BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780695|ref|YP_003065108.1| flagellar MS-ring protein
[Candidatus Liberibacter asiaticus str. psy62]
         (563 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|170696757|ref|ZP_02887869.1| flagellar M-ring protein FliF [Burkholderia graminis C4D1M]
 gi|170138336|gb|EDT06552.1| flagellar M-ring protein FliF [Burkholderia graminis C4D1M]
          Length = 600

 Score =  415 bits (1065), Expect = e-113,   Method: Composition-based stats.
 Identities = 130/561 (23%), Positives = 234/561 (41%), Gaps = 25/561 (4%)

Query: 9   QFFKSGTSLGRTR---ILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISV 65
            F +  + L + R      L   + + + +      +  +P Y  LY  L   D   I  
Sbjct: 48  NFGQRLSGLAQMRGNPRAPLIFAVALLVAIVAGLFLWSRAPDYKVLYSNLSDRDGGAIIT 107

Query: 66  ALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSF 125
           AL +ANI ++ S+ G +I VPS  V + R+ LA+QGLP S S  G+EL D    FG++ F
Sbjct: 108 ALQQANIPYKFSEAGGAILVPSEQVHEMRLRLASQGLPKSGS-VGFELMDN-QKFGISQF 165

Query: 126 MQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVY 185
            ++I   RALEGE+ RTI+S+S + +ARVH+ +P    F +    P+ASV++        
Sbjct: 166 AEQINYQRALEGELERTIESVSSVKSARVHLAIPKPSVFVRDKEAPSASVLVNLYPGRAL 225

Query: 186 K--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEM 243
                 AI H+V++AVP + +  VT+LD  G LLT   +   +    L   Q I+   + 
Sbjct: 226 DEGQVLAITHMVSSAVPEMPVKGVTILDQDGNLLTQPSVGGGLDASQLKYRQQIERSTQQ 285

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE---TS 300
            I+  LA   G  N  S V A+++    +     Y P+   +++   S+ +  +      
Sbjct: 286 RIDAILAPLFGSGNAHSQVSADIDFSRSEQTSENYGPNGNPQQAAIRSQQSSTATEMSQG 345

Query: 301 QPESAVTVEQNMPHVSDRKV--------PLPRSLENTDKKEEQSNYEINTKSIATTHDNY 352
                     N P                   +   +D+K+  +NYE++           
Sbjct: 346 GASGVPGALSNQPPQPASAPINAPAGASGGVTTTPVSDRKDMTTNYELDKTVRHLEQPMG 405

Query: 353 KLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMD 412
            ++RLS+AVVVN  R+ +  G +  Q      LA++N++V  A G +++RGD++ + +  
Sbjct: 406 GIKRLSVAVVVNYLRVVDAKGHATMQPVTADKLAQVNQLVKDAMGFDAQRGDSVNVVNSP 465

Query: 413 FLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKG 472
           F      N+          +   +  +   L      L + F+ +    R          
Sbjct: 466 FTTALDPNADLP-WWRTPDMLALYKQIATYLGIGAVALFLYFVMVKPALRRAFPPPEPVV 524

Query: 473 EVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLL 532
                S   P  +          N  + +D+ + ++ +           +  +++     
Sbjct: 525 AAALPSPDEPILLDGIPAAERAGNAALEMDNGDAELQALENAK------HKYERNLEFAR 578

Query: 533 HMIEINEERFAKILRKWARSE 553
            +   + +  A +++ W   E
Sbjct: 579 SIARQDPKIVATVVKNWVTDE 599


>gi|254780695|ref|YP_003065108.1| flagellar MS-ring protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040372|gb|ACT57168.1| flagellar MS-ring protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 563

 Score =  414 bits (1063), Expect = e-113,   Method: Composition-based stats.
 Identities = 563/563 (100%), Positives = 563/563 (100%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV
Sbjct: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF
Sbjct: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI
Sbjct: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHE 240
           NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHE
Sbjct: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHE 240

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS
Sbjct: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA
Sbjct: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360

Query: 361 VVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN 420
           VVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN
Sbjct: 361 VVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN 420

Query: 421 SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL 480
           SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL
Sbjct: 421 SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL 480

Query: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540
           SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE
Sbjct: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540

Query: 541 RFAKILRKWARSEIEDRYTQHIS 563
           RFAKILRKWARSEIEDRYTQHIS
Sbjct: 541 RFAKILRKWARSEIEDRYTQHIS 563


>gi|209522223|ref|ZP_03270859.1| flagellar M-ring protein FliF [Burkholderia sp. H160]
 gi|209497337|gb|EDZ97556.1| flagellar M-ring protein FliF [Burkholderia sp. H160]
          Length = 555

 Score =  412 bits (1057), Expect = e-112,   Method: Composition-based stats.
 Identities = 134/560 (23%), Positives = 231/560 (41%), Gaps = 27/560 (4%)

Query: 9   QFFKSGTSLGRTR---ILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISV 65
            F +  + L + R      L   I + + +      +  +P Y  LY  L   D   I  
Sbjct: 7   NFGQRLSGLAQMRGNPRAPLVFAIALLVAVVAGLFLWSRTPDYKVLYSNLSDRDGGSIIA 66

Query: 66  ALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSF 125
           AL +ANI +++SD+G +I VP+  V + R+ LA+QGLP S S  G+EL D    FG++ F
Sbjct: 67  ALQQANIPYKLSDSGGAILVPAEQVHEMRLRLASQGLPKSGS-VGFELMDN-QKFGISQF 124

Query: 126 MQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP--S 183
            ++I   R+LEGE+ RTI+SIS + +ARVH+ +P    F +    P+A+V++        
Sbjct: 125 NEQINYQRSLEGELERTIESISSVKSARVHLAIPKPSVFVRDKEAPSAAVLVNLYPGRVL 184

Query: 184 VYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEM 243
                 AI H+V++AVP + +  VT+LD  G LLT       +    L   Q I+   + 
Sbjct: 185 DEGQVVAITHMVSSAVPEMPVRGVTILDQDGNLLTQPSNGSGLDATQLKFRQQIERNTQQ 244

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE---TS 300
            I+  LA   G  N RS V A+++    +     Y P+   +++   S+ +  +      
Sbjct: 245 RIDAILAPLFGPGNARSQVSADIDFSHSEQTSENYGPNGSPQQAAIRSQQSSSATEMSQG 304

Query: 301 QPESAVTVEQNMPHVSDRKV-------PLPRSLENTDKKEEQSNYEINTKSIATTHDNYK 353
                     N P                  +   +D K+  +NYE++            
Sbjct: 305 GASGVPGALSNQPPQPASAPIVAANGASSVATTPISDHKDSTTNYELDKTVRHVDQPMGG 364

Query: 354 LERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           + RLS+AVVVN  R+ +  G    Q      L +I ++V  A G ++ RGD++ + +  F
Sbjct: 365 IHRLSVAVVVNYLRVVDAKGHVTMQPVSADKLMQITQLVKDAMGFDASRGDSVNVVNSAF 424

Query: 414 LENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGE 473
             +   N+        D+L+ +        +  V   L   +   ALRR           
Sbjct: 425 TTDLDPNADLPWWRTPDMLALYKQIATYLGIGAVALFLYFVMVKPALRRAFPPPPEPVPA 484

Query: 474 VGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLH 533
           +             A             + +  +I + S  L      +  +++      
Sbjct: 485 LMSPDEPVLLDGIPAEER----------EGAIVEIETDSETLALENAKHKYERNLEFARS 534

Query: 534 MIEINEERFAKILRKWARSE 553
           +   + +  A +++ W   E
Sbjct: 535 IARQDPKIVATVVKNWVSDE 554


>gi|78067882|ref|YP_370651.1| flagellar MS-ring protein [Burkholderia sp. 383]
 gi|77968627|gb|ABB10007.1| Flagellar FliF M-ring protein [Burkholderia sp. 383]
          Length = 587

 Score =  407 bits (1045), Expect = e-111,   Method: Composition-based stats.
 Identities = 124/553 (22%), Positives = 222/553 (40%), Gaps = 29/553 (5%)

Query: 13  SGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANI 72
             + +     L     +   + +  A   +  +P Y  LY  L   D   I  AL +AN+
Sbjct: 51  GISRMKGNPKLPFLIAVAFAVAVITALVLWSRAPDYRVLYSNLSDRDGGAIIAALQQANV 110

Query: 73  DFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRV 132
            ++ +D G +I VPS+ V + R+ LAA GLP   S  G+EL D    FG++ F ++I   
Sbjct: 111 PYKFADAGGAILVPSNQVHETRLKLAAMGLPKGGS-VGFELMDN-QKFGISQFAEQINYQ 168

Query: 133 RALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP--SVYKSAEA 190
           RALEGE+ RTI+SI+ +  ARVH+ +P    F +    P+ASV +             +A
Sbjct: 169 RALEGELQRTIESINAVRGARVHLAIPKPSVFVRDKEAPSASVFVDLYPGRVLDEGQVQA 228

Query: 191 IRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALA 250
           I  +V++ VP++   +VT++D  G LLT       +    L  VQ ++H  +  I+  LA
Sbjct: 229 ITRMVSSGVPDMPAKNVTIVDQDGNLLTQTASASGLDASQLKYVQQVEHNTQKRIDAILA 288

Query: 251 AFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE---TSQPESAVT 307
              G  N RS V A+L+    +     Y P+   ++S   S+    +             
Sbjct: 289 PIFGTGNARSQVSADLDFSKIEQTSESYGPNGNPQQSAIRSQQTSSATELAQGGASGVPG 348

Query: 308 VEQNMPHVSDRKV-------PLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
              N P                P++   +D+K++ +NYE++            ++RLS+A
Sbjct: 349 ALSNTPPQPASAPIVAGNGQNAPQTTPVSDRKDQTTNYEVDKTIRHLEQPMGSVKRLSVA 408

Query: 361 VVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN 420
           VVVN   + +  G    Q    + LA++ ++V  A G + +RGD++ + +  F       
Sbjct: 409 VVVNYQPVADAKGHVTMQPLPPAKLAQVEQLVKDAMGYDEKRGDSVNVVNSAFSTVSDPY 468

