAVTVEQNMPH-------- 314
            Y P+   ++    S+    SE              ++QP +        P         
Sbjct: 283 EYKPNQAADKGAVRSQQVSTSEQLGGTNVGGVPGALSNQPSATPVAPIETPQATPAAGAA 342

Query: 315 ------------VSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVV 362
                        +        +  +  + ++ +N+E++     T      ++RLS+AVV
Sbjct: 343 GATANNANAANRPATTTAAKSTATSSNSRHDQTTNFEVDRTIRHTQQQAGMVQRLSVAVV 402

Query: 363 VNKG--RLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN 420
           VN G  +  + +  + DQ      LA++  +   A G ++ RGDT+ + +  F      +
Sbjct: 403 VNYGSDKAGKPVALTKDQ------LAQVESLTREAMGFSTDRGDTLNVVNTPFSATDDAS 456

Query: 421 SGTV----QVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGG 476
             T+    Q SF D        ++NA  +L+  LLV ++     R+L     AKK +V  
Sbjct: 457 GNTLPFWQQQSFFD-------QMLNAGRYLL-ILLVAWI---LWRKLVRPMMAKK-QVAD 504

Query: 477 KSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIE 536
           K+  S   I++ V T +   +      S +++    +N Q R+++ V  Q   R+  + +
Sbjct: 505 KAAAS---INNIVQTAVASEN---AKQSKEELALRKKN-QQRVSAEVQAQ---RIRELAD 554

Query: 537 INEERFAKILRKW 549
            +    A ++R+W
Sbjct: 555 KDPRVVALVIRQW 567


>gi|46578729|ref|YP_009537.1| flagellar M-ring protein FliF [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46448141|gb|AAS94796.1| flagellar M-ring protein FliF [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|311232601|gb|ADP85455.1| flagellar M-ring protein FliF [Desulfovibrio vulgaris RCH1]
          Length = 538

 Score =  150 bits (378), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 120/421 (28%), Positives = 201/421 (47%), Gaps = 17/421 (4%)

Query: 21  RILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNG 80
           R+ I+  + LV + +F     ++N P Y  LY  L   D NR+   L    + +++ ++G
Sbjct: 24  RVFIVG-LALVTVGIFFTLILWINRPDYRVLYSNLAGEDANRVVKLLQANKVPYKLENDG 82

Query: 81  SSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIA 140
            ++ VP+  +   RI +A +G        G+E+FD +   G T F+Q+I   RAL+GE+ 
Sbjct: 83  GTVLVPADKLYDLRIKVAGEG-NLVGQGIGFEIFDDLK-VGQTDFVQKINYQRALQGELI 140

Query: 141 RTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI--RAINPSVYKSAEAIRHLVAAA 198
           RTI    G+  ARVH+V+P    F +   +P+ASV++  R       +  +AI +LV  A
Sbjct: 141 RTISEFPGVETARVHLVIPHRSLFIEEQQKPSASVVVKLREGKKMEAQDVQAIVNLVVMA 200

Query: 199 VPNLDMGDVTVLDSTGKLL---TANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGV 255
           V  +D   V+V D++GK+L   T ++  + +    L     +Q  +E  I + L   +G 
Sbjct: 201 VEGMDRNRVSVADTSGKILYYPTEDDSLQGLTTTQLEYKMRLQQNLERRIEELLYPVIGP 260

Query: 256 DNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHV 315
               + V A+++   + IR  +YDP+  V RS       QRSE S    A  +E   P  
Sbjct: 261 GKVIAKVNADVDFSQRTIRRELYDPEKTVVRS------EQRSEESTRGRA-NLEAGAPDA 313

Query: 316 SDRKVPLPRSLENTDKKEE--QSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLG 373
           + R   +  S    +   E   +N+EIN +      +   L RLS+AV+V+        G
Sbjct: 314 NFRGDGISGSASTQEGTRETRTTNFEINKEEQNIVANVGDLSRLSVAVIVDGTYEKAADG 373

Query: 374 RSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILS 433
                 +    +  I ++VS+A G +  RGDT+ + S+ F    L    ++   F+D   
Sbjct: 374 TYTFVPRNAEEMQRIRQLVSSAVGYDRARGDTVEVNSISFGGPDLPQEASLPQLFLDYAL 433

Query: 434 R 434
           R
Sbjct: 434 R 434


>gi|309388817|gb|ADO76697.1| flagellar M-ring protein FliF [Halanaerobium praevalens DSM 2228]
          Length = 512

 Score =  150 bits (378), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 117/378 (30%), Positives = 193/378 (51%), Gaps = 30/378 (7%)

Query: 45  SPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPS 104
           S +Y  L+  L  SD   I   L E  +D+++  NG++I VP S + + R+ +A+ GLP 
Sbjct: 47  SSNYQPLFTNLSTSDTAAIVERLDENQVDYKLGGNGNTILVPESEIHRLRLDMASAGLPD 106

Query: 105 SSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSF 164
                G+E+FD  + FG T F + +   RAL GE++R+IQSISGI  ARV I  P+   F
Sbjct: 107 QGV-VGFEIFDS-SDFGTTEFERRVNYYRALGGELSRSIQSISGIEFARVQITPPEESLF 164

Query: 165 RKIGARPTASVMIRAINPSVYKSAE---AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA-- 219
                  TASV+++ ++     S+E   A+++LVA+ V +L + +VT++D+ G LL+   
Sbjct: 165 LDEEKSATASVVVK-LSAGYKMSSERVRAVQNLVASGVQDLPLEEVTLVDTNGNLLSKPV 223

Query: 220 -NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
            +E  R    ++ +I +  +  ++ ++   L   LG +NF   V A+LN D +      Y
Sbjct: 224 NSEDGRWSDPQNFAIQKEFESALKNDLRVLLTKVLGPNNFAVQVNAKLNFDQRHSESKTY 283

Query: 279 DP---DSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQ 335
            P   DS + RS  ++ ++Q  E      A   + N+P           S    D++   
Sbjct: 284 APVIDDSGIIRSQEVNTESQ--ENGINGGAPGTDANIPQYQAEGTGEASSY---DRENTI 338

Query: 336 SNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAA 395
           +NYEIN +     +   ++ERLS++V++             DQ   +  +A+I   V AA
Sbjct: 339 TNYEINERIEEHIYAPGEVERLSVSVML-------------DQDTDEEKIAQIRNAVGAA 385

Query: 396 TGINSRRGDTITITSMDF 413
            G N  RGD + I+S+ F
Sbjct: 386 IGYNEDRGDVLNISSIAF 403


>gi|209884352|ref|YP_002288208.1| flagellar M-ring protein FliF [Oligotropha carboxidovorans OM5]
 gi|209872548|gb|ACI92344.1| flagellar M-ring protein FliF [Oligotropha carboxidovorans OM5]
          Length = 537

 Score =  150 bits (378), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 105/375 (28%), Positives = 186/375 (49%), Gaps = 5/375 (1%)

Query: 43  VNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGL 102
           V +P    LY  L   D   +   L    I + + ++G+ I VP   V + R+ LA  GL
Sbjct: 37  VTAPQMITLYTDLGYDDAAGVIKELDRQGIPYEMKNDGAIIMVPKDKVTRLRMKLAESGL 96

Query: 103 PSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMG 162
           P  S   GYE+FDK  + G TSF+Q +  +RALEGE+ARTI++I  I   RVH+V+P+  
Sbjct: 97  PKGSG-VGYEIFDKSETLGSTSFVQNVNHLRALEGELARTIKAIDRIQGVRVHLVLPERP 155

Query: 163 SFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM 222
            F +    P+A++++R       +   AIRHLVA++V  L    V+++D  G+LL     
Sbjct: 156 LFSREKPEPSAAIVVRVRGALEAQQVRAIRHLVASSVNGLKPQRVSIVDENGQLLADGSG 215

Query: 223 ERNILGKSLSIVQAIQHE--IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDP 280
           + N +G   +  + + +E  +   I   + + +G    R  + A+ + +        +DP
Sbjct: 216 DANGMGDVGADERRVAYENRLRKQIESIVTSVVGGGRARVQLSADFDYNKVTETSDKFDP 275

Query: 281 DSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEI 340
           + +V RS + +++   + ++     VTV   MP  + ++       +   K EE +NYEI
Sbjct: 276 EGRVLRSSQ-TREESSATSNGLNGQVTVNNEMPG-NQQQNAANAGKDQAKKSEEINNYEI 333

Query: 341 NTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINS 400
           +  +     +  +++R+S+AV+V+        G      +    L  I  +V +A G + 
Sbjct: 334 SRTTKTEVTEAGRVQRMSVAVLVDGVYSRNEKGDQVYAPRSQEDLERIATLVRSAIGFDK 393

Query: 401 RRGDTITITSMDFLE 415
            RGD + + ++ F +
Sbjct: 394 ARGDQVEVVNLRFAD 408


>gi|183598654|ref|ZP_02960147.1| hypothetical protein PROSTU_02060 [Providencia stuartii ATCC 25827]
 gi|188020839|gb|EDU58879.1| hypothetical protein PROSTU_02060 [Providencia stuartii ATCC 25827]
          Length = 562

 Score =  150 bits (378), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 117/414 (28%), Positives = 208/414 (50%), Gaps = 51/414 (12%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           ++ SP Y  L   L   D   I   L++ N+ ++I+DNGS+I VP+  V + R+ LA  G
Sbjct: 47  WLRSPDYRVLLSNLSAKDGGDIVSQLTQMNVPYQIADNGSAILVPAEKVHELRLKLAQSG 106

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP    N+G+EL DK   FG++ F +++   RALEGE++RTI+S+S +  ARVH+ +P  
Sbjct: 107 LPKGG-NTGFELLDK-EQFGISQFSEQVNYQRALEGELSRTIESLSPVQNARVHLAIPKP 164

