PSIBLAST alignment of GI: 254780695 and protein with PDB id: 2y9j

>gi|326634131|pdb|2Y9J|Y Chain Y, Three-Dimensional Model Of Salmonella's Needle Complex At Subnanometer Resolution Length = 170
>gi|326634132|pdb|2Y9J|Z Chain Z, Three-Dimensional Model Of Salmonella's Needle Complex At Subnanometer Resolution Length = 170
 Score = 83.4 bits (204), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 31/165 (18%), Positives = 64/165 (38%), Gaps = 6/165 (3%)

Query: 51  LYVKLEVSDVNRISVALSEANIDF-RISDN--GSSISVPSSMVGKARIHLAAQGLPSSSS 107
           L   L+    N +   L   NI+  +I     G SI+V       A   +    LP    
Sbjct: 3   LLKGLDQEQANEVIAVLQMHNIEANKIDSGKLGYSITVAEPDFTAAVYWIKTYQLPPRPR 62

Query: 108 NSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMP-DMGSFRK 166
               ++F   +    +   ++     A+E  + +++Q++ G+++ARVHI    D G   +
Sbjct: 63  VEIAQMFPADS-LVSSPRAEKARLYSAIEQRLEQSLQTMEGVLSARVHISYDIDAGENGR 121

Query: 167 IGARPTASVMIRAINPSVYK-SAEAIRHLVAAAVPNLDMGDVTVL 210
                  S +      S        I+  +  +  ++D  +++V+
Sbjct: 122 PPKPVHLSALAVYERGSPLAHQISDIKRFLKNSFADVDYDNISVV 166