Query: 421 SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL 480
           +        D+++          +      L       A+RR     +     +      
Sbjct: 469 ADLPWWRQPDMIAMAKEAAKWLGIAAAAAALYFMFVRPAMRRAFPPPEPVAPALAAPEDS 528

Query: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540
                         P+  +    S ++                 +++      +   + +
Sbjct: 529 VALDGLPGPEKSEEPDALLLGFESEKNR---------------YERNLDYARTIARQDPK 573

Query: 541 RFAKILRKWARSE 553
             A +++ W   E
Sbjct: 574 IVATVVKNWVSDE 586


>gi|91785611|ref|YP_560817.1| flagellar MS-ring protein [Burkholderia xenovorans LB400]
 gi|91689565|gb|ABE32765.1| Flagellar FliF M-ring protein [Burkholderia xenovorans LB400]
          Length = 600

 Score =  406 bits (1042), Expect = e-111,   Method: Composition-based stats.
 Identities = 137/557 (24%), Positives = 237/557 (42%), Gaps = 22/557 (3%)

Query: 12  KSGTSLGRTR---ILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALS 68
           +  + L + R      L   + + + +      +  +P Y  LY  L   D   I  AL 
Sbjct: 50  QRLSGLAQMRGNPRAPLIFAVALLVAVVAGLFLWSRAPDYKVLYSNLSDRDGGAIITALQ 109

Query: 69  EANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQE 128
            ANI ++ SD G +I VP+  V + R+ LA+QGLP S S  G+EL D    FG++ F ++
Sbjct: 110 AANIPYKFSDAGGAILVPAEQVHEMRLRLASQGLPKSGS-VGFELMDN-QKFGISQFAEQ 167

Query: 129 ITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK-- 186
           I   RALEGE+ RT++SIS + +ARVH+ +P    F +    P+ASV++           
Sbjct: 168 INYQRALEGELERTVESISSVKSARVHLAIPKPSVFVRDKEAPSASVLVNLYPGRALDEG 227

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNIN 246
              AI H+V++AVP++ +  VT+LD  G LLT       +    L   Q I+   +  I+
Sbjct: 228 QVLAITHMVSSAVPDMPVKGVTILDQDGNLLTQPSTGSGLDASQLKYRQQIERSTQQRID 287

Query: 247 KALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE---TSQPE 303
             LA   G  N  S V A+++    +     Y P+   +++   S+ +  +         
Sbjct: 288 AILAPLFGSGNAHSQVSADIDFSRSEQTSENYGPNGNPQQAAIRSQQSSSATEMSQGGAS 347

Query: 304 SAVTVEQNMPH-------VSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLER 356
                  N P         +        +   +D+K+  +NYE++            ++R
Sbjct: 348 GVPGALSNQPPQPASAPINAPTGASGVTTTPVSDRKDSTTNYELDKTVRHLERPMGGIKR 407

Query: 357 LSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLEN 416
           LS+AVVVN  R+ +  G +  Q      LA++N++V  A G ++ RGD++ + +  F  +
Sbjct: 408 LSVAVVVNYLRVVDAKGHATMQPVTADKLAQVNQLVKDAMGFDAARGDSVNVVNSPFTTD 467

Query: 417 QLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGG 476
              N+        D+++          +  V   L   +   ALRR          E   
Sbjct: 468 LDPNADLPWWRTPDMIALARQVATYLGIGAVALFLYFVMVKPALRRAF-----PPPEPVV 522

Query: 477 KSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIE 536
              L  P     +          A  SS  ++ S S  L    + +  +++     ++  
Sbjct: 523 AGALPSPDEPILLDGIPAAERAGAGGSSVAELESDSELLALENSKHKYERNLEFARNIAR 582

Query: 537 INEERFAKILRKWARSE 553
            + +  A +++ W   E
Sbjct: 583 QDPKIVATVVKNWVSDE 599


>gi|323527692|ref|YP_004229845.1| flagellar M-ring protein FliF [Burkholderia sp. CCGE1001]
 gi|323384694|gb|ADX56785.1| flagellar M-ring protein FliF [Burkholderia sp. CCGE1001]
          Length = 600

 Score =  403 bits (1036), Expect = e-110,   Method: Composition-based stats.
 Identities = 132/558 (23%), Positives = 234/558 (41%), Gaps = 25/558 (4%)

Query: 12  KSGTSLGRTR---ILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALS 68
           +  + L + R      L   + V + +      +  +P Y  LY  L   D   I  AL 
Sbjct: 51  QRLSGLAQMRGNPRAPLIFAVAVLVAVVAGLFLWSRAPDYKVLYSNLSDRDGGAIITALQ 110

Query: 69  EANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQE 128
           +ANI ++ SD G +I VP+  V + R+ LA+QGLP S S  G+EL D    FG++ F ++
Sbjct: 111 QANIPYKFSDAGGAILVPAEQVHEMRLRLASQGLPKSGS-VGFELMDN-QKFGISQFAEQ 168

Query: 129 ITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR--AINPSVYK 186
           I   RALEGE+ RTI+SIS + +ARVH+ +P    F +    P+ASV++           
Sbjct: 169 INYQRALEGELERTIESISSVKSARVHLAIPKPSVFVRDKEAPSASVLVNLFPGRALDEG 228

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNIN 246
              AI H+V++AVP + +  VT+LD  G LLT       +    L   Q I+   +  I+
Sbjct: 229 QVLAITHMVSSAVPEMPVKGVTILDQDGNLLTQPSTGGGLDASQLKYRQQIERNTQQRID 288

Query: 247 KALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE---TSQPE 303
             LA   G  N  S V A+++    +     Y P+   +++   S+ +  +         
Sbjct: 289 AILAPLFGAGNAHSQVSADIDFSRSEQTSENYGPNGNPQQAAIRSQQSSTATEMSQGGAS 348

Query: 304 SAVTVEQNMPHVSDRKVPLPRSLENTD--------KKEEQSNYEINTKSIATTHDNYKLE 355
                  N P           +  ++         +K+  +NYE++            + 
Sbjct: 349 GVPGALSNQPPQPASAPINAPNGASSSVTTTPVSDRKDMTTNYELDKTVRHLEQPMGGIR 408

Query: 356 RLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLE 415
           RLS+AVVVN  R+ +  G +  Q      LA++N++V  A G +++RGD++ + +  F  
Sbjct: 409 RLSVAVVVNYLRVVDGKGHATMQPVSADKLAQVNQLVKDAMGFDAQRGDSVNVVNSPFTA 468

Query: 416 NQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVG 475
               N+          +   +  +   L      L + F+ +    R             
Sbjct: 469 ELDPNADLP-WWRTPDMLALYKQIATYLGIGAVALFLYFVMVKPALRRAFPPPEPVVAAA 527

Query: 476 GKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMI 535
             S   P  +          N N+ +D+S+ ++ +           +  +++     ++ 
Sbjct: 528 LPSPDEPILLDGIPAAERAGNGNVEIDNSDSELLALENAK------HKYERNLEFARNIA 581

Query: 536 EINEERFAKILRKWARSE 553
             + +  A +++ W   E
Sbjct: 582 RQDPKIVATVVKNWVTDE 599


>gi|296157432|ref|ZP_06840267.1| flagellar M-ring protein FliF [Burkholderia sp. Ch1-1]
 gi|295892204|gb|EFG71987.1| flagellar M-ring protein FliF [Burkholderia sp. Ch1-1]
          Length = 600

 Score =  402 bits (1033), Expect = e-110,   Method: Composition-based stats.
 Identities = 134/560 (23%), Positives = 234/560 (41%), Gaps = 22/560 (3%)

Query: 9   QFFKSGTSLGRTR---ILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISV 65
            F +  + L + R      L   + + + + +    +  +P Y  LY  L   D   I  
Sbjct: 47  NFGQRLSGLAQMRGNPRAPLIFAVALLVAVVVGLFLWSRAPDYKVLYSNLSDRDGGAIIT 106

Query: 66  ALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSF 125
           AL  ANI ++ SD G +I VP+  V + R+ LA+QGLP S S  G+EL D    FG++ F
Sbjct: 107 ALQAANIPYKFSDAGGAILVPAEQVHEMRLRLASQGLPKSGS-VGFELMDN-QKFGISQF 164

Query: 126 MQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVY 185
            ++I   RALEGE+ RT++SIS + +ARVH+ +P    F +    P+ASV++        
Sbjct: 165 AEQINYQRALEGELERTVESISSVKSARVHLAIPKPSVFVRDKEAPSASVLVNLYPGRAL 224

Query: 186 K--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEM 243
                 AI H+V++AVP++ +  VT+LD  G LLT       +    L   Q I+   + 
Sbjct: 225 DEGQVLAITHMVSSAVPDMPVKGVTILDQDGNLLTQPSTGNGLDASQLKYRQQIERSTQQ 284

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE---TS 300
            I+  LA   G  N  S V A+++    +     Y P+   +++   S+ +  +      
Sbjct: 285 RIDAILAPLFGSGNAHSQVSADIDFSHSEQTSENYGPNGNPQQAAIRSQQSSSATEMSQG 344

Query: 301 QPESAVTVEQNMPH-------VSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYK 353
                     N P         +        +   +D+K+  +NYE++            
Sbjct: 345 AASGVPGALSNQPPQPASAPINAPTGASGVTTTPVSDRKDSTTNYELDKTVRHLERPMGG 404

Query: 354 LERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           ++RLS+AVVVN  R+ +  G +  Q      LA++N++V  A G +  RGD++ + +  F
Sbjct: 405 IKRLSVAVVVNYLRVVDAKGHATMQPVTADKLAQVNQLVKDAMGFDQARGDSVNVVNSAF 464

Query: 414 LENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGE 473
             +   N+          +      +   L      L + F+ +    R           
Sbjct: 465 STDLDPNADLP-WWRTPDMIALAKQIATYLGIGAVALFLYFVMVKPALRRAFPPPEPPVA 523

Query: 474 VGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLH 533
               S   P      +          A  SS  ++ S S  L    + +  +++     +
Sbjct: 524 GALPSPDEPIL----LDGIPAAERVGAGGSSVAELESDSELLALENSKHKYERNLEFARN 579

Query: 534 MIEINEERFAKILRKWARSE 553
           +   + +  A +++ W   E
Sbjct: 580 IARQDPKIVATVVKNWVSDE 599


>gi|187925740|ref|YP_001897382.1| flagellar MS-ring protein [Burkholderia phytofirmans PsJN]
 gi|187716934|gb|ACD18158.1| flagellar M-ring protein FliF [Burkholderia phytofirmans PsJN]
          Length = 603