Query: 162 GSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    PTASV +  +   +    +  AI H+V+++V  L   +VT++D TG+LLT 
Sbjct: 165 TLFVREQKLPTASVTVGLLPGRMLDEGQITAIVHMVSSSVSGLTAANVTIVDQTGRLLTN 224

Query: 220 NE-MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
           N+  +++     + + + ++  ++  I   ++  +G  N  + V A+++    +     Y
Sbjct: 225 NDNSQQSANNAQIKMTKEMESHLKQRIEDIISPLVGRANVHAQVTAQMDFSKVEQTSEEY 284

Query: 279 DPDSKVER-SIRLSKDAQRSE-------------TSQPESAVTVEQNMPHVSDRKVPLPR 324
            P+      ++R  +++Q S+             ++QP SA +     P  +D K     
Sbjct: 285 KPNQTPNSAAVRSRQNSQSSQNNTSGVGGVPGALSNQPPSAPSA----PISTDNKG--AN 338

Query: 325 SLENT--------DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSA 376
           S +N+         + +E +NYE++ K   T      ++RLS+AV++N       L +  
Sbjct: 339 SAQNSPSNNGSSLSQSDETTNYEVDRKISHTQRQIGVIDRLSVAVIIN------YLPQDG 392

Query: 377 DQGKID------SYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTV 424
           + G           + +I  +   A G +S RGD+++IT      N LF + TV
Sbjct: 393 EDGTQQMKPLSPEMMQQIESLTREAMGYSSTRGDSLSIT------NSLFTNDTV 440


>gi|120603707|ref|YP_968107.1| flagellar M-ring protein FliF [Desulfovibrio vulgaris DP4]
 gi|120563936|gb|ABM29680.1| flagellar M-ring protein FliF [Desulfovibrio vulgaris DP4]
          Length = 538

 Score =  150 bits (378), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 123/428 (28%), Positives = 207/428 (48%), Gaps = 31/428 (7%)

Query: 21  RILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNG 80
           R+ I+  + LV + +F     ++N P Y  LY  L   D NR+   L    + +++ ++G
Sbjct: 24  RVFIVG-LALVTVGIFFTLILWINRPDYRVLYSNLAGEDANRVVKLLQANKVPYKLENDG 82

Query: 81  SSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIA 140
            ++ VP+  +   RI +A +G        G+E+FD +   G T F+Q+I   RAL+GE+ 
Sbjct: 83  GTVLVPADKLYDLRIKVAGEG-NLVGQGIGFEIFDDLK-VGQTDFVQKINYQRALQGELI 140

Query: 141 RTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI--RAINPSVYKSAEAIRHLVAAA 198
           RTI    G+  ARVH+V+P    F +   +P+ASV++  R       +  +AI +LV  A
Sbjct: 141 RTISEFPGVETARVHLVIPHRSLFIEEQQKPSASVVVKLREGKKMEAQDVQAIVNLVVMA 200

Query: 199 VPNLDMGDVTVLDSTGKLL---TANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGV 255
           V  +D   V+V D++GK+L   T ++  + +    L     +Q  +E  I + L   +G 
Sbjct: 201 VEGMDRNRVSVADTSGKILYYPTEDDSLQGLTTTQLEYKMRLQQNLERRIEELLYPVIGP 260

Query: 256 DNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHV 315
               + V A+++   + IR  +YDP+  V RS       QRSE S    A  +E   P  
Sbjct: 261 GKVIAKVNADVDFSQRTIRRELYDPEKTVVRS------EQRSEESTRGRA-NLEAGAPDA 313

Query: 316 SDRKVPLPRSLENTDKKEE--QSNYEINTKSIATTHDNYKLERLSIAVVVN-------KG 366
           + R   +  S    +   E   +N+EIN +      +   L RLS+AV+V+        G
Sbjct: 314 NFRGDGISGSASTQEGTRETRTTNFEINKEEQNIVANVGDLSRLSVAVIVDGTYEKAADG 373

Query: 367 RLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQV 426
             T  + R+A++      +  I ++VS+A G +  RGDT+ + S+ F    L    ++  
Sbjct: 374 TYT-FVPRNAEE------MQRIRQLVSSAVGYDRARGDTVEVNSISFGGPDLPQEASLPQ 426

Query: 427 SFMDILSR 434
            F+D   R
Sbjct: 427 LFLDYALR 434


>gi|239909140|ref|YP_002955882.1| flagellar M-ring protein [Desulfovibrio magneticus RS-1]
 gi|239799007|dbj|BAH77996.1| flagellar M-ring protein [Desulfovibrio magneticus RS-1]
          Length = 547

 Score =  150 bits (378), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 121/433 (27%), Positives = 213/433 (49%), Gaps = 38/433 (8%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
            ++L+Q++ + ++  R   ++LA +    +  F+   F +N P    LY  +   D +R+
Sbjct: 9   FEKLIQYWSNRSAAQR---IMLAGLAASLVAAFVVMLFILNQPDMRVLYTNMPQEDASRV 65

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
              L  +   + + DNG+++ VP+  V + R+ +A +G+       G+ELFD++   G T
Sbjct: 66  VELLKASKTPYELRDNGATVLVPAEAVYEQRLKVAGEGV-MRGQGIGFELFDELK-VGQT 123

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVM--IRAIN 181
            F+Q I   RAL+GE+ARTI     +  ARVH+V+P    F +   + TASV+  +R   
Sbjct: 124 DFVQRINYTRALQGELARTISEFPQVEKARVHLVLPHKSLFIEEQKKATASVVLTLRKGQ 183

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQ---AIQ 238
               K  + I +LVA +V  L    +TV D+ G+ L     +  + G + +  +     +
Sbjct: 184 KLDAKQLQGIVNLVAMSVEGLTPDHITVTDTAGQSLYQPRGDGGLDGLTTTQFEYKNTFE 243

Query: 239 HEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE 298
             +E  + + L   LG     + V AEL+   + IR+ +YDP++ V RS + S+++    
Sbjct: 244 SNLENRLEQILTPILGPGRSLAKVNAELDFAQRTIRKELYDPNATVVRSEQKSEESTSGT 303

Query: 299 TSQPESAVTVEQNMPHVSDRKVP----------LPRSLENTDKKEEQSNYEINTKSIATT 348
            +   S VT     P    + VP             S + ++++ + +NYEIN +     
Sbjct: 304 AAVDASGVTT---TPRGGGQAVPNTNFRGEGYSGTESTQKSNRENKTTNYEINKEEQNVV 360

Query: 349 HDNYKLERLSIAVVVNKGRLTEVLG--------RSADQGKIDSYLAEINKIVSAATGINS 400
                L+R SIAV+V+ G   +V G        RSA++      L  I +IV+ A G+++
Sbjct: 361 TPVGDLKRQSIAVIVD-GTYEKVEGTKNWKFVPRSAEE------LERIKQIVARAAGLDA 413

Query: 401 RRGDTITITSMDF 413
            RGD I ++S +F
Sbjct: 414 ARGDEIQVSSFEF 426


>gi|123442764|ref|YP_001006741.1| flagellar MS-ring protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122089725|emb|CAL12578.1| flagellar M-ring protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 566

 Score =  150 bits (378), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 133/543 (24%), Positives = 244/543 (44%), Gaps = 61/543 (11%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  SP Y  LY  L   D   I   L++ NI +R +DNG ++ +P+  V + R+ LA Q
Sbjct: 46  LWAKSPDYRVLYSNLNDRDGGDIVTQLTQLNIPYRFADNGGALLIPADKVHETRLRLAQQ 105

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI ++  ++  RVH+ MP 
Sbjct: 106 GLPKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELARTIGTLGPVLNVRVHLAMPK 163

Query: 161 MGSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +    PTASV + A+ P          AI ++V+++V  L   +VTV+D TG+LL
Sbjct: 164 PSLFVREQKSPTASVTL-ALQPGRALDDGQINAIVYMVSSSVAGLPPANVTVVDQTGRLL 222

Query: 218 T-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI 276
           T ++   R++    L     +++  +  I   LA  +G  N  + V A+++  +++  + 
Sbjct: 223 TQSDSAGRDLNAAQLKFTNEVENRFQRRIETILAPMVGSGNVHAQVTAQVDFASREQTDE 282

Query: 277 VYDPDSKVERSIRLSKDAQRSE--------------TSQPESAVTVEQNMPHVSDRKVPL 322
            Y P+    +    S+    SE              ++QP +       +P  +      
Sbjct: 283 EYKPNQAANQGAVRSQQVSTSEQLGGTNVGGVPGALSNQPSATPVAPIEIPQATPAAGAG 342

Query: 323 PR--------------SLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG-- 366
                           +  +  + ++ +N+E++     T      ++RLS+AVVVN G  
Sbjct: 343 AAANAANRPATAARQTATSSNSRHDQTTNFEVDRTIRHTQQQAGMVQRLSVAVVVNYGSD 402

Query: 367 RLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQV 426
           +  + +  S DQ      LA++  +   A G ++ RGDT+ + +  F  N   ++    +
Sbjct: 403 KAGKPIALSKDQ------LAQVESLTREAMGFSTVRGDTLNVVNTPF--NATDDASGSNL 454

Query: 427 SFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPIS 486
            F    S  F  ++N   +L+  L+   L    +R L  I   ++ +    S+ +    +
Sbjct: 455 PFWQQPS-FFDQLLNIGRYLLILLVAWILWRKLVRPL--IAKKQEADKAAASVNNIVQAA 511

Query: 487 SAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKIL 546
               T     + +AL   N          Q R+++ V  Q   R+  + + +    A ++
Sbjct: 512 QTTETAKQTKEELALRKKN----------QQRVSAEVQAQ---RIRELADKDPRIVALVI 558

Query: 547 RKW 549
           R+W
Sbjct: 559 RQW 561


>gi|56695122|ref|YP_165469.1| flagellar MS-ring protein [Ruegeria pomeroyi DSS-3]
 gi|56676859|gb|AAV93525.1| flagellar M-ring protein FliF [Ruegeria pomeroyi DSS-3]
          Length = 534

 Score =  150 bits (378), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 160/555 (28%), Positives = 249/555 (44%), Gaps = 59/555 (10%)

Query: 16  SLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFR 75
           SL + +  I+    LV  +  +       SP+   LY  LE      +  +L +  + + 
Sbjct: 10  SLDKKKQFIVIGAALVVFLGVLGLTRMAGSPNMQLLYAGLESGSAGEVVRSLEQQGVPYE 69

Query: 76  ISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRAL 135
           +   G SI VP++   + R+ LA++GLP++    GYEL D ++ FG TS M +    RA 
Sbjct: 70  V--RGGSIYVPAARRDELRLTLASEGLPANGGR-GYELLDSLSGFGTTSQMFDAAYWRAK 126

Query: 136 EGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKS-AEAIRHL 194
           EGE+ARTI +   +  ARVHI       F++    PTASV +      V  + A AIR+L
Sbjct: 127 EGELARTIVASPHVAQARVHIANSSSNPFQR-SIEPTASVSVVPSGSEVTPAQANAIRYL 185

Query: 195 VAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLG 254
           VA+AV  +    VTV+DS G          N++G   +   +   +    + + +   + 
Sbjct: 186 VASAVSGMVAEGVTVVDSNG----------NVIGTPETPTSSTSEDRAQQMRERVLRLVE 235

Query: 255 VDNFRSAVVAELNMD----TQQIREIVYDPDSKVERSIRLSK--DAQRSETSQPESAVTV 308
               R   + E+++D    T+ IRE  +DP+ +V  S  + +  DA +++T+     VTV
Sbjct: 236 ARVGRGNAIVEVSLDTVTETESIRERRFDPNGRVAISTDVEERSDASKNQTTD----VTV 291

Query: 309 EQNMPH----VSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVN 364
             N+P     V D       S  +T    E+ NYE++            ++RLS+AV+VN
Sbjct: 292 ASNLPDGDGAVGD------ESNSSTSATRERVNYEVSETETEILRTPGAIKRLSVAVLVN 345

Query: 365 KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF--LENQ--LFN 420
                   G S    + +  LA + ++V +A G N  RGD IT+ SM+   LE Q  L +
Sbjct: 346 GLPGAAQDGSSQFTPRPEEELAALRELVESAVGFNQDRGDVITLKSMELPNLEPQGTLAS 405

Query: 421 SGTVQVSFMDILSR-HFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGK-- 477
           S  +Q    D++S    AT+  ALV LV       LGL  +R +       K  V     
Sbjct: 406 SSMLQGLTFDLMSLIQMATL--ALVTLV-------LGLFVVRPILT-----KPAVSAPLL 451

Query: 478 SILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDL---RLLHM 534
           ++  PP  S A + G      I   S  Q+    +   Q      +   S     RL  M
Sbjct: 452 AVAPPPNQSGAQSAGPALTGEIDDGSPRQNQLPGAATQQRGTVPALVGSSGTPVDRLRAM 511

Query: 535 IEINEERFAKILRKW 549
           I   +E   +ILR W
Sbjct: 512 IGDKQEETVEILRSW 526


>gi|71734724|ref|YP_275541.1| flagellar MS-ring protein [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|71555277|gb|AAZ34488.1| flagellar M-ring protein FliF [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 594

 Score =  150 bits (378), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 152/603 (25%), Positives = 258/603 (42%), Gaps = 98/603 (16%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  +I   L
Sbjct: 24  LSFLENLSEMTMLRQIGLMVGLAASVAIGFAVVLWSQQPDYRPLYGSLAGMDSKQIMDTL 83

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + ANI++ +  N  ++ V S  V +ARI LA  G+  + +N G+E+ DK    G + FM+
Sbjct: 84  TAANINYTVEPNSGALLVKSDDVQRARIQLAQAGVVQNDANIGFEILDKDQGLGTSQFME 143

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI-----RAINP 182
                R LEGE+ARTI +++ +  ARVH+ +P    F +   +P+ASV++     R++ P
Sbjct: 144 ATRYRRGLEGELARTISALNNVKGARVHLAIPKSSVFVRDDRKPSASVLVELYAGRSLEP 203

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT--ANEMERNILGKSLSIVQAIQHE 240
           S      AI +LVA +VP L    +TV+D  G LL+  A   E  + GK     + ++  
Sbjct: 204 S---QVMAIINLVATSVPELSKSQITVVDQKGALLSDQAENSELTMAGKQFDYSRRMEGM 260

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           +   +   L   LG D +++ V A ++    +     ++PD    RS + S + QRS +S
Sbjct: 261 LTQRVQNILQPILGNDRYKAEVSAVVDFSAVESTAESFNPDQPALRSEQ-SVNEQRSSSS 319

Query: 301 -----------QPESAVTVEQNM----------------------PHVSDRKVPLPRSLE 327
                      QP    T  QN                         + D     P    
Sbjct: 320 STGGVPGALSNQPPGPATAPQNATAGAAGAAGPIAPGQPLLDANGQQIMDPATGQPALAP 379

Query: 328 NTDKKEEQS--NYEINTKSIATTHDNYKLERLSIAVVVN--------KGRLTEVLGRSAD 377
               K  QS  N+E++     T     +L RLS+AVVV+         G +T     +AD
Sbjct: 380 YPADKRVQSTKNFELDRSISHTKQQQGRLTRLSVAVVVDDMVKTNAANGEVTRAPWSAAD 439

Query: 378 QGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF-------LENQLFNSGTVQVSFMD 430
                  LA   ++V  A G ++ RGD++++ ++ F       L    F S   Q  F D
Sbjct: 440 -------LARFTRLVQDAVGFDASRGDSVSVINVPFSIERAEVLPEASFYS---QPWFWD 489

Query: 431 ILSRHFATVINALVFLVGTL--LVTFLGLHALRRLHNI-DDAKKGEVGGKSILSPPPISS 487
           I+ +    VI  L+ + G L  ++T +     + L     DA+ G +GG           
Sbjct: 490 IV-KQAVGVIFILILVFGVLRPVLTNITTGKSKELAGFGGDAELGGMGG----------- 537

Query: 488 AVTTGLMPNDNIALDSSNQDIF-SHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKIL 546
               G + ND ++L      +  S +    +++N+  S         ++  +  R A+++
Sbjct: 538 --LDGELSNDRVSLGGPQSILLPSPTEGYDAQLNAIKS---------LVAEDPGRVAQVV 586

Query: 547 RKW 549
           ++W
Sbjct: 587 KEW 589


>gi|51596039|ref|YP_070230.1| flagellar MS-ring protein [Yersinia pseudotuberculosis IP 32953]
 gi|51589321|emb|CAH20942.1| flagellar M-ring protein [Yersinia pseudotuberculosis IP 32953]
          Length = 570

 Score =  150 bits (378), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 141/551 (25%), Positives = 256/551 (46%), Gaps = 73/551 (13%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  SP Y  LY  L   D   I   L++ NI +R +DNG ++ +P+  V + R+ LA Q
Sbjct: 46  LWAKSPDYRVLYSNLSDRDGGDIVTQLTQLNIPYRFADNGGALLIPAEKVHETRLRLAQQ 105

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F ++I   RALEGE++RTI ++  ++  RVH+ MP 
Sbjct: 106 GLPKGGA-VGFELLDQ-EKFGISQFSEQINYQRALEGELSRTIGTLGPVLNVRVHLAMPK 163

Query: 161 MGSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +    PTASV + A+ P          AI ++V+++V  L  G+VTV+D TG+LL
Sbjct: 164 PSLFVREQKSPTASVTL-ALQPGRALDDGQINAIVYMVSSSVAGLPPGNVTVVDQTGRLL 222

Query: 218 T-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI 276
           T ++   R++    L     +++  +  I   LA  +G  N  + V A+++  +++  + 
Sbjct: 223 TQSDSAGRDLNASQLKFTSEVENRYQRRIENILAPMVGNGNVHAQVTAQVDFASREQTDE 282

Query: 277 VYDPDSKVE----RSIRLSKDAQRSETS--QPESAVTVEQNMPHVSDRKVPLPRSL---- 326
            Y P+        RS ++S   Q   T+      A++ +  +  ++  ++P P       
Sbjct: 283 EYKPNQAANQGAVRSQQVSTSEQLGGTNVGGVPGALSNQPPVAPIAPIEIPQPAGAAANN 342

Query: 327 ----------------------ENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVN 364
                                  +  + ++ +N+E++     T      ++RLS+AVVVN
Sbjct: 343 AAPANAATTANANTTATAAKASSSNSRHDQTTNFEVDRTIRHTQQQAGMVQRLSVAVVVN 402

Query: 365 --KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG 422
               +  + +  S DQ      LA++  +   A G ++ RGDT+ + +  F  +      
Sbjct: 403 YTSDKAGKPIALSKDQ------LAQVESLTREAMGFSTVRGDTLNVVNTPFTASDDTRGS 456

Query: 423 TV----QVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKS 478
           ++    Q SF D L       +NA  +L+  L+   L    LR +     AKK +V  K+
Sbjct: 457 SLPFWQQQSFFDQL-------LNAGRYLLILLVAWILWRKLLRPML----AKK-QVADKA 504