 Score =  401 bits (1030), Expect = e-109,   Method: Composition-based stats.
 Identities = 134/559 (23%), Positives = 231/559 (41%), Gaps = 20/559 (3%)

Query: 10  FFKSGTSLGRTR---ILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           F +  + L + R      L   + + + +      +  +P Y  LY  L   D   I  A
Sbjct: 49  FGQRLSGLAQMRGNPRAPLIFAVALLVAVVAGLFLWSRAPDYKVLYSNLSDRDGGAIITA 108

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L  ANI ++ SD G +I VP+  V + R+ LA+QGLP S S  G+EL D    FG++ F 
Sbjct: 109 LQAANIPYKFSDAGGAILVPAEQVHEMRLRLASQGLPKSGS-VGFELMDN-QKFGISQFA 166

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           ++I   RALEGE+ RTI+SIS + +ARVH+ +P    F +    P+ASV++         
Sbjct: 167 EQINYQRALEGELERTIESISSVKSARVHLAIPKPSVFVRDKEAPSASVLVNLYPGRALD 226

Query: 187 --SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMN 244
                AI H+V++AVP++ +  VT+LD  G LLT       +    L   Q I+   +  
Sbjct: 227 EGQVLAITHMVSSAVPDMPVKGVTILDQDGNLLTQLSTGSGLDASQLKYRQQIERSTQQR 286

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE---TSQ 301
           I+  LA   G  N  S V A+++    +     Y P+   +++   S+ +  +       
Sbjct: 287 IDAILAPLFGSGNAHSQVSADIDFSHSEQTSENYGPNGNPQQAAIRSQQSSSATEMSQGA 346

Query: 302 PESAVTVEQNMPH-------VSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKL 354
                    N P         +        +   +D+K+  +NYE++            +
Sbjct: 347 ASGVPGALSNQPPQPASAPINAPNGASGVTTTPVSDRKDSTTNYELDKTVRHLERPMGGI 406

Query: 355 ERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFL 414
           +RLS+AVVVN  R+ +  G +  Q      LA++N++V  A G +  RGD++ + +  F 
Sbjct: 407 KRLSVAVVVNYLRVVDAKGHATMQPVTADKLAQVNQLVKDAMGFDQARGDSVNVVNSPFS 466

Query: 415 ENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEV 474
                N+        D+++          +  V   L   +   ALRR     +      
Sbjct: 467 TEVDPNADLPWWRTPDMIALAKQIATYLGIGAVALFLYFVMVKPALRRAFPPPEPAAVAA 526

Query: 475 GGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHM 534
                             +  N   +   S  ++   S  L      +  +++      +
Sbjct: 527 LASPDEPILLDGIPAAERMGANGTSS---SVAELEGDSELLALESAKHKYERNLEFARSI 583

Query: 535 IEINEERFAKILRKWARSE 553
              + +  A +++ W   E
Sbjct: 584 ARQDPKIVATVVKNWVSDE 602


>gi|302878299|ref|YP_003846863.1| flagellar M-ring protein FliF [Gallionella capsiferriformans ES-2]
 gi|302581088|gb|ADL55099.1| flagellar M-ring protein FliF [Gallionella capsiferriformans ES-2]
          Length = 566

 Score =  400 bits (1027), Expect = e-109,   Method: Composition-based stats.
 Identities = 124/561 (22%), Positives = 226/561 (40%), Gaps = 26/561 (4%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
           F     L   + + L   I   I L + A  +  +P Y  LY  L   D   I  +L + 
Sbjct: 15  FSRFEQLSAQQKMGLGVGIAALIALIVGAWMWGQTPDYRILYSNLSDRDGGAIIESLQQL 74

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI ++ +D G ++ +P+  V +AR+ LA+QGLP      G+EL  +   FG+T F +++ 
Sbjct: 75  NIPYKFADGGGALMIPADQVHEARLKLASQGLPK-GGTVGFELM-ENQKFGITQFAEQVN 132

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPSVYKSA 188
             RALEGE+AR++QSI  + +ARVH+ +P    F K   +P+ASV++             
Sbjct: 133 YQRALEGELARSVQSIGAVASARVHLAIPKPSVFIKEQQKPSASVVLTLHGGRLLDSAQV 192

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMER--NILGKSLSIVQAIQHEIEMNIN 246
            AI HL++++VP++   +VT++D  G LL++ +      +    L  VQ I+      I 
Sbjct: 193 TAIVHLISSSVPDMSAKNVTIVDQDGSLLSSLQDSNGLGLDANQLKYVQQIEQNYIKRIE 252

Query: 247 KALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQ---RSETSQPE 303
             L   LG +N  + V A ++    +     Y P+     S   S               
Sbjct: 253 DILTPLLGANNVHAQVTANIDFARTEQTAETYKPNQNPADSSVRSLQNSETLNGSGLNAS 312

Query: 304 SAVTVEQNMPHVSDRKV----------PLPRSLENTDKKEEQSNYEINTKSIATTHDNYK 353
                  N P V               P      +   KE   NYE++     T      
Sbjct: 313 GVPGALSNQPPVPATAPIVSAPPGATDPANAPKIDNLHKENTINYEVDRTISHTILPVGM 372

Query: 354 LERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           ++RLS+AVVVN  + T+  G+ + +   D+  A+I+ +V  A G +  RGD++ I +  F
Sbjct: 373 IKRLSVAVVVNNRKATDPKGKVSSKPLTDAEKAQIDNLVKDAVGFDKNRGDSLNIQNAAF 432

Query: 414 LENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGE 473
            + +   S           +           +L+   ++  +    ++      +    E
Sbjct: 433 NDEKEALSELP----WWKQADIIELAKLLAKYLIIAAVMLIVVFKIIKPAFRPLEPFHAE 488

Query: 474 VGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLH 533
              +  ++    +     G      IA  ++     +   +          +++      
Sbjct: 489 TDDEEHVATVDHTPGEGEGEGE---IATGAAGTQHANEPGSEHYTPPVEPYEKNLNIARQ 545

Query: 534 MIEINEERFAKILRKWARSEI 554
           + + + +  A +++ W     
Sbjct: 546 ITQQDPKIVASVIKDWVNGNE 566


>gi|307731342|ref|YP_003908566.1| flagellar M-ring protein FliF [Burkholderia sp. CCGE1003]
 gi|307585877|gb|ADN59275.1| flagellar M-ring protein FliF [Burkholderia sp. CCGE1003]
          Length = 600

 Score =  398 bits (1023), Expect = e-109,   Method: Composition-based stats.
 Identities = 131/558 (23%), Positives = 234/558 (41%), Gaps = 25/558 (4%)

Query: 12  KSGTSLGRTR---ILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALS 68
           +  + L + R      L   + V + +      +  +P Y  LY  L   D   I  AL 
Sbjct: 51  QRLSGLAQMRGNPRAPLIFAVAVLVAVVAGLFLWSRAPDYKVLYSNLSDRDGGAIITALQ 110

Query: 69  EANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQE 128
           +ANI ++ SD G +I VP+  V + R+ LA+ GLP S S  G+EL D    FG++ F ++
Sbjct: 111 QANIPYKFSDAGGAILVPAEQVHEMRLRLASLGLPKSGS-VGFELMDN-QKFGISQFAEQ 168

Query: 129 ITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK-- 186
           I   RALEGE+ RTIQSIS + +ARVH+ +P    F +    P+ASV++           
Sbjct: 169 INYQRALEGELERTIQSISSVKSARVHLAIPKPSVFVRDKEAPSASVLVNLYPGRALDEG 228

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNIN 246
              AI H+V++AVP + +  VT+LD  G LLT   +   +    L   Q I+   +  I+
Sbjct: 229 QVLAITHMVSSAVPEMPVKGVTILDQDGNLLTQPSVGGGLDASQLKYRQQIERNTQQRID 288

Query: 247 KALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE---TSQPE 303
             LA   G  N  S V A+++    +     Y P+   +++   S+ +  +         
Sbjct: 289 AILAPLFGAGNAHSQVSADIDFSRSEQTSEAYGPNGNPQQAAIRSQQSSTATEMSQGGAS 348

Query: 304 SAVTVEQNMPHVSDRKVPLPRSLENTD--------KKEEQSNYEINTKSIATTHDNYKLE 355
                  N P           +  ++         +K+  +NYE++            ++
Sbjct: 349 GVPGALSNQPPQPASAPINAPNGASSSVTTTPVSDRKDMTTNYELDKTVRHLEQPMGGIK 408

Query: 356 RLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLE 415
           RLS+AVVVN  R+ +  GR+  Q      LA++N++V  A G +++RGD++ + +  F  
Sbjct: 409 RLSVAVVVNYLRVVDGKGRATMQPVSADKLAQVNQLVKDAMGFDAQRGDSVNVVNSPFTA 468

Query: 416 NQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVG 475
               N+          +   +  +   L      L + F+ +    R             
Sbjct: 469 ELDPNADLP-WWRTPDMLALYKQIATYLGIGAVALFLYFVMVKPALRRAFPPPEPVVAAA 527

Query: 476 GKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMI 535
             S   P  +          N ++ +D+ + ++ +           +  +++      + 
Sbjct: 528 LPSPDEPILLDGIPAAERAANASVEIDTGDAELLALENAK------HKYERNLEFARSIA 581

Query: 536 EINEERFAKILRKWARSE 553
             + +  A +++ W   E
Sbjct: 582 RQDPKIVATVVKNWVTDE 599


>gi|254239470|ref|ZP_04932792.1| Flagella M-ring outer membrane protein precursor [Pseudomonas
           aeruginosa 2192]
 gi|126192848|gb|EAZ56911.1| Flagella M-ring outer membrane protein precursor [Pseudomonas
           aeruginosa 2192]
          Length = 598

 Score =  398 bits (1021), Expect = e-108,   Method: Composition-based stats.
 Identities = 119/585 (20%), Positives = 243/585 (41%), Gaps = 51/585 (8%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F  + + +   R + L   +   + +  A   +   P Y  LY  L   D NR+  AL
Sbjct: 27  LSFLDNLSEMTMLRQIGLLVGLAASVAIGFAVVLWSQQPDYKPLYGSLNGVDANRVVEAL 86