Query: 479 ILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEIN 538
             S   +++ V T         +  S +++    +N Q R+++ V  Q   R+  + + +
Sbjct: 505 AAS---VNNIVQTAQAAE---TVKQSKEELALRKKN-QQRVSAEVQAQ---RIRELADKD 554

Query: 539 EERFAKILRKW 549
               A ++R+W
Sbjct: 555 PRVVALVIRQW 565


>gi|22126359|ref|NP_669782.1| flagellar MS-ring protein [Yersinia pestis KIM 10]
 gi|45441380|ref|NP_992919.1| flagellar MS-ring protein [Yersinia pestis biovar Microtus str.
           91001]
 gi|108807202|ref|YP_651118.1| flagellar MS-ring protein [Yersinia pestis Antiqua]
 gi|108812454|ref|YP_648221.1| flagellar MS-ring protein [Yersinia pestis Nepal516]
 gi|145598582|ref|YP_001162658.1| flagellar MS-ring protein [Yersinia pestis Pestoides F]
 gi|149366222|ref|ZP_01888257.1| flagellar M-ring protein [Yersinia pestis CA88-4125]
 gi|153947408|ref|YP_001401259.1| flagellar MS-ring protein [Yersinia pseudotuberculosis IP 31758]
 gi|162421303|ref|YP_001606485.1| flagellar MS-ring protein [Yersinia pestis Angola]
 gi|165926013|ref|ZP_02221845.1| flagellar M-ring protein FliF [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165938662|ref|ZP_02227217.1| flagellar M-ring protein FliF [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166010885|ref|ZP_02231783.1| flagellar M-ring protein FliF [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166210437|ref|ZP_02236472.1| flagellar M-ring protein FliF [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167401031|ref|ZP_02306534.1| flagellar M-ring protein FliF [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167420343|ref|ZP_02312096.1| flagellar M-ring protein FliF [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167425776|ref|ZP_02317529.1| flagellar M-ring protein FliF [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|167468921|ref|ZP_02333625.1| flagellar M-ring protein FliF [Yersinia pestis FV-1]
 gi|218928951|ref|YP_002346826.1| flagellar MS-ring protein [Yersinia pestis CO92]
 gi|229897213|ref|ZP_04512369.1| flagellar M-ring protein [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229897940|ref|ZP_04513091.1| flagellar M-ring protein [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229902829|ref|ZP_04517946.1| flagellar M-ring protein [Yersinia pestis Nepal516]
 gi|270486615|ref|ZP_06203689.1| flagellar M-ring protein FliF [Yersinia pestis KIM D27]
 gi|294504003|ref|YP_003568065.1| flagellar M-ring protein [Yersinia pestis Z176003]
 gi|21959343|gb|AAM86033.1|AE013851_5 basal-body MS (membrane and supramembrane)-ring and collar protein
           [Yersinia pestis KIM 10]
 gi|45436240|gb|AAS61796.1| flagellar M-ring protein [Yersinia pestis biovar Microtus str.
           91001]
 gi|108776102|gb|ABG18621.1| flagellar M-ring protein [Yersinia pestis Nepal516]
 gi|108779115|gb|ABG13173.1| flagellar M-ring protein [Yersinia pestis Antiqua]
 gi|115347562|emb|CAL20471.1| flagellar M-ring protein [Yersinia pestis CO92]
 gi|145210278|gb|ABP39685.1| flagellar M-ring protein [Yersinia pestis Pestoides F]
 gi|149292635|gb|EDM42709.1| flagellar M-ring protein [Yersinia pestis CA88-4125]
 gi|152958903|gb|ABS46364.1| flagellar M-ring protein FliF [Yersinia pseudotuberculosis IP
           31758]
 gi|162354118|gb|ABX88066.1| flagellar M-ring protein FliF [Yersinia pestis Angola]
 gi|165913276|gb|EDR31898.1| flagellar M-ring protein FliF [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165922217|gb|EDR39394.1| flagellar M-ring protein FliF [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165990229|gb|EDR42530.1| flagellar M-ring protein FliF [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166207617|gb|EDR52097.1| flagellar M-ring protein FliF [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166962038|gb|EDR58059.1| flagellar M-ring protein FliF [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167049420|gb|EDR60828.1| flagellar M-ring protein FliF [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167055175|gb|EDR64972.1| flagellar M-ring protein FliF [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|229680276|gb|EEO76375.1| flagellar M-ring protein [Yersinia pestis Nepal516]
 gi|229688981|gb|EEO81046.1| flagellar M-ring protein [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229693550|gb|EEO83599.1| flagellar M-ring protein [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|262361812|gb|ACY58533.1| flagellar M-ring protein [Yersinia pestis D106004]
 gi|270335119|gb|EFA45896.1| flagellar M-ring protein FliF [Yersinia pestis KIM D27]
 gi|294354462|gb|ADE64803.1| flagellar M-ring protein [Yersinia pestis Z176003]
 gi|320015431|gb|ADV99002.1| flagellar M-ring protein [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 570

 Score =  150 bits (378), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 141/551 (25%), Positives = 256/551 (46%), Gaps = 73/551 (13%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  SP Y  LY  L   D   I   L++ NI +R +DNG ++ +P+  V + R+ LA Q
Sbjct: 46  LWAKSPDYRVLYSNLSDRDGGDIVTQLTQLNIPYRFADNGGALLIPAEKVHETRLRLAQQ 105

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F ++I   RALEGE++RTI ++  ++  RVH+ MP 
Sbjct: 106 GLPKGGA-VGFELLDQ-EKFGISQFSEQINYQRALEGELSRTIGTLGPVLNVRVHLAMPK 163

Query: 161 MGSFRKIGARPTASVMIRAINPSVY---KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
              F +    PTASV + A+ P          AI ++V+++V  L  G+VTV+D TG+LL
Sbjct: 164 PSLFVREQKSPTASVTL-ALQPGRALDDGQINAIVYMVSSSVAGLPPGNVTVVDQTGRLL 222

Query: 218 T-ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI 276
           T ++   R++    L     +++  +  I   LA  +G  N  + V A+++  +++  + 
Sbjct: 223 TQSDSAGRDLNASQLKFTSEVENRYQRRIENILAPMVGNGNVHAQVTAQVDFASREQTDE 282

Query: 277 VYDPDSKVE----RSIRLSKDAQRSETS--QPESAVTVEQNMPHVSDRKVPLPRSL---- 326
            Y P+        RS ++S   Q   T+      A++ +  +  ++  ++P P       
Sbjct: 283 EYKPNQAANQGAVRSQQVSTSEQLGGTNVGGVPGALSNQPPVAPIAPIEIPQPAGAAANN 342

Query: 327 ----------------------ENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVN 364
                                  +  + ++ +N+E++     T      ++RLS+AVVVN
Sbjct: 343 AAPANTAATANANTTATAAKASSSNSRHDQTTNFEVDRTIRHTQQQAGMVQRLSVAVVVN 402

Query: 365 --KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG 422
               +  + +  S DQ      LA++  +   A G ++ RGDT+ + +  F  +      
Sbjct: 403 YTSDKAGKPIALSKDQ------LAQVESLTREAMGFSTVRGDTLNVVNTPFTASDDTRGS 456

Query: 423 TV----QVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKS 478
           ++    Q SF D L       +NA  +L+  L+   L    LR +     AKK +V  K+
Sbjct: 457 SLPFWQQQSFFDQL-------LNAGRYLLILLVAWILWRKLLRPML----AKK-QVADKA 504

Query: 479 ILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEIN 538
             S   +++ V T         +  S +++    +N Q R+++ V  Q   R+  + + +
Sbjct: 505 AAS---VNNIVQTAQAAE---TVKQSKEELALRKKN-QQRVSAEVQAQ---RIRELADKD 554

Query: 539 EERFAKILRKW 549
               A ++R+W
Sbjct: 555 PRVVALVIRQW 565


>gi|74317618|ref|YP_315358.1| flagellar MS-ring protein [Thiobacillus denitrificans ATCC 25259]
 gi|74057113|gb|AAZ97553.1| flagellar M-ring protein FliF [Thiobacillus denitrificans ATCC
           25259]
          Length = 548

 Score =  149 bits (377), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 123/439 (28%), Positives = 209/439 (47%), Gaps = 31/439 (7%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M +   +++F +  T+ GR  +L+L     V   +  A   +   P Y  L+      D 
Sbjct: 7   MVVPGNVMEFTR--TAGGRKILLMLGVAASV--AVMAAVWMWGQQPEYRVLFSNFSDRDG 62

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L + N+ ++ ++ G ++ VP+  V  AR+ LA+QGLP    N G+EL +     
Sbjct: 63  GAIVAELEKMNVPYKYAEGGGAVLVPADRVHDARLKLASQGLPKGG-NVGFELMEN-QRL 120

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI--- 177
           G + F++++   RA+EGE+AR+I+S+S + AARVH+ +P    F     +PTASV++   
Sbjct: 121 GASQFVEQVNFQRAMEGELARSIESVSAVQAARVHLALPKDSIFVSEQKQPTASVLLNLH 180

Query: 178 --RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT-ANEMER-NILGKS-LS 232
             RA++P   +   AI HLVA++VP L   +VTV+D  G LL+ A +  R N +  S + 
Sbjct: 181 PGRALDP---QQVSAIVHLVASSVPELATKNVTVVDQNGNLLSDAGKAPRVNGMDPSQIK 237

Query: 233 IVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD----PDSKVERSI 288
            VQ +Q ++   I   +   +G  N R+   A+++    +     Y     PD+   RS 
Sbjct: 238 YVQELQQDVVQRIESIITPIVGPGNVRAEATADVDFSRSEQAVESYKPNQTPDAMAIRSQ 297

Query: 289 RLSKDAQRSET---------SQPESAVTVEQNMP-HVSDRKVPLPRSLENTDKKEEQSNY 338
           + S+    S           +QP +  T    +P   +            + +K+   NY
Sbjct: 298 QTSESLNGSANPAGVPGALINQPPAPATAPITVPGQATPAPAAAAAQPATSTRKDATVNY 357

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++            L+RLS+ VVVN  +  +  G+ A +   ++   +I  +V  A G 
Sbjct: 358 EVDKTIQYVQQAGGGLKRLSVGVVVNYKKTVDKAGKVAMKPLSEAEKTQITNLVKEAMGY 417

Query: 399 NSRRGDTITITSMDFLENQ 417
           N  RGDT+ + +  F   Q
Sbjct: 418 NQARGDTVNVVNSPFASAQ 436


>gi|324018846|gb|EGB88065.1| flagellar M-ring protein FliF [Escherichia coli MS 117-3]
          Length = 512

 Score =  149 bits (377), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 114/398 (28%), Positives = 187/398 (46%), Gaps = 38/398 (9%)

Query: 43  VNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGL 102
            N P Y  L+  L   D   I   L++ NI +R S+   +I VP+  V + R+ LA QGL
Sbjct: 3   ANPPDYRTLFSNLSDQDGGAIVSQLTQMNIPYRFSEASGAIEVPAEKVHELRLRLAQQGL 62

Query: 103 PSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMG 162
           P   +  G+EL D+   FG++ F +++   RALEGE++RTI +I  +  ARVH+ MP   
Sbjct: 63  PKGGA-VGFELLDQ-EKFGISQFSEQVNYQRALEGELSRTIATIGPVKGARVHLAMPKPS 120

Query: 163 SFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLT-A 219
            F +    P+ASV +  +        +  AI HLV++AV  L  G+VT++D  G LLT +
Sbjct: 121 LFVREQKSPSASVTVNLLPGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQS 180

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
           N   R++    L     ++  I+  I   L+  +G  N  + V A+L+  +++  E  Y 
Sbjct: 181 NTSGRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYR 240

Query: 280 PDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQ- 335
           P+     +   S+    SE S    P        N P  ++   P+     N + +++Q 
Sbjct: 241 PNGDESHAALRSRQLNESEQSGSGYPGGVPGALSNQPAPAN-NAPISTPPANQNNRQQQA 299

Query: 336 ----------------SNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQG 379
                           SNYE++     T  +   ++RLS+AVVVN   L +        G
Sbjct: 300 STTSNSGPRSTQRNETSNYEVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPD--------G 351

Query: 380 KI----DSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           K     +  + +I  +   A G + +RGD++ + +  F
Sbjct: 352 KPLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPF 389


>gi|194292866|ref|YP_002008773.1| flagellar ms-ring protein [Cupriavidus taiwanensis LMG 19424]
 gi|193226770|emb|CAQ72721.1| FliF: Flagellar biosynthesis protein, M-ring protein, Belongs to
           the fliF family [Cupriavidus taiwanensis LMG 19424]
          Length = 576

 Score =  149 bits (377), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 113/429 (26%), Positives = 194/429 (45%), Gaps = 68/429 (15%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +   P Y  LY  L   D   +  +L + N+ ++ ++ G ++ VP+  V + R+ LA+Q
Sbjct: 42  LWSRGPDYKVLYSNLSERDGGAVLQSLQQMNVPYKFAEGGGAVMVPAEKVHETRLRLASQ 101

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP S + +G EL D    FG++ F +++   R LEGE+AR+I+SI+ + +ARVH+ +P 
Sbjct: 102 GLPKSGT-AGMELMDN-QKFGISQFAEQVNYQRGLEGELARSIESIAAVQSARVHLAIPK 159

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +   +PTAS+++     RAI+        AI HLV+++VP L    ++++D  G 
Sbjct: 160 PTLFVRERQKPTASIVLQLYPGRAID---EGQVAAISHLVSSSVPELTPKSISIVDQHGN 216

Query: 216 LLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           LL+    ER +    L  VQA++      I   L   +G DN R+ V A+++    +  +
Sbjct: 217 LLSNTGNERMLDATQLKYVQALEQNYLKRIEAILTPIVGKDNVRAQVTADVDFSIVEHTD 276

Query: 276 IVY----DPDSKVERSIRLSKDAQRSET----------SQPESAVTVEQNMPHVSDRKVP 321
             Y    DP     RS + S+  Q+  T          +QP +A       P        
Sbjct: 277 ESYKPNQDPTRTAIRSQQTSESTQQGATPPGGVPGALSNQPPAAAVAPVTTPQT------ 330

Query: 322 LPR-------------------------------------SLENTDKKEEQSNYEINTKS 344
            PR                                     S  ++++++   NYE++   
Sbjct: 331 -PRAGQAPGQAGAPGAGQPGQPGQAGQAGQAAQGATATASSGPSSNRRDSTVNYELDRSV 389

Query: 345 IATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGD 404
                    + RLS+AVVVN  +  +  G+   +    + LA+I  +   A G ++ RGD
Sbjct: 390 RHVQQAPGGVRRLSVAVVVNYRQQADAKGKLVAEPLPPALLAQIQNLTKEAMGFSAERGD 449

Query: 405 TITITSMDF 413
           +I + +  F
Sbjct: 450 SINVVNSPF 458


>gi|104782821|ref|YP_609319.1| flagellar MS-ring protein [Pseudomonas entomophila L48]
 gi|95111808|emb|CAK16532.1| flagellar basal-body M-ring protein FliF [Pseudomonas entomophila
           L48]
          Length = 592

 Score =  149 bits (376), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 140/573 (24%), Positives = 249/573 (43%), Gaps = 91/573 (15%)

Query: 33  IMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGK 92
           + +  A   +   P Y  LY  L   D  ++   L+ A+I + +  N  ++ V +  + +
Sbjct: 50  VAIGFAVVLWSQQPDYRPLYGSLAGMDTKQVMDTLASADIPYHVEPNSGALLVKADDLSR 109

Query: 93  ARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAA 152
           AR+ LAA G+  S  N G+EL DK    G + FM+     R+LEGE+ART+ S++ + AA
Sbjct: 110 ARLKLAAAGVAPSDGNVGFELLDKEQGLGTSQFMETTRYRRSLEGELARTVSSLNNVKAA 169

Query: 153 RVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVL 210
           RVH+ +P    F +   +P+ASV++        ++ +  AI +LVA +VP LD   VTV+
Sbjct: 170 RVHLAIPKSSVFVRDERKPSASVLVELYPGRALEAGQVMAIVNLVATSVPELDKSQVTVV 229

Query: 211 DSTGKLLTANEMERNIL---GKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELN 267
           D  G LL+ ++++   L   GK     + ++  +   ++  L   LG D +++ V A+++
Sbjct: 230 DQKGNLLS-DQLQDTALSMAGKQFDYSRRMEGLLTQRVHNILQPVLGNDRYKAEVSADVD 288

Query: 268 MDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMP-------------- 313
               +     ++PD    RS + S + QR+ +  P+       N P              
Sbjct: 289 FSAVESTSEQFNPDQPALRSEQ-SVNEQRASSQGPQGVPGALSNQPPAGASAPENARAAA 347

Query: 314 ------------------HVSDRKVPLPRSLENTDKKEEQS--NYEINTKSIATTHDNYK 353
                              + D     P        K +QS  N+E++     T     +
Sbjct: 348 TPAGAIQPGQPLVDANGQQIMDPATGQPMLAPYPSDKRQQSTKNFELDRSISHTRQQQGR 407

Query: 354 LERLSIAVVVN-KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMD 412
           L RLS+AVVV+ + +L    G +         LA   ++V  A G ++ RGD++T+ ++ 
Sbjct: 408 LTRLSVAVVVDDQVKLDAASGEATRTPWGAEDLARFTRLVQDAVGFDASRGDSVTVINVP 467

Query: 413 FLENQ-------LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRR-LH 464
           F  ++        F S   Q  F DI+ +           ++G L +  L    LR  L 
Sbjct: 468 FAADRGDELVDIPFYS---QPWFWDIVKQ-----------VLGVLFILVLVFGVLRPVLT 513

Query: 465 NIDDAKKG-------EVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIF-SHSRNLQ 516
           NI    K        E+GG   L           G + ND ++L      +  S S   +
Sbjct: 514 NITGGGKQAATDSDMELGGMIGLD----------GELANDRVSLGGPTSILLPSPSEGYE 563

Query: 517 SRINSYVSKQSDLRLLHMIEINEERFAKILRKW 549
           +++N+         +  ++  +  R A+++++W
Sbjct: 564 AQLNA---------IKGLVAEDPGRVAQVVKEW 587


>gi|95929849|ref|ZP_01312590.1| flagellar M-ring protein FliF [Desulfuromonas acetoxidans DSM 684]
 gi|95134145|gb|EAT15803.1| flagellar M-ring protein FliF [Desulfuromonas acetoxidans DSM 684]
          Length = 521

 Score =  149 bits (376), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 124/408 (30%), Positives = 201/408 (49%), Gaps = 27/408 (6%)

Query: 20  TRILILASVILVPIMLFMAARFFVNSPH--YDNLYVKLEVSDVNRISVALSEANIDFRIS 77
           +R + L +V L  + LF  A   + + H  Y  L+  L  +D + I   L E  + + + 
Sbjct: 19  SRKISLIAVTLFSLTLF--ALIIMQARHTDYQLLFANLSENDASSIVTWLKEQKVPYELR 76

Query: 78  DNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEG 137
             G S+ VP+  V + R+ LA  GLP      G+E+FDK  S G+T F+Q++  +RA++G
Sbjct: 77  SGGQSVYVPADRVYETRLDLAGAGLPQGG-GVGFEIFDK-QSLGITDFVQKVNYLRAMQG 134