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + A+I +++  N  ++ V +  +G+AR+ +A+ G+  + SN G+E+ DK  + G + FM+
Sbjct: 87  TAADIPYKVEPNSGALLVKADDLGRARMKVASAGVAPTDSNVGFEILDKEQALGTSQFME 146

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV--Y 185
                R LEGE+ART+ S++ + AARVH+ +P    F +   +P+ASV++          
Sbjct: 147 ATNYRRGLEGELARTVSSLNNVKAARVHLAIPKSSVFVRDDRKPSASVLVELYPGRSLEP 206

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM--ERNILGKSLSIVQAIQHEIEM 243
               AI +LVA +VP LD   VTV+D  G LL+  +   E  + GK     + ++  +  
Sbjct: 207 SQVMAIVNLVATSVPELDKSQVTVVDQKGNLLSDQQELSELTMAGKQFDFTRRMEGLLTQ 266

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            ++  L   LG   +++ V A+++    +    +Y+PD    RS + + + +++ +  P+
Sbjct: 267 RVHNILQPVLGNGRYKAEVSADVDFSAVESTSEMYNPDQPALRSEQRNNEERQNSS-GPQ 325

Query: 304 SAVTVEQNMPHVSDRKVPLPRSL---------------------------------ENTD 330
                  N P           +                                      
Sbjct: 326 GVPGALSNQPPGPASAPQQATASAPADYVAPGQPLKDANGQTIIDPKTGKPELAPYPTDK 385

Query: 331 KKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVL-GRSADQGKIDSYLAEIN 389
           + +   NYE++     T     +L RLS+AVV++     +   G  + Q      LA   
Sbjct: 386 RDQTTRNYELDRSISYTKQQQGRLRRLSVAVVLDDQMKVDAKTGEVSHQPWSADELARFT 445

Query: 390 KIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGT 449
           ++V  + G ++ RGD++++ +  F   Q     ++           F  ++  ++ ++  
Sbjct: 446 RLVQDSVGYDASRGDSVSVINAPFAPAQAEEIDSIPF----YSQPWFWDIVKQVLGVLFI 501

Query: 450 LLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIF 509
           L++ F  L  +          K   GG        +  +   G + +D +++   +  + 
Sbjct: 502 LVLVFGVLRPVLSNITGGGKGKSLAGGGGRDGDLALGESGLEGSLADDRVSIGGPSSILL 561

Query: 510 SHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                      +         + +++  +  R A+++++W  ++ 
Sbjct: 562 PSP--------TEGYDAQLNAIKNLVAQDPGRVAQVVKEWINADE 598


>gi|218892935|ref|YP_002441804.1| flagellar MS-ring protein [Pseudomonas aeruginosa LESB58]
 gi|218773163|emb|CAW28975.1| Flagella M-ring outer membrane protein precursor [Pseudomonas
           aeruginosa LESB58]
          Length = 598

 Score =  397 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 118/585 (20%), Positives = 243/585 (41%), Gaps = 51/585 (8%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F  + + +   R + L   +   + +  A   +   P Y  LY  L   D NR+  AL
Sbjct: 27  LSFLDNLSEMTMLRQIGLLVGLAASVAIGFAVVLWSQQPDYKPLYGSLNGVDANRVVEAL 86

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + A+I +++  N  ++ V +  +G+AR+ +A+ G+  + +N G+E+ DK  + G + FM+
Sbjct: 87  TAADIPYKVEPNSGALLVKADDLGRARMKVASAGVAPTDNNVGFEILDKEQALGTSQFME 146

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV--Y 185
                R LEGE+ART+ S++ + AARVH+ +P    F +   +P+ASV++          
Sbjct: 147 ATNYRRGLEGELARTVSSLNNVKAARVHLAIPKSSVFVRDDRKPSASVLVELYPGRSLEP 206

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM--ERNILGKSLSIVQAIQHEIEM 243
               AI +LVA +VP LD   VTV+D  G LL+  +   E  + GK     + ++  +  
Sbjct: 207 SQVMAIVNLVATSVPELDKSQVTVVDQKGNLLSDQQELSELTMAGKQFDFTRRMEGLLTQ 266

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            ++  L   LG   +++ V A+++    +    +Y+PD    RS + + + +++ +  P+
Sbjct: 267 RVHNILQPVLGNGRYKAEVSADVDFSAVESTSEMYNPDQPALRSEQRNNEERQNSS-GPQ 325

Query: 304 SAVTVEQNMPHVSDRKVPLPRSL---------------------------------ENTD 330
                  N P           +                                      
Sbjct: 326 GVPGALSNQPPGPASAPQQATASAPADYVAPGQPLKDANGQTIIDPKTGKPELAPYPTDK 385

Query: 331 KKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVL-GRSADQGKIDSYLAEIN 389
           + +   NYE++     T     +L RLS+AVV++     +   G  + Q      LA   
Sbjct: 386 RDQTTRNYELDRSISYTKQQQGRLRRLSVAVVLDDQMKVDAKTGEVSHQPWSADELARFT 445

Query: 390 KIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGT 449
           ++V  + G ++ RGD++++ +  F   Q     ++           F  ++  ++ ++  
Sbjct: 446 RLVQDSVGYDASRGDSVSVINAPFAPVQAEEIDSIPF----YSQPWFWDIVKQVLGVLFI 501

Query: 450 LLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIF 509
           L++ F  L  +          K   GG        +  +   G + +D +++   +  + 
Sbjct: 502 LVLVFGVLRPVLSNITGGGKGKSLAGGGGRDGDLALGESGLEGSLADDRVSIGGPSSILL 561

Query: 510 SHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                      +         + +++  +  R A+++++W  ++ 
Sbjct: 562 PSP--------TEGYDAQLNAIKNLVAQDPGRVAQVVKEWINADE 598


>gi|15596298|ref|NP_249792.1| flagellar MS-ring protein [Pseudomonas aeruginosa PAO1]
 gi|107100552|ref|ZP_01364470.1| hypothetical protein PaerPA_01001577 [Pseudomonas aeruginosa PACS2]
 gi|116049030|ref|YP_792168.1| flagellar MS-ring protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|296390533|ref|ZP_06880008.1| flagellar MS-ring protein [Pseudomonas aeruginosa PAb1]
 gi|12230924|sp|Q51463|FLIF_PSEAE RecName: Full=Flagellar M-ring protein
 gi|9947018|gb|AAG04490.1|AE004540_10 Flagella M-ring outer membrane protein precursor [Pseudomonas
           aeruginosa PAO1]
 gi|115584251|gb|ABJ10266.1| Flagella M-ring outer membrane protein precursor [Pseudomonas
           aeruginosa UCBPP-PA14]
          Length = 598

 Score =  397 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 118/585 (20%), Positives = 243/585 (41%), Gaps = 51/585 (8%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F  + + +   R + L   +   + +  A   +   P Y  LY  L   D NR+  AL
Sbjct: 27  LSFLDNLSEMTMLRQIGLLVGLAASVAIGFAVVLWSQQPDYKPLYGSLNGVDANRVVEAL 86

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + A+I +++  N  ++ V +  +G+AR+ +A+ G+  + +N G+E+ DK  + G + FM+
Sbjct: 87  TAADIPYKVEPNSGALLVKADDLGRARMKVASAGVAPTDNNVGFEILDKEQALGTSQFME 146

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV--Y 185
                R LEGE+ART+ S++ + AARVH+ +P    F +   +P+ASV++          
Sbjct: 147 ATNYRRGLEGELARTVSSLNNVKAARVHLAIPKSSVFVRDDRKPSASVLVELYPGRSLEP 206

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM--ERNILGKSLSIVQAIQHEIEM 243
               AI +LVA +VP LD   VTV+D  G LL+  +   E  + GK     + ++  +  
Sbjct: 207 SQVMAIVNLVATSVPELDKSQVTVVDQKGNLLSDQQELSELTMAGKQFDFTRRMEGLLTQ 266

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            ++  L   LG   +++ V A+++    +    +Y+PD    RS + + + +++ +  P+
Sbjct: 267 RVHNILQPVLGNGRYKAEVSADVDFSAVESTSEMYNPDQPALRSEQRNNEERQNSS-GPQ 325

Query: 304 SAVTVEQNMPHVSDRKVPLPRSL---------------------------------ENTD 330
                  N P           +                                      
Sbjct: 326 GVPGALSNQPPGPASAPQQATASAPADYVAPGQPLKDANGQTIIDPKTGKPELAPYPTDK 385

Query: 331 KKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVL-GRSADQGKIDSYLAEIN 389
           + +   NYE++     T     +L RLS+AVV++     +   G  + Q      LA   
Sbjct: 386 RDQTTRNYELDRSISYTKQQQGRLRRLSVAVVLDDQMKVDAKTGEVSHQPWSADELARFT 445

Query: 390 KIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGT 449
           ++V  + G ++ RGD++++ +  F   Q     ++           F  ++  ++ ++  
Sbjct: 446 RLVQDSVGYDASRGDSVSVINAPFAPAQAEEIDSIPF----YSQPWFWDIVKQVLGVLFI 501

Query: 450 LLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIF 509
           L++ F  L  +          K   GG        +  +   G + +D +++   +  + 
Sbjct: 502 LVLVFGVLRPVLSNITGGGKGKSLAGGGGRDGDLALGESGLEGSLADDRVSIGGPSSILL 561

Query: 510 SHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                      +         + +++  +  R A+++++W  ++ 
Sbjct: 562 PSP--------TEGYDAQLNAIKNLVAQDPGRVAQVVKEWINADE 598


>gi|170700811|ref|ZP_02891802.1| flagellar M-ring protein FliF [Burkholderia ambifaria IOP40-10]
 gi|170134298|gb|EDT02635.1| flagellar M-ring protein FliF [Burkholderia ambifaria IOP40-10]
          Length = 587

 Score =  395 bits (1015), Expect = e-108,   Method: Composition-based stats.
 Identities = 120/528 (22%), Positives = 214/528 (40%), Gaps = 29/528 (5%)

Query: 38  AARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHL 97
           A   +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VPS+ V + R+ L
Sbjct: 76  ALVLWSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPSNQVHETRLKL 135