Query: 138 EIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSA--EAIRHLV 195
           E++RT+ S+S + AARVH+ +P    F+    R TAS++++       K A  + I +LV
Sbjct: 135 ELSRTVASLSPVSAARVHLALPQKRLFKSEQQRVTASIIVKLAPGRTLKEAQVQGIVNLV 194

Query: 196 AAAVPNLDMGDVTVLDSTGKLLTANEME---RNILGKSLSIVQAIQHEIEMNINKALAAF 252
           A +V  LD   VTV+D+ GK+L+    E     +    L   +A++ ++E      L   
Sbjct: 195 AGSVEGLDSDYVTVVDAAGKVLSKKPDEGLSGPMTPGMLEYQRAVERQMESRAQAMLDRA 254

Query: 253 LGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNM 312
           LG+ N    V A L+    +  E +YDP S V RS +L +        Q E + TV   +
Sbjct: 255 LGMANSLVKVTAVLDFAQVEKLEELYDPKSAVPRSEQLQE--------QKEGSSTVGGGV 306

Query: 313 PHVSDRKVP----LPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRL 368
           P V     P          N+    E +NYEI+     T      ++ LS++V+V   ++
Sbjct: 307 PGVQANLGPGVNSAGGGGSNSTSSAETTNYEISKVVNRTVAPVGTIKHLSVSVLVAD-KM 365

Query: 369 TEVLGRSADQG---KIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           T+     A+     + +  L  I K+V +A GI+  RGD + + SM F
Sbjct: 366 TDGEEDGAEPALTPRSEQELRTIEKMVQSALGIDKTRGDQLNVVSMPF 413


>gi|224370787|ref|YP_002604951.1| FliF [Desulfobacterium autotrophicum HRM2]
 gi|223693504|gb|ACN16787.1| FliF [Desulfobacterium autotrophicum HRM2]
          Length = 571

 Score =  149 bits (376), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 120/428 (28%), Positives = 202/428 (47%), Gaps = 27/428 (6%)

Query: 3   ILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNR 62
           +++Q +  +K    +   R +++  V+L     F A   + N   Y + Y  L   D   
Sbjct: 4   LVEQTINLYKE---MPLARKILMGVVVLAMFGGFAAMFIWANKTEYKSAYSGLNQEDAAA 60

Query: 63  ISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGL 122
           I   L  A   +RI   G++I VP+  V   R+ +A  G+P  S   G+E+FDK + FG 
Sbjct: 61  IVDRLKTAKTPYRIEAGGATIMVPADQVYDVRLSMAKDGIPKGS-GVGFEIFDKTD-FGT 118

Query: 123 TSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP 182
           T F+Q+I R RA++GE+ARTI++   +  ARV IV P    F +   +P+AS+++   + 
Sbjct: 119 TEFVQKINRRRAIQGELARTIRAFDEVKDARVMIVFPKDSVFVEETKKPSASILLELKSD 178

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEME--------RNILGKSLSIV 234
                  A+ HLVA+A+ +L    VT++D+TG++L   + E        RN+        
Sbjct: 179 LSEDKVAAVAHLVASAIEDLTPKLVTIVDTTGRILFEGKSEEEKAKIDARNLADSQYKYK 238

Query: 235 QAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKD- 293
              +  +   I   L   +G D     V AE++  T    E +YDP  +    +R SK  
Sbjct: 239 MRYETTLAERIQTMLERIVGKDKAIVRVTAEMDFSTSNTNEEIYDPFERETTFVR-SKQI 297

Query: 294 -AQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNY 352
            A+  +T Q  + +    N P V         ++E TDKK +  NYE++ ++  T     
Sbjct: 298 LAETGQTRQDSAGIPSSVN-PVVPPGGTADASAMEMTDKKNDTINYELSRRTRQTIKPMA 356

Query: 353 KLERLSIAVVVNKGRLTEVLGRSADQGKIDSY-------LAEINKIVSAATGINSRRGDT 405
            ++R+S+A VV+ G+       S ++ K  +Y       + + + IV  A G N  R D 
Sbjct: 357 VVQRVSVAAVVD-GKYEFKTDDSGNRSK--TYVPRSQVEMQQFSDIVVKAMGFNETRQDQ 413

Query: 406 ITITSMDF 413
           +++    F
Sbjct: 414 VSMECFPF 421


>gi|73538922|ref|YP_299289.1| flagellar MS-ring protein [Ralstonia eutropha JMP134]
 gi|72122259|gb|AAZ64445.1| Flagellar FliF M-ring protein [Ralstonia eutropha JMP134]
          Length = 568

 Score =  149 bits (376), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 109/419 (26%), Positives = 194/419 (46%), Gaps = 55/419 (13%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  L   D   +  +L + N+ ++ ++ G ++ VP+  V + R+ LA+Q
Sbjct: 42  LWSRAPDYKVLYSNLSERDGGAVLQSLQQMNVPYKFAEGGGAVMVPAEKVHETRLRLASQ 101

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP S + +G EL D    FG++ F +++   R LEGE+AR+I+SI+ + +ARVH+ +P 
Sbjct: 102 GLPKSGT-TGLELMDN-QKFGISQFAEQVNYQRGLEGELARSIESIAAVQSARVHLAIPK 159

Query: 161 MGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
              F +   +PTAS+++     RAI+        AI HLV+++VP L    ++++D  G 
Sbjct: 160 PTLFVRERQKPTASIVLQLYPGRAID---EGQVAAISHLVSSSVPELTPKAISIVDQHGN 216

Query: 216 LLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           LL+ +  ER +    L  VQA++      I   L   +G DN R+ V A+++    +  +
Sbjct: 217 LLSNSGNERMLDATQLKYVQALEQNYLKRIESILTPIVGKDNVRAQVTADVDFSIVEHTD 276

Query: 276 IVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSL--------- 326
             Y P+     +   S+  Q SE++Q     T    +P     + P P +          
Sbjct: 277 ESYKPNQDPTHAAIRSQ--QTSESNQ--QGATPPGGVPGALSNQPPAPATAPITTAQTPR 332

Query: 327 --------------------------------ENTDKKEEQSNYEINTKSIATTHDNYKL 354
                                            ++++++   NYE++            +
Sbjct: 333 AGQAPGQAGAPAQPQGAQAGQAQAATSTASTGPSSNRRDSTVNYELDRTVRHVQQAPGGV 392

Query: 355 ERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
            RLS+AVVVN  +  +  G+   Q    + LA+I  +     G ++ RGD+I + +  F
Sbjct: 393 RRLSVAVVVNYRQQADAKGKMVAQPLPPALLAQIENLTKETMGFSADRGDSINVVNSPF 451


>gi|327481269|gb|AEA84579.1| flagellar MS-ring protein [Pseudomonas stutzeri DSM 4166]
          Length = 594

 Score =  149 bits (376), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 143/601 (23%), Positives = 267/601 (44%), Gaps = 94/601 (15%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F ++ + +   R + L   +   + +  A   +   P Y  L   L   D N++   L
Sbjct: 24  LSFLENLSEMSMLRQIGLLVGLAASVAMGFAVVLWSQQPDYRPLLGSLAGMDANQVMETL 83

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + A+I + +  N  ++ V ++ + +AR+ LA  G+  + SN G+E+ DK    G + FM+
Sbjct: 84  AAADIAYTVEPNSGALLVKANDLARARLKLAGAGIAPADSNIGFEILDKDQGLGTSQFME 143

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI-----RAINP 182
                R LEGE+ RTI S++ +  ARVH+ +P    F +   +P+ASV++     RA+ P
Sbjct: 144 ATRYRRGLEGELGRTISSLNNVKGARVHLAIPKSSVFVRDERKPSASVLVELYPGRALEP 203

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE--MERNILGKSLSIVQAIQHE 240
           S      AI +LVA +VP L+   +TV+D  G LL+  +   E ++ GK     + ++  
Sbjct: 204 S---QVMAIINLVATSVPELNKSQITVVDQKGNLLSDQQELTELSMAGKQFDYSRRMESL 260

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
               ++  L   LG   +++ V A+++    +     ++PD    RS + S + QR  + 
Sbjct: 261 YTQRVHNILQPVLGSGRYKAEVSADVDFSAVESTSETFNPDQPALRSEQ-SVNEQRQSSL 319

Query: 301 QPESAVTVEQNMP------------------------------------HVSDRKV--PL 322
            P+       N P                                     V+ + +  P 
Sbjct: 320 PPQGVPGALSNQPPGPASAPEQANQAAAAAGAVAPGQPLVDANGQQIMDPVTGQPMLAPF 379

Query: 323 PRSLENTDKKEEQS-NYEINTKSIATTHDNYKLERLSIAVVVN-------KGRLTEVLGR 374
           P      DK+E+ + NYE++     T   + +L RLS+AVVV+        G +  V   
Sbjct: 380 P-----ADKREQATRNYELDRSISYTKQQHGRLRRLSVAVVVDDQMSLNAAGEMVRVPWN 434

Query: 375 SADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSR 434
           + D       LA   ++V  A G ++ RGD++++ +  F+ +  F     ++ F      
Sbjct: 435 ADD-------LARFTRLVQDAVGFDASRGDSVSVINTAFVADS-FGETFEEIPFYS--QP 484

Query: 435 HFATVINALVFLVGTLLVTFLGLHA-LRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGL 493
            F  V+  ++ ++  L++ F  L   L+ L N +  K+ +V G       P       GL
Sbjct: 485 WFWDVVKQVLGVLFILVLVFGVLRPVLKSLTNPNAGKELQVAGM------PGELGEDEGL 538

Query: 494 ---MPNDNIALDSSNQDIF--SHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRK 548
              + ND ++L S  Q+I   S S   ++++N+         + +++  +  R A+++++
Sbjct: 539 DGGLANDRVSL-SGPQNILLPSPSEGYEAQLNA---------IKNLVADDPGRVAQVVKE 588

Query: 549 W 549
           W
Sbjct: 589 W 589


>gi|146282929|ref|YP_001173082.1| flagellar MS-ring protein [Pseudomonas stutzeri A1501]
 gi|145571134|gb|ABP80240.1| flagellar M-ring protein [Pseudomonas stutzeri A1501]
          Length = 585

 Score =  149 bits (375), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 143/601 (23%), Positives = 267/601 (44%), Gaps = 94/601 (15%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F ++ + +   R + L   +   + +  A   +   P Y  L   L   D N++   L
Sbjct: 15  LSFLENLSEMSMLRQIGLLVGLAASVAMGFAVVLWSQQPDYRPLLGSLAGMDANQVMETL 74

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + A+I + +  N  ++ V ++ + +AR+ LA  G+  + SN G+E+ DK    G + FM+
Sbjct: 75  AAADIAYTVEPNSGALLVKANDLARARLKLAGAGIAPADSNIGFEILDKDQGLGTSQFME 134

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI-----RAINP 182
                R LEGE+ RTI S++ +  ARVH+ +P    F +   +P+ASV++     RA+ P
Sbjct: 135 ATRYRRGLEGELGRTISSLNNVKGARVHLAIPKSSVFVRDERKPSASVLVELYPGRALEP 194

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE--MERNILGKSLSIVQAIQHE 240
           S      AI +LVA +VP L+   +TV+D  G LL+  +   E ++ GK     + ++  
Sbjct: 195 S---QVMAIINLVATSVPELNKSQITVVDQKGNLLSDQQELTELSMAGKQFDYSRRMESL 251

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
               ++  L   LG   +++ V A+++    +     ++PD    RS + S + QR  + 
Sbjct: 252 YTQRVHNILQPVLGSGRYKAEVSADVDFSAVESTSETFNPDQPALRSEQ-SVNEQRQSSL 310

Query: 301 QPESAVTVEQNMP------------------------------------HVSDRKV--PL 322
            P+       N P                                     V+ + +  P 
Sbjct: 311 PPQGVPGALSNQPPGPASAPEQANQAAAAAGAVAPGQPLVDANGQQIMDPVTGQPMLAPF 370

Query: 323 PRSLENTDKKEEQS-NYEINTKSIATTHDNYKLERLSIAVVVNK-------GRLTEVLGR 374
           P      DK+E+ + NYE++     T   + +L RLS+AVVV+        G +  V   
Sbjct: 371 P-----ADKREQATRNYELDRSISYTKQQHGRLRRLSVAVVVDDQMSLNAAGEMVRVPWN 425

Query: 375 SADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSR 434
           + D       LA   ++V  A G ++ RGD++++ +  F+ +  F     ++ F      
Sbjct: 426 ADD-------LARFTRLVQDAVGFDASRGDSVSVINTAFVADS-FGETFEEIPFYS--QP 475

Query: 435 HFATVINALVFLVGTLLVTFLGLHA-LRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGL 493
            F  V+  ++ ++  L++ F  L   L+ L N +  K+ +V G       P       GL
Sbjct: 476 WFWDVVKQVLGVLFILVLVFGVLRPVLKSLTNPNAGKELQVAGM------PGELGEDEGL 529

Query: 494 ---MPNDNIALDSSNQDIF--SHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRK 548
              + ND ++L S  Q+I   S S   ++++N+         + +++  +  R A+++++
Sbjct: 530 DGGLANDRVSL-SGPQNILLPSPSEGYEAQLNA---------IKNLVADDPGRVAQVVKE 579

Query: 549 W 549
           W
Sbjct: 580 W 580


>gi|302185562|ref|ZP_07262235.1| flagellar MS-ring protein [Pseudomonas syringae pv. syringae 642]
          Length = 594

 Score =  149 bits (375), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 148/579 (25%), Positives = 248/579 (42%), Gaps = 100/579 (17%)

Query: 33  IMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGK 92
           + +  A   +   P Y  LY  L   D  +I   L+ ANI++ +  N  ++ V S  V +
Sbjct: 49  VAIGFAVVLWSQQPDYRPLYGSLAGMDSKQIMDTLTAANINYTVEPNSGALLVKSDDVQR 108

Query: 93  ARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAA 152
           ARI LA  G+  + +N G+E+ DK    G + FM+     R LEGE+ARTI +++ +  A
Sbjct: 109 ARIQLAQAGVVQNDANIGFEILDKDQGLGTSQFMEATRYRRGLEGELARTISALNNVKGA 168

Query: 153 RVHIVMPDMGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDV 207
           RVH+ +P    F +   +P+ASV++     R++ PS      AI +LVA +VP L    +
Sbjct: 169 RVHLAIPKSSVFVRDDRKPSASVLVELYAGRSLEPS---QVMAIINLVATSVPELSKSQI 225

Query: 208 TVLDSTGKLLT--ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAE 265
           TV+D  G LL+  A   E  + GK     + ++  +   +   L   LG D +++ V A 
Sbjct: 226 TVVDQKGALLSDQAENSELTMAGKQFDYSRRMESMLTQRVQNILQPILGNDRYKAEVSAV 285

Query: 266 LNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE-----------TSQPESAVTVEQ---- 310
           ++    +     ++PD    RS + S + QRS            ++QP    T  Q    
Sbjct: 286 VDFSAVESTAESFNPDQPALRSEQ-SVNEQRSSGSSSGGVPGALSNQPPGPATAPQTAGG 344

Query: 311 ------------------NMPHVSDRKVPLPRSLENTDKKEEQS--NYEINTKSIATTHD 350
                             N   + D     P        K  QS  N+E++     T   
Sbjct: 345 GAAGAAGPIAPGQPLLDANGQQIMDPATGQPALAPYPADKRVQSTKNFELDRSISHTKQQ 404

Query: 351 NYKLERLSIAVVVN--------KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRR 402
             +L RLS+AVVV+         G +T     +AD       LA   ++V  A G ++ R
Sbjct: 405 QGRLTRLSVAVVVDDMVKTNAANGEVTRAPWSAAD-------LARFTRLVQDAVGFDASR 457

Query: 403 GDTITITSMDF-------LENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFL 455
           GD++++ ++ F       L    F S   Q  F DI+ +            VG + +  L
Sbjct: 458 GDSVSVINVPFSSERAEVLPEASFYS---QPWFWDIVKQA-----------VGVIFILIL 503

Query: 456 GLHALRR-LHNIDDAKKGEV---GGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIF-S 510
               LR  L+NI + K+ E+   GG + L           G + ND ++L      +  S
Sbjct: 504 VFGVLRPVLNNITNGKRKELAGFGGDAELG----GMGGLDGELSNDRVSLGGPQSILLPS 559

Query: 511 HSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKW 549
            +    +++N+  S         ++  +  R A+++++W
Sbjct: 560 PTEGYDAQLNAIKS---------LVAEDPGRVAQVVKEW 589


>gi|268589960|ref|ZP_06124181.1| flagellar M-ring protein FliF [Providencia rettgeri DSM 1131]
 gi|291314677|gb|EFE55130.1| flagellar M-ring protein FliF [Providencia rettgeri DSM 1131]
          Length = 561

 Score =  149 bits (375), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 115/394 (29%), Positives = 201/394 (51%), Gaps = 26/394 (6%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            ++ SP Y  L   L   D   I   L++ N+ ++I+DNGS+I VP+  V + R+ LA  
Sbjct: 46  LWLRSPDYRVLLSNLSAKDGGDIVGQLTQMNVPYQIADNGSAILVPADKVHELRLKLAQS 105

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP    N+G+EL DK   FG++ F ++I   RALEGE++RTI+S+S + +ARVH+ +P 
Sbjct: 106 GLPKGG-NTGFELLDK-EQFGISQFSEQINYQRALEGELSRTIESLSPVQSARVHLAIPK 163

Query: 161 MGSFRKIGARPTASVMIRAINPSVYKSAE--AIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    PTASV +  +   +    +  AI H+V+++V  L   +V ++D  G+LLT
Sbjct: 164 PTLFVREQKLPTASVTVGLLPGRMLDEGQISAIVHMVSSSVTGLTASNVIIVDQAGRLLT 223

Query: 219 ANE-MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIV 277
            N+  +++     + + + ++  ++  I   L+  +G  N  + V A+++    +     
Sbjct: 224 NNDNSQQSANSAQIKMTKEMESHLKQRIEDILSPLVGRANIHAQVTAQMDFSKVEQTSEE 283

Query: 278 YD----PDSKVERSIRLSKDAQRSE----------TSQPESAVT--VEQNMPHVSDRKVP 321
           Y     PDS   RS + S+  Q +           ++QP SA +  +E N  +    +  
Sbjct: 284 YKPNQTPDSAAIRSRQNSQSMQNNNGGTGGVPGALSNQPVSAPSAPIETNKDNKDGAQTA 343

Query: 322 LPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGK- 380
             R+  +  + +E +NYE++ K   T      ++RLS+AV+VN        G +  + K 
Sbjct: 344 NNRNSVSNSQSDETTNYEVDRKISHTQRQIGVVDRLSVAVIVNYHSQD---GENGPEMKP 400

Query: 381 -IDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
                L +I  +   A G ++ RGD++ IT+  F
Sbjct: 401 LPPEMLQQIEALTREAMGFSTARGDSLNITNSLF 434


>gi|299131954|ref|ZP_07025149.1| flagellar M-ring protein FliF [Afipia sp. 1NLS2]
 gi|298592091|gb|EFI52291.1| flagellar M-ring protein FliF [Afipia sp. 1NLS2]
          Length = 517