Query: 98  AAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIV 157
           AA GLP   S  G+EL D    FG++ F +++   RALEGE+ RTI+SI+ +  ARVH+ 
Sbjct: 136 AALGLPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTIESINAVRGARVHLA 193

Query: 158 MPDMGSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
           +P    F +    P+ASV +             +AI  +V++ VP++   +VT++D  G 
Sbjct: 194 IPKPSVFVRDKEAPSASVFVDLYPGRVLDEGQVQAITRMVSSGVPDMPAKNVTIVDQDGN 253

Query: 216 LLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           LLT       +    L  VQ ++   +  I+  LA   G  N RS V A+++    +   
Sbjct: 254 LLTQTASASGLDASQLKYVQQVEGNTQKRIDAILAPIFGTGNARSQVSADIDFSKLEQTS 313

Query: 276 IVYDPDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDRKV-------PLPRS 325
             Y P+   +++   S+    +                N P                 +S
Sbjct: 314 ESYGPNGTPQQAAIRSQQTSSATELAQGGASGVPGALSNTPPQPASAPIVAGNGQNGAQS 373

Query: 326 LENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYL 385
              +D+K++ +NYE++            ++RLS+AVVVN   + +  G    Q      L
Sbjct: 374 TPVSDRKDQTTNYELDKTIRHVEQPMGNVKRLSVAVVVNYQPVADAKGHVTMQPLPPPKL 433

Query: 386 AEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVF 445
           A+I ++V  A G + +RGD++ + +  F       +        D+++          + 
Sbjct: 434 AQIEQLVKDAMGYDEKRGDSVNVVNSAFSSVGDPYADLPWWRQPDMIAMAKEAAKWLGIA 493

Query: 446 LVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSN 505
                L       A+RR     +     +             A      P+  +    + 
Sbjct: 494 AAAAALYFMFVRPAMRRAFPPPEPVAPALAAPDDPVALDGLPAPDKADEPDPLLLGFENE 553

Query: 506 QDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
           ++                 +++      +   + +  A +++ W   E
Sbjct: 554 KNR---------------YERNLDYARTIARQDPKIVATVVKNWVSDE 586


>gi|238028887|ref|YP_002913118.1| flagellar MS-ring protein [Burkholderia glumae BGR1]
 gi|237878081|gb|ACR30414.1| Flagellar M-ring protein FliF [Burkholderia glumae BGR1]
          Length = 599

 Score =  395 bits (1014), Expect = e-107,   Method: Composition-based stats.
 Identities = 123/524 (23%), Positives = 214/524 (40%), Gaps = 21/524 (4%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +ANI ++ +D G +I VP+S V + R+ LAA G
Sbjct: 84  WSRAPDYRVLYSNLSDRDGGAIITALQQANIPYQFADAGGAILVPASQVHETRLRLAAMG 143

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RTI SI+ + +ARVH+ +P  
Sbjct: 144 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELERTIASINAVRSARVHLAIPKP 201

Query: 162 GSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV +              AI  +VA+ VP++   +VT++D  G LL+ 
Sbjct: 202 SVFVRDREAPSASVFVDLYPGRVLDDGQVLAITRMVASGVPDMPAKNVTIVDQDGNLLSQ 261

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ ++H  +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 262 QPSSSGLDANQLKYVQQVEHNTQKRIDAILAPMFGAGNTRSQVSADIDFTRSEQTSESYA 321

Query: 280 PDSKVERSIRLSKDAQRS---ETSQPESAVTVEQNMPHVSDRKV-------PLPRSLENT 329
           P+   +++   S+    S     S          N P                      +
Sbjct: 322 PNGTQQQAAIRSQQTSSSVESAQSGAGGVPGALSNTPPQPASAPITGASGAAGTPPTPIS 381

Query: 330 DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEIN 389
           D+K+  +NYE++     T      ++RLS+AVVVN   + +  G    Q      L ++ 
Sbjct: 382 DRKDSTTNYELDKTVRHTEAPTGGIKRLSVAVVVNNLPVVDAKGHVTMQPLTADKLKQVE 441

Query: 390 KIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGT 449
           ++V  A G +++RGD++ + +  F       +          +          L      
Sbjct: 442 QLVKDAMGYDAKRGDSVNVVNSVFTTTADPLADLP-WWRQPDMIALAKDAAKWLGIAAAA 500

Query: 450 LLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIF 509
             + F+ +    R               +     P   A+     P+  +A DS    + 
Sbjct: 501 AALYFMFVRPAMRRAFPPPEAAVANPALAAALGSPDEPALDGLPAPDSVVAEDSPEAALL 560

Query: 510 SHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
           +   +       +  +++      +   + +  A +++ W   E
Sbjct: 561 AFEADK------HRYERNLDYAKMIARQDPKIVAAVVKNWVSDE 598


>gi|75674797|ref|YP_317218.1| flagellar MS-ring protein [Nitrobacter winogradskyi Nb-255]
 gi|74419667|gb|ABA03866.1| flagellar FliF M-ring protein [Nitrobacter winogradskyi Nb-255]
          Length = 541

 Score =  395 bits (1013), Expect = e-107,   Method: Composition-based stats.
 Identities = 141/549 (25%), Positives = 244/549 (44%), Gaps = 13/549 (2%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           +         LG +R++ + +V  V I  F      V +P    L+  L V D + I   
Sbjct: 1   MQGLLAFLKGLGASRLMAMVAVTAVLIGFFAFVIMRVTTPQMTTLFTDLSVEDSSGIIKD 60

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L    I F + ++G+ I VP   V + R+ LA  GLP      GYE+FDK ++ G TSF+
Sbjct: 61  LERQAIPFELRNDGAVIMVPKDKVTRLRMKLAEAGLPKGGG-VGYEIFDKSDALGTTSFV 119

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           Q I R+RALEGE+ARTI++I  +  ARVH+V+P+   F +   +P+AS+++R       +
Sbjct: 120 QNINRLRALEGELARTIRAIDRVQDARVHLVLPERPLFTREAPQPSASIVLRVRGGLEPQ 179

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNIN 246
              AIRHLVA+AV  L    V+++D TG+LL                  A +  +   + 
Sbjct: 180 QIRAIRHLVASAVNGLKPQRVSIVDETGQLLADGSATDADGVSGDERRAAFEKRMRSQVE 239

Query: 247 KALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAV 306
             +++ +G    R  + A+ + +        +DP+ +V RS +  ++   S T+     V
Sbjct: 240 AIVSSVVGNGRARVQLSADFDYNKITQTSDKFDPEGRVLRSSQTREE--SSLTADNNGQV 297

Query: 307 TVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG 366
           TV   +P       P   + + + K EE +NYEI+  +     +  ++ R+S+AV+V+  
Sbjct: 298 TVNNELPGNQPSDNPN-TARDQSKKSEETNNYEISRTTKTEVTEAGRVNRISVAVLVDGA 356

Query: 367 RLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQV 426
                 G+   + +    L  I  +V +A G + +RGD + + ++ F E  +        
Sbjct: 357 YARNDKGQMVYEERSQEQLDRIATLVRSAIGFDQKRGDQVEVVNLKFAEPPVVVPLAEPT 416

Query: 427 SFMDIL---SRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPP 483
            ++ ++         V    V  +  L+VTF+ +  L +     +         + L  P
Sbjct: 417 GWLGMMTLTKDDVMYVFELGVMALLGLVVTFMVIRPLVQRILAAEPATPSAQPAAALPVP 476

Query: 484 PISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFA 543
             +SA  T    N             +      +++   V  QS  R+  + E N    A
Sbjct: 477 ADASAQPTETGQNL------IPGSNATAQLIDVAQVQGQVHAQSVHRVGELAERNPAETA 530

Query: 544 KILRKWARS 552
            I+R+W   
Sbjct: 531 SIIRQWLAE 539


>gi|172062015|ref|YP_001809667.1| flagellar MS-ring protein [Burkholderia ambifaria MC40-6]
 gi|171994532|gb|ACB65451.1| flagellar M-ring protein FliF [Burkholderia ambifaria MC40-6]
          Length = 587

 Score =  395 bits (1013), Expect = e-107,   Method: Composition-based stats.
 Identities = 120/528 (22%), Positives = 215/528 (40%), Gaps = 29/528 (5%)

Query: 38  AARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHL 97
           A   +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VPS+ V + R+ L
Sbjct: 76  ALVLWSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPSNQVHETRLKL 135

Query: 98  AAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIV 157
           AA GLP   S  G+EL D    FG++ F +++   RALEGE+ RTI+SI+ +  ARVH+ 
Sbjct: 136 AALGLPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTIESINAVRGARVHLA 193

Query: 158 MPDMGSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
           +P    F +    P+ASV +             +AI  +V++ VP++   +VT++D  G 
Sbjct: 194 IPKPSVFVRDKEAPSASVFVDLYPGRVLDEGQVQAITRMVSSGVPDMPAKNVTIVDQDGN 253

Query: 216 LLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           LLT       +    L  VQ ++H  +  I+  LA   G  N RS V A+++    +   
Sbjct: 254 LLTQTASASGLDASQLKYVQQVEHNTQKRIDAILAPIFGTGNARSQVSADIDFSKLEQTS 313

Query: 276 IVYDPDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDRKV-------PLPRS 325
             Y P+   +++   S+    +                N P                 +S
Sbjct: 314 ESYGPNGTPQQAAIRSQQTSSATELAQGGASGVPGALSNTPPQPASAPIVAGNGQNGAQS 373

Query: 326 LENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYL 385
              +D+K++ +NYE++            ++RLS+AVVVN   + +  G    Q      L
Sbjct: 374 TPVSDRKDQTTNYELDKTIRHVEQPMGNVKRLSVAVVVNYQPVADAKGHVTMQPLPPPKL 433

Query: 386 AEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVF 445
           A++ ++V  A G + +RGD++ + +  F       +        D+++          + 
Sbjct: 434 AQVEQLVKDAMGYDEKRGDSVNVVNSAFSSVGDPYADLPWWRQPDMIAMAKEAAKWLGIA 493

Query: 446 LVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSN 505
                L       A+RR     +     +             A      P+  +    + 
Sbjct: 494 AAAAALYFMFVRPAMRRAFPPPEPVAPALAAPDDPVALDGLPAPDKADEPDPLLLGFENE 553

Query: 506 QDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
           ++                 +++      +   + +  A +++ W   E
Sbjct: 554 KNR---------------YERNLDYARTIARQDPKIVATVVKNWVSDE 586


>gi|107023995|ref|YP_622322.1| flagellar MS-ring protein [Burkholderia cenocepacia AU 1054]
 gi|116691082|ref|YP_836705.1| flagellar MS-ring protein [Burkholderia cenocepacia HI2424]
 gi|170734416|ref|YP_001766363.1| flagellar MS-ring protein [Burkholderia cenocepacia MC0-3]
 gi|105894184|gb|ABF77349.1| flagellar M-ring protein FliF [Burkholderia cenocepacia AU 1054]
 gi|116649171|gb|ABK09812.1| flagellar M-ring protein FliF [Burkholderia cenocepacia HI2424]
 gi|169817658|gb|ACA92241.1| flagellar M-ring protein FliF [Burkholderia cenocepacia MC0-3]
          Length = 587

 Score =  395 bits (1013), Expect = e-107,   Method: Composition-based stats.
 Identities = 125/528 (23%), Positives = 217/528 (41%), Gaps = 28/528 (5%)

Query: 38  AARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHL 97
           A   +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VPS  V + R+ L
Sbjct: 75  ALVLWSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPSGQVHETRLKL 134

Query: 98  AAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIV 157
           AA GLP   S  G+EL D    FG++ F ++I   RALEGE+ RTI+SI+ +  ARVH+ 
Sbjct: 135 AAMGLPKGGS-VGFELMDN-QKFGISQFAEQINYQRALEGELQRTIESINAVRGARVHLA 192

Query: 158 MPDMGSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
           +P    F +    P+ASV +             +AI  +V++ VP++   +VT++D  G 
Sbjct: 193 IPKPSVFVRDKEAPSASVFVDLYPGRVLDEGQVQAITRMVSSGVPDMPAKNVTIVDQDGN 252

Query: 216 LLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           LLT       +    L  VQ ++H  +  I+  LA   G  N RS V A+L+    +   
Sbjct: 253 LLTQTASASGLDASQLKYVQQVEHNTQKRIDAILAPIFGAGNARSQVSADLDFSKIEQTS 312

Query: 276 IVYDPDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDRKV-------PLPRS 325
             Y P+   +++   S+    +                N P                P++
Sbjct: 313 ESYGPNGTPQQAAIRSQQTSSATELAQGGASGVPGALSNTPPQPASAPIVAGNGQNGPQT 372

Query: 326 LENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYL 385
              +D+K++ +NYE++     T      ++RLS+AVVVN   + +  G    Q    + L
Sbjct: 373 TPVSDRKDQTTNYELDKTIRHTEQPMGSVKRLSVAVVVNYQPVADAKGHVTMQPLPPAKL 432

Query: 386 AEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVF 445
           A++ ++V  A G +++RGD++ + +  F       +        D+++          + 
Sbjct: 433 AQVEQLVKDAMGYDAKRGDSVNVVNSAFSTVSDPYADLPWWRQPDMIAMAKEAAKWLGIA 492

Query: 446 LVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSN 505
                L       A+RR     +     +             A        D + L   N
Sbjct: 493 AAAAALYFMFVRPAMRRAFPPPEPAAPALAAPEDTVALDGLPAPEKAAEEADPLLLGFEN 552

Query: 506 QDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
           +                  +++      +   + +  A +++ W   E
Sbjct: 553 EK--------------NRYERNLDYARTIARQDPKIVATVVKNWVSDE 586


>gi|254246925|ref|ZP_04940246.1| Flagellar biosynthesis/type III secretory pathway lipoprotein
           [Burkholderia cenocepacia PC184]
 gi|124871701|gb|EAY63417.1| Flagellar biosynthesis/type III secretory pathway lipoprotein
           [Burkholderia cenocepacia PC184]
          Length = 587

 Score =  394 bits (1012), Expect = e-107,   Method: Composition-based stats.
 Identities = 125/528 (23%), Positives = 216/528 (40%), Gaps = 28/528 (5%)

Query: 38  AARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHL 97
           A   +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VPS  V + R+ L
Sbjct: 75  ALVLWSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPSGQVHETRLKL 134

Query: 98  AAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIV 157
           AA GLP   S  G+EL D    FG++ F ++I   RALEGE+ RTI+SI+ +  ARVH+ 
Sbjct: 135 AAMGLPKGGS-VGFELMDN-QKFGISQFAEQINYQRALEGELQRTIESINAVRGARVHLA 192

Query: 158 MPDMGSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
           +P    F +    P+ASV +             +AI  +V++ VP++   +VT++D  G 
Sbjct: 193 IPKPSVFVRDKEAPSASVFVDLYPGRVLDEGQVQAITRMVSSGVPDMPAKNVTIVDQDGN 252

Query: 216 LLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           LLT       +    L  VQ ++H  +  I+  LA   G  N RS V A+L+    +   
Sbjct: 253 LLTQTASASGLDASQLKYVQQVEHNTQKRIDAILAPIFGAGNARSQVSADLDFSKIEQTS 312

Query: 276 IVYDPDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDRKV-------PLPRS 325
             Y P+   +++   S+    +                N P                P++
Sbjct: 313 ESYGPNGTPQQAAIRSQQTSSATELAQGGASGVPGALSNTPPQPASAPIVAGNGQNGPQT 372

Query: 326 LENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYL 385
              +D+K++ +NYE++     T      ++RLS+AVVVN   + +  G    Q    + L
Sbjct: 373 TPVSDRKDQTTNYELDKTIRHTEQPMGSVKRLSVAVVVNYQPVADAKGHVTMQPLPPAKL 432

Query: 386 AEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVF 445
           A++ ++V  A G + +RGD++ + +  F       +        D+++          + 
Sbjct: 433 AQVEQLVKDAMGYDEKRGDSVNVVNSAFSTASDPYADLPWWRQPDMIAMAKEAAKWLGIA 492

Query: 446 LVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSN 505
                L       A+RR     +     +             A        D + L   N
Sbjct: 493 AAAAALYFMFVRPAMRRAFPPPEPAAPALAAPEDTVALDGLPAPEKAAEEADPLLLGFEN 552

Query: 506 QDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
           +                  +++      +   + +  A +++ W   E
Sbjct: 553 EK--------------NRYERNLDYARTIARQDPKIVATVVKNWVSDE 586


>gi|115353160|ref|YP_774999.1| flagellar MS-ring protein [Burkholderia ambifaria AMMD]
 gi|115283148|gb|ABI88665.1| flagellar M-ring protein FliF [Burkholderia ambifaria AMMD]
          Length = 587

 Score =  394 bits (1011), Expect = e-107,   Method: Composition-based stats.
 Identities = 119/528 (22%), Positives = 214/528 (40%), Gaps = 29/528 (5%)

Query: 38  AARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHL 97
           A   +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VPS+ V + R+ L
Sbjct: 76  ALVLWSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPSNQVHETRLKL 135

Query: 98  AAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIV 157
           AA GLP   S  G+EL D    FG++ F +++   RALEGE+ RTI+SI+ +  ARVH+ 
Sbjct: 136 AALGLPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTIESINAVRGARVHLA 193

Query: 158 MPDMGSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
           +P    F +    P+ASV +             +AI  +V++ VP++   +VT++D  G 
Sbjct: 194 IPKPSVFVRDKEAPSASVFVDLYPGRVLDEGQVQAITRMVSSGVPDMPAKNVTIVDQDGN 253

Query: 216 LLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           LLT       +    L  VQ ++   +  I+  LA   G  N RS V A+++    +   
Sbjct: 254 LLTQTASASGLDASQLKYVQQVERNTQKRIDSILAPIFGTGNARSQVSADIDFSKLEQTS 313

Query: 276 IVYDPDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDRKV-------PLPRS 325
             Y P+   +++   S+    +                N P                 +S
Sbjct: 314 ESYSPNGTPQQAAIRSQQTSSATELAQGGASGVPGALSNTPPQPASAPIVAGNGQNGAQS 373

Query: 326 LENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYL 385
              +D+K++ +NYE++            ++RLS+AVVVN   + +  G    Q      L
Sbjct: 374 TPVSDRKDQTTNYELDKTIRHVEQPMGNVKRLSVAVVVNYQPVADAKGHVTMQPLPPPKL 433

Query: 386 AEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVF 445
           A++ ++V  A G + +RGD++ + +  F       +        D+++          + 
Sbjct: 434 AQVEQLVKDAMGYDEKRGDSVNVVNSAFSSVGDPYADLPWWRQPDMIAMAKEAAKWLGIA 493

Query: 446 LVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSN 505
                L       A+RR     +     +             A      P+  +    + 
Sbjct: 494 AAAAALYFMFVRPAMRRAFPPPEPVAPALAAPDDPVALDGLPAPDRADEPDPLLLGFENE 553

Query: 506 QDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
           ++                 +++      +   + +  A +++ W   E
Sbjct: 554 KNR---------------YERNLDYARTIARQDPKIVATVVKNWVSDE 586


>gi|206558926|ref|YP_002229686.1| flagellar MS-ring protein [Burkholderia cenocepacia J2315]
 gi|198034963|emb|CAR50835.1| flagellar M-ring protein FliF [Burkholderia cenocepacia J2315]
          Length = 587

 Score =  394 bits (1011), Expect = e-107,   Method: Composition-based stats.
 Identities = 125/528 (23%), Positives = 217/528 (41%), Gaps = 28/528 (5%)

Query: 38  AARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHL 97
           A   +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VPS+ V + R+ L
Sbjct: 75  ALVLWSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPSNQVHETRLKL 134

Query: 98  AAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIV 157
           AA GLP   S  G+EL D    FG++ F ++I   RALEGE+ RTI+SI+ +  ARVH+ 
Sbjct: 135 AAMGLPKGGS-VGFELMDN-QKFGISQFAEQINYQRALEGELQRTIESINAVRGARVHLA 192

Query: 158 MPDMGSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
           +P    F +    P+ASV +             +AI  +V++ VP++   +VT++D  G 
Sbjct: 193 IPKPSVFVRDKEAPSASVFVDLYPGRVLDEGQVQAITRMVSSGVPDMPAKNVTIVDQDGN 252