 Score =  148 bits (374), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 108/375 (28%), Positives = 186/375 (49%), Gaps = 5/375 (1%)

Query: 43  VNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGL 102
           V +P    LY  L   D + +   L    I + + ++G+ I VP   V + R+ LA +G 
Sbjct: 19  VTAPQMVTLYTDLSYDDASGVMKELDRQGIPYELKNDGAIIMVPKDKVTRLRMKLA-EGG 77

Query: 103 PSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMG 162
                  GYE+FDK ++ G TSF+Q +  +RALEGE+ARTI+SI  I A RVH+V+PD  
Sbjct: 78  LPKGGGVGYEIFDKSDTLGSTSFVQNVNHLRALEGELARTIKSIDRIQAVRVHLVLPDRP 137

Query: 163 SFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM 222
            F +    P+A++++R       +   AIRHLVA++V  L    V+++D  G+LL     
Sbjct: 138 LFSREKPEPSAAIVVRVRGALEPQQVRAIRHLVASSVNGLKPQRVSIVDENGQLLADGSG 197

Query: 223 ERNILGKSLSIVQAIQHE--IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDP 280
           + N +G   +  + I +E  +   I   + + +G    R  + A+ + +        +DP
Sbjct: 198 DANGMGDVGADERRIAYENRLRKQIESIVTSVVGAGRARVQLSADFDYNKVTETSDKFDP 257

Query: 281 DSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEI 340
           + +V RS +  +++  +   Q    VTV   MP  + ++       + + K EE +NYEI
Sbjct: 258 EGRVLRSSQTREESSATSNGQ-NGQVTVNNEMPG-NQQQNAANAGKDQSKKSEEINNYEI 315

Query: 341 NTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINS 400
           +  +     +  +++R+S+AV+V+        G      +    L  I  +V +A G   
Sbjct: 316 SRTTKTEVTEAGRVQRVSVAVLVDGTYSKNEKGDMVYAPRSKEDLERIATLVRSAIGFEK 375

Query: 401 RRGDTITITSMDFLE 415
            RGD + + ++ F E
Sbjct: 376 NRGDQVDVVNLRFAE 390


>gi|254785458|ref|YP_003072887.1| flagellar MS-ring protein [Teredinibacter turnerae T7901]
 gi|237683992|gb|ACR11256.1| flagellar M-ring protein FliF [Teredinibacter turnerae T7901]
          Length = 558

 Score =  148 bits (374), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 119/442 (26%), Positives = 209/442 (47%), Gaps = 34/442 (7%)

Query: 33  IMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGK 92
           + +  A   +     Y  LY  L+  D   +   L   +I ++I  +  ++ VP   + K
Sbjct: 39  VAIGFAVVLWSQGEDYKPLYGSLDRLDSAEVGQVLDFNDIPYKIDGSTGALLVPVDKLQK 98

Query: 93  ARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAA 152
           ARI LA  G+       G+EL D+    G + FM+     R+LEGE+ARTI SI+ + +A
Sbjct: 99  ARILLAENGI-QGDKTIGFELLDQEQPLGTSQFMEATRYRRSLEGELARTIASINSVRSA 157

Query: 153 RVHIVMPDMGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDV 207
           RVH+ +P    F + G  P+ASV +     R I P   K    I +LVAA++P LD  +V
Sbjct: 158 RVHLAIPKRSVFVRDGREPSASVFLDLYPGRPIKP---KQIAGIANLVAASIPELDSTNV 214

Query: 208 TVLDSTGKLLTANEMERNILGKS--LSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAE 265
           T++D  G L+     +  +   S  L   + ++ +I + I + L   +G  NF++ V A+
Sbjct: 215 TIVDQKGNLMEVAPEDEKLAQASQHLDYTRKVEDDIVLRIRRLLTPIIGDANFKTEVAAD 274

Query: 266 LNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHV--SDRKVPLP 323
           L+    +     ++PD    RS + S++ QR     P        N P    +  +V +P
Sbjct: 275 LDFTEMEQAAETFNPDLPAIRSEQTSEE-QRIGAGGPGGIPGALTNQPPADGAAPEVAVP 333

Query: 324 RSLENTDKKEEQS------NYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSAD 377
               +     +QS      NYE++     T H   +L RL++AVVV+     + + R+A+
Sbjct: 334 GGGGDGQTPPQQSQSRATRNYELDRTVSYTKHQKGRLRRLTVAVVVD-----DKVQRNAE 388

Query: 378 QGK------IDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDI 431
            G+       ++ L  +  +V  A G ++ RGD++ + +  F+    F+SG + +   D 
Sbjct: 389 TGEATRVPWTEAELERLAILVRDAVGFSAARGDSVNVLNEPFVAQLDFDSGDLPIWKEDW 448

Query: 432 ---LSRHFATVINALVFLVGTL 450
              L++  A  +  +  ++G +
Sbjct: 449 FLSLAKQLAGFLIIVALILGLM 470


>gi|330972435|gb|EGH72501.1| flagellar MS-ring protein [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 594

 Score =  148 bits (374), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 148/579 (25%), Positives = 248/579 (42%), Gaps = 100/579 (17%)

Query: 33  IMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGK 92
           + +  A   +   P Y  LY  L   D  +I   L+ ANI++ +  N  ++ V S  V +
Sbjct: 49  VAIGFAVVLWSQQPDYRPLYGSLAGMDSKQIMDTLTAANINYTVEPNSGALLVKSDDVQR 108

Query: 93  ARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAA 152
           ARI LA  G+  + +N G+E+ DK    G + FM+     R LEGE+ARTI +++ +  A
Sbjct: 109 ARIQLAQAGVVQNDANIGFEILDKDQGLGTSQFMEATRYRRGLEGELARTISALNNVKGA 168

Query: 153 RVHIVMPDMGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDV 207
           RVH+ +P    F +   +P+ASV++     R++ PS      AI +LVA +VP L    +
Sbjct: 169 RVHLAIPKSSVFVRDDRKPSASVLVELYAGRSLEPS---QVMAIINLVATSVPELSKSQI 225

Query: 208 TVLDSTGKLLT--ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAE 265
           TV+D  G LL+  A   E  + GK     + ++  +   +   L   LG D +++ V A 
Sbjct: 226 TVVDQKGTLLSDQAENSELTMAGKQFDYSRRMEGMLTQRVQNILQPILGNDRYKAEVSAV 285

Query: 266 LNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE-----------TSQPESAVTVEQ---- 310
           ++    +     ++PD    RS + S + QRS            ++QP    T  Q    
Sbjct: 286 VDFSAVESTAESFNPDQPALRSEQ-SVNEQRSSSSSSGGVPGALSNQPPGPATAPQTAGG 344

Query: 311 ------------------NMPHVSDRKVPLPRSLENTDKKEEQS--NYEINTKSIATTHD 350
                             N   + D     P        K  QS  N+E++     T   
Sbjct: 345 GAAGAAGPIAPGQPLLDANGQQIMDPATGQPALAPYPADKRVQSTKNFELDRSISHTKQQ 404

Query: 351 NYKLERLSIAVVVN--------KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRR 402
             +L RLS+AVVV+         G +T     +AD       LA   ++V  A G ++ R
Sbjct: 405 QGRLTRLSVAVVVDDMVKTNAANGEVTRAPWSAAD-------LARFTRLVQDAVGFDASR 457

Query: 403 GDTITITSMDF-------LENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFL 455
           GD++++ ++ F       L    F S   Q  F DI+ +            VG + +  L
Sbjct: 458 GDSVSVINVPFSSERAEVLPEASFYS---QPWFWDIVKQA-----------VGVIFILIL 503

Query: 456 GLHALRR-LHNIDDAKKGEV---GGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIF-S 510
               LR  L+NI + K+ E+   GG + L           G + ND ++L      +  S
Sbjct: 504 VFGVLRPVLNNITNGKRKELAGFGGDAELG----GMGGLDGELSNDRVSLGGPQSILLPS 559

Query: 511 HSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKW 549
            +    +++N+  S         ++  +  R A+++++W
Sbjct: 560 PTEGYDAQLNAIKS---------LVAEDPGRVAQVVKEW 589


>gi|330953748|gb|EGH54008.1| flagellar MS-ring protein [Pseudomonas syringae Cit 7]
          Length = 594

 Score =  148 bits (374), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 148/579 (25%), Positives = 248/579 (42%), Gaps = 100/579 (17%)

Query: 33  IMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGK 92
           + +  A   +   P Y  LY  L   D  +I   L+ ANI++ +  N  ++ V S  V +
Sbjct: 49  VAIGFAVVLWSQQPDYRPLYGSLAGMDSKQIMDTLTAANINYTVEPNSGALLVKSDDVQR 108

Query: 93  ARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAA 152
           ARI LA  G+  + +N G+E+ DK    G + FM+     R LEGE+ARTI +++ +  A
Sbjct: 109 ARIQLAQAGVVQNDANIGFEILDKDQGLGTSQFMEATRYRRGLEGELARTISALNNVKGA 168

Query: 153 RVHIVMPDMGSFRKIGARPTASVMI-----RAINPSVYKSAEAIRHLVAAAVPNLDMGDV 207
           RVH+ +P    F +   +P+ASV++     R++ PS      AI +LVA +VP L    +
Sbjct: 169 RVHLAIPKSSVFVRDDRKPSASVLVELYAGRSLEPS---QVMAIINLVATSVPELSKSQI 225

Query: 208 TVLDSTGKLLT--ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAE 265
           TV+D  G LL+  A   E  + GK     + ++  +   +   L   LG D +++ V A 
Sbjct: 226 TVVDQKGALLSDQAENSELTMAGKQFDYSRRMESMLTQRVQNILQPILGNDRYKAEVSAV 285

Query: 266 LNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE-----------TSQPESAVTVEQ-