Query: 216 LLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           LLT       +    L  VQ ++H  +  I+  LA   G  N RS V A+L+    +   
Sbjct: 253 LLTQTASASGLDASQLKYVQQVEHNTQKRIDAILAPIFGAGNARSQVSADLDFSKIEQTS 312

Query: 276 IVYDPDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDRKV-------PLPRS 325
             Y P+   +++   S+    +                N P                P++
Sbjct: 313 ESYGPNGTPQQAAIRSQQTSSATELAQGGASGVPGALSNTPPQPASAPIVAGNGQNAPQT 372

Query: 326 LENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYL 385
              +D+K++ +NYE++     T      ++RLS+AVVVN   + +  G    Q    + L
Sbjct: 373 TPVSDRKDQTTNYELDKTIRHTEQPMGSVKRLSVAVVVNYQPVADAKGHVTMQPLPPAKL 432

Query: 386 AEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVF 445
           A++ ++V  A G + +RGD++ + +  F       +        D+++          + 
Sbjct: 433 AQVEQLVKDAMGYDEKRGDSVNVVNSAFSTVSDPYADLPWWRQPDMIAMAKEAAKWLGIA 492

Query: 446 LVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSN 505
                L       A+RR     +     +             A        D + L   N
Sbjct: 493 AAAAALYFMFVRPAMRRAFPPPEPAAPALAAPEDAVALDGLPAPDKAAEEPDPLLLGFEN 552

Query: 506 QDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
           +                  +++      +   + +  A +++ W   E
Sbjct: 553 EK--------------NRYERNLDYARTIARQDPKIVATVVKNWVSDE 586


>gi|134297240|ref|YP_001120975.1| flagellar MS-ring protein [Burkholderia vietnamiensis G4]
 gi|134140397|gb|ABO56140.1| flagellar M-ring protein FliF [Burkholderia vietnamiensis G4]
          Length = 587

 Score =  393 bits (1010), Expect = e-107,   Method: Composition-based stats.
 Identities = 121/527 (22%), Positives = 210/527 (39%), Gaps = 29/527 (5%)

Query: 39  ARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLA 98
              +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VPS+ V + R+ LA
Sbjct: 77  LVLWSRTPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPSNQVHETRLKLA 136

Query: 99  AQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVM 158
           A GLP   S  G+EL D    FG++ F +++   RALEGE+ RTI+SI+ +  ARVH+ +
Sbjct: 137 AMGLPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTIESINAVRGARVHLAI 194

Query: 159 PDMGSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKL 216
           P    F +    P+ASV I             +AI  +V++ VP++   +VT++D  G L
Sbjct: 195 PKPSVFVRDKEAPSASVFIDLYPGRVLDEGQVQAITRMVSSGVPDMPAKNVTIVDQDGNL 254

Query: 217 LTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI 276
           LT       +    L  VQ ++   +  I+  LA   G  N RS V A+++    +    
Sbjct: 255 LTQPASASGLDASQLKYVQQVERNTQKRIDSILAPIFGTGNARSQVSADIDFSKLEQTSE 314

Query: 277 VYDPDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDRKV-------PLPRSL 326
            Y P+   +++   S+    +                N P                P+S 
Sbjct: 315 SYGPNGTPQQAAIRSQQTSSATELAQGGASGVPGALSNTPPQPASAPIVAGNGQSGPQST 374

Query: 327 ENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLA 386
             +D+K++ +NYE++            ++RLS+AVVVN   + +  G    Q    + LA
Sbjct: 375 PVSDRKDQTTNYELDKTIRHVEQPMGNVKRLSVAVVVNYQPVADAKGHVTMQPLPPAKLA 434

Query: 387 EINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFL 446
           +I ++V  A G + +RGD++ + +  F       +        D++           +  
Sbjct: 435 QIEQLVKDAMGYDEKRGDSVNVVNSAFSTANDPYADLPWWRQPDMIEMAKEAAKWLGIAA 494

Query: 447 VGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQ 506
               L       A+RR     +     +                          L +   
Sbjct: 495 AAAALYFMFVRPAMRRAFPPPEPPAPALAAPEGTVVLD---------------GLPAPEA 539

Query: 507 DIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
                   L         +++      +   + +  A +++ W   E
Sbjct: 540 AAEPDPMLLGFENEKNRYERNLDYARTIARQDPKIVATVVKNWVSDE 586


>gi|288960029|ref|YP_003450369.1| flagellar M-ring protein [Azospirillum sp. B510]
 gi|288912337|dbj|BAI73825.1| flagellar M-ring protein [Azospirillum sp. B510]
          Length = 553

 Score =  393 bits (1010), Expect = e-107,   Method: Composition-based stats.
 Identities = 156/554 (28%), Positives = 272/554 (49%), Gaps = 9/554 (1%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           +    ++  +LG  R+  +  V L+ I  F+     +++P  + LY +L+ ++   I+  
Sbjct: 1   MNNLLQTLRNLGPARLAAIGGVGLLLIGFFVYLTTRLSTPEMELLYAELQPTEAAAIAKK 60

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L EA + F +  +G+ I VP+  VG  R+ +AAQGLP S  + GYELFDK   FG TSFM
Sbjct: 61  LEEAKVPFSVDKSGTKIMVPADQVGPMRMRMAAQGLP-SGGSVGYELFDKGEGFGATSFM 119

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN--PSV 184
           Q I  +RALEGE+ART+Q+++G+  ARVH+V+P    F +     TASV ++        
Sbjct: 120 QNINHLRALEGEMARTVQTLNGVQQARVHLVLPKRELFARQQNPATASVFLKLRPGAQLS 179

Query: 185 YKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL---TANEMERNILGKSLSIVQAIQHEI 241
            ++ +AI+ L+AA+VPNLD   ++++D  GKLL   T ++    ++  +    QA +  +
Sbjct: 180 RENIQAIQQLIAASVPNLDPNRISIVDDKGKLLARGTGSDTAEAMMASAEEKKQAYEGRL 239

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
              I   L   LG    R+ V A+L+ D    +  ++DPDS+V RS +   ++  S    
Sbjct: 240 ARTIEDLLGRTLGYGKVRAEVSADLDFDRITTQSEIFDPDSQVVRSTQTVNESNESSDRD 299

Query: 302 PESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAV 361
           P + VTV+QN+P         P S   +++ EE  NYEI   + +   ++ ++ RLS+AV
Sbjct: 300 PLAPVTVDQNLPTAQSSSSASPLSSNKSNRAEETINYEITKTTKSHVRESGQVRRLSVAV 359

Query: 362 VVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNS 421
           +V+           A Q + D  +  I  +V +A G+++ RGD++ + +M F   +    
Sbjct: 360 LVDGTYQLSKDAPPAYQPRSDQEIESIKALVRSAVGLDAVRGDSLEVINMRFWSPEDDIQ 419

Query: 422 GTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILS 481
              ++ FM +       +   +V  +  +L+  L +  L          + E     +L+
Sbjct: 420 KPDEL-FMGMTKDDLFRIAEMVVLGIVAVLIILLVIRPLIARAFEKAEMQEEDEMDRLLT 478

Query: 482 PPPISSAVTTGL--MPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
                 A           ++AL+++  D         +R+   V   S  ++  +++ + 
Sbjct: 479 DQAGMPAALAAPTGALAQDLALEAAQADEELEQMIDINRVEGRVRASSLRKVGEIVDKHP 538

Query: 540 ERFAKILRKWARSE 553
           E    ILR W   E
Sbjct: 539 EEAVSILRNWLYQE 552


>gi|92116309|ref|YP_576038.1| flagellar MS-ring protein [Nitrobacter hamburgensis X14]
 gi|91799203|gb|ABE61578.1| flagellar M-ring protein FliF [Nitrobacter hamburgensis X14]
          Length = 540

 Score =  393 bits (1009), Expect = e-107,   Method: Composition-based stats.
 Identities = 141/549 (25%), Positives = 238/549 (43%), Gaps = 14/549 (2%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           +         LG +R++ + +V    I  F      V +P    L+  L V D + I   
Sbjct: 1   MQGLLAFLKGLGPSRLMAMVAVTTALIGFFAFVIMRVTAPQMTTLFTDLSVEDSSGIIKD 60

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L    I + + ++G+ I VP   V + R+ LA  GLP      GYE+FDK ++ G TSF+
Sbjct: 61  LERQAIPYELRNDGAVIMVPKDKVTRLRMKLAEAGLPKGGG-VGYEIFDKSDALGTTSFV 119

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           Q I R+RALEGE++RTI++I  I  ARVH+V+PD   F +   +P+AS+++R       +
Sbjct: 120 QNINRLRALEGELSRTIKAIDRIQDARVHLVLPDRPLFSREAPQPSASIVLRVRGGLEPQ 179

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNIN 246
              AIRHLVA+AV  L    V+++D TG+LL                  A +  +   + 
Sbjct: 180 QIRAIRHLVASAVNGLKPQRVSIVDETGQLLADGSATDADGTTGDERRTAFEKRMRNQVE 239

Query: 247 KALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAV 306
             +++ +G    R  + A+ + +        +DP+ +V RS +  ++   S T+     V
Sbjct: 240 AIVSSVVGSGRARVQLSADFDYNKITQTSDKFDPEGRVLRSSQTREE--SSVTADNNGQV 297

Query: 307 TVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG 366
           TV   +P       P P + + + K EE +NYEI+  +     +  ++ R+S+AV+V+  
Sbjct: 298 TVNNELPGNQQSDNPSP-ARDQSKKSEETNNYEISRTTKTEVTEAGRVNRISVAVLVDGT 356

Query: 367 RLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQV 426
                 G+     +    L  I  +V +A G + +RGD + + ++ F E           
Sbjct: 357 YTKNDQGQMVYAERSKEQLDRIATLVRSAIGFDQKRGDQVEVVNLKFAEPPAAVPLAEPA 416

Query: 427 ---SFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPP 483
                M +       VI+  V L+  L+VTF+ +  L R     +              P
Sbjct: 417 GLLGMMALTKDDVMYVIDLAVMLLLGLVVTFMVIRPLVRRILASEPAPAGAA-------P 469

Query: 484 PISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFA 543
               A             +       +      +++   V  QS  R+  + E N    A
Sbjct: 470 SQLPAPADATAQAGATGQNLVPGGSATAQLIDVAQVQGQVHAQSVHRVGELAERNPAETA 529

Query: 544 KILRKWARS 552
            I+R+W   
Sbjct: 530 SIIRQWLAE 538


>gi|152984140|ref|YP_001349624.1| flagellar MS-ring protein [Pseudomonas aeruginosa PA7]
 gi|150959298|gb|ABR81323.1| flagellar M-ring protein FliF [Pseudomonas aeruginosa PA7]
          Length = 597

 Score =  393 bits (1009), Expect = e-107,   Method: Composition-based stats.
 Identities = 120/585 (20%), Positives = 244/585 (41%), Gaps = 52/585 (8%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F  + + +   R + L   +   + +  A   +   P Y  LY  L   D NR+  AL
Sbjct: 27  LSFLDNLSEMTMLRQIGLLVGLAASVAIGFAVVLWSQQPDYKPLYGSLNGVDANRVVEAL 86

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + A+I +++  N  ++ V +  +G+AR+ +A+ G+  + +N G+E+ DK  + G + FM+
Sbjct: 87  TAADIPYKVEPNSGALLVKADDLGRARMKVASAGVAPTDNNIGFEILDKEQALGTSQFME 146

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV--Y 185
                R LEGE+ART+ S++ + AARVH+ +P    F +   +P+ASV++          
Sbjct: 147 ATNYRRGLEGELARTVSSLNNVKAARVHLAIPKSSVFVRDDRKPSASVLVELYPGRSLEP 206

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM--ERNILGKSLSIVQAIQHEIEM 243
               AI +LVA +VP LD   VTV+D  G LL+  +   E  + GK     + ++  +  
Sbjct: 207 SQVMAIVNLVATSVPELDKSQVTVVDQKGNLLSDQQELSELTMAGKQFDFTRRMEGLLTQ 266

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            ++  L   LG   +++ V A+++    +    +Y+PD    RS + + + +++ +  P+
Sbjct: 267 RVHNILQPVLGNGRYKAEVSADVDFSAVESTSEMYNPDQPALRSEQRNNEERQNSS-GPQ 325

Query: 304 SAVTVEQNMPHVSDRKVPLPRSL---------------------------------ENTD 330
                  N P           +                                      
Sbjct: 326 GVPGALSNQPPGPATAPQQATAGAPADYVAPGQPLKDANGQTIIDPKTGKPELAPYPTDK 385

Query: 331 KKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVL-GRSADQGKIDSYLAEIN 389
           + +   NYE++     T     +L RLS+AVV++     +   G  + Q      LA   
Sbjct: 386 RDQTTRNYELDRSISYTKQQQGRLRRLSVAVVLDDQMKVDAKTGEVSHQPWSADELARFT 445

Query: 390 KIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGT 449
           ++V  + G ++ RGD++++ +  F   Q     ++           F  ++  ++ ++  
Sbjct: 446 RLVQDSVGYDASRGDSVSVINAPFAPAQAEEIDSIPF----YSQPWFWDIVKQVLGVLFI 501

Query: 450 LLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIF 509
           L++ F  L  +    +     K    G          S +   L  +       S+  + 
Sbjct: 502 LVLVFGVLRPVLSNISGGGKGKALADGGRDGDLALGDSGLEGSLADDRVSIGGPSSILLP 561

Query: 510 SHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
           S +    +++N          + +++  +  R A+++++W  ++ 
Sbjct: 562 SPTEGYDAQLN---------AIKNLVAQDPGRVAQVVKEWINADE 597


>gi|254251157|ref|ZP_04944475.1| Flagellar biosynthesis/type III secretory pathway lipoprotein
           [Burkholderia dolosa AUO158]
 gi|124893766|gb|EAY67646.1| Flagellar biosynthesis/type III secretory pathway lipoprotein
           [Burkholderia dolosa AUO158]
          Length = 588

 Score =  392 bits (1007), Expect = e-107,   Method: Composition-based stats.
 Identities = 127/528 (24%), Positives = 218/528 (41%), Gaps = 28/528 (5%)

Query: 38  AARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHL 97
           A   +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VPSS V + R+ L
Sbjct: 76  ALVLWSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPSSQVHETRLKL 135

Query: 98  AAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIV 157
           AA GLP   S  G+EL D    FG++ F ++I   RALEGE+ RTI+SI+ +  ARVH+ 
Sbjct: 136 AAMGLPKGGS-VGFELMDN-QKFGISQFAEQINYQRALEGELQRTIESINAVRGARVHLA 193

Query: 158 MPDMGSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
           +P    F +    P+ASV +             +AI  +V++ VP++   +VT++D  G 
Sbjct: 194 IPKPSVFVRDKEAPSASVFVDLYPGRVLDEGQVQAITRMVSSGVPDMPAKNVTIVDQDGN 253

Query: 216 LLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           LLT       +    L  VQ ++   +  I+  LA   G  N RS V A+++    +   
Sbjct: 254 LLTQTASATGLDASQLKYVQQVERNTQKRIDAILAPIFGAGNARSQVSADIDFSKLEQTS 313

Query: 276 IVYDPDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDRKV-------PLPRS 325
             Y P+   +++   S+    S     S          N P                P++
Sbjct: 314 ESYAPNGTPQQAAIRSQQTSTSTELAQSGASGVPGALSNTPPQPASAPIVAGNGQNGPQT 373

Query: 326 LENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYL 385
              +D+K++ +NYE++            ++RLS+AVVVN   + +  G    Q    + L
Sbjct: 374 TPVSDRKDQTTNYELDKTIRHVEQPMGSVKRLSVAVVVNYQPVADAKGHVTMQPLPPAKL 433

Query: 386 AEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVF 445
           A+I ++V  A G + +RGD++ + +  F       +        DI++          + 
Sbjct: 434 AQIEQLVKDAMGYDQKRGDSVNVVNSAFSTATDPYADLPWWRQPDIIAIAKEAAKWLGIA 493

Query: 446 LVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSN 505
                L       A+RR     +     +     +       A  +     D + L   N
Sbjct: 494 AAAAALYFMFVRPAMRRAFPPPEPAAPALAAPEDVVALDGLPAPASADDEPDTLLLGFEN 553

Query: 506 QDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
           +                  +++      +   + +  A +++ W   E
Sbjct: 554 EK--------------NRYERNLDYARTIARQDPKIVATVVKNWVSDE 587


>gi|295678025|ref|YP_003606549.1| flagellar M-ring protein FliF [Burkholderia sp. CCGE1002]
 gi|295437868|gb|ADG17038.1| flagellar M-ring protein FliF [Burkholderia sp. CCGE1002]
          Length = 598

 Score =  392 bits (1007), Expect = e-107,   Method: Composition-based stats.
 Identities = 130/526 (24%), Positives = 223/526 (42%), Gaps = 24/526 (4%)

Query: 40  RFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAA 99
             +  +P Y  LY  L   D   I  AL +ANI +++S++G+++ VP+  V + R+ LA+
Sbjct: 84  FLWSRAPSYKVLYSNLSDRDGGSIITALQQANIPYKLSESGTAVLVPAEQVHETRLRLAS 143

Query: 100 QGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMP 159
           QGLP S S  G+EL D    FG++ F +++   RALEGE+ RTI SIS + +ARVH+ +P
Sbjct: 144 QGLPKSGS-VGFELMDN-QKFGISQFDEQVNYQRALEGELERTIGSISSVKSARVHLAIP 201

Query: 160 DMGSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
               F +    P+ASV++              AI H+VA+AVP + +  VT+LD  G LL
Sbjct: 202 KPSVFVRDKEPPSASVLVNLYPGRVLDEGQVVAITHMVASAVPQMPVRGVTILDQDGNLL 261

Query: 218 TANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIV 277
           T       +    L   Q I+   +  I+  LA   G  N RS V A+++    +     
Sbjct: 262 TQPTNGSGLDATQLKFRQQIERNTQQRIDTILAPLFGAGNARSQVSADIDFSHSEQTSEK 321

Query: 278 YDPDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDRKVPLPRSLEN------ 328
           Y P++  + +   S+    +                N P        +  +  +      
Sbjct: 322 YGPNANPQDAAIRSQQTSSATEMSQGGASGVPGALSNQPPQPASAPIVAGNGASSVSTTP 381

Query: 329 -TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAE 387
            +D K+  +NYE++            + RL++AVVVN  R+ +  G    Q      LA+
Sbjct: 382 ISDHKDSTTNYELDKTVRHIDQPMGGIRRLTVAVVVNYMRVVDPKGHVTMQPVSADKLAQ 441

Query: 388 INKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLV 447
           I ++V  A G ++ RGD++ + +  F  +   N+        D+L+ +        +  V
Sbjct: 442 ITQLVKDAMGYDASRGDSVNVVNSAFTTDLDPNADLPWWRTPDMLALYKQIATYLGIGAV 501

Query: 448 GTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQD 507
              L   +   ALRR           +             A             D +  +
Sbjct: 502 ALFLYFVMVKPALRRAFPPPPEPVPALMSPDEPVLLDGIPADER----------DGAVVE 551

Query: 508 IFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
           I + S  L      +  +++     ++   + +  A +++ W   E
Sbjct: 552 IEADSEKLALENAKHKYERNLEFARNIARQDPKIVATVVKNWVSDE 597


>gi|89094455|ref|ZP_01167395.1| flagellar M-ring protein [Oceanospirillum sp. MED92]
 gi|89081347|gb|EAR60579.1| flagellar M-ring protein [Oceanospirillum sp. MED92]
          Length = 554

 Score =  391 bits (1004), Expect = e-106,   Method: Composition-based stats.
 Identities = 120/555 (21%), Positives = 235/555 (42%), Gaps = 28/555 (5%)

Query: 13  SGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANI 72
               L   R + L   +   + +  A   +   P    L+  L  SD N+I   L   N+
Sbjct: 15  GFNKLSIVRQIGLMVGLAASVAIGFAVVLWSQKPEQRVLFSNLTFSDANQIIEQLRLYNV 74

Query: 73  DFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRV 132
            +    +G +I VP   V +AR+ LAA+G  +S    G+E+ D+  S G + FM+     
Sbjct: 75  PYTFDADGRAILVPDEHVHQARLKLAAEGF-TSDKTVGFEILDREQSLGTSQFMETTKYR 133

Query: 133 RALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPSVYKSAEA 190
           R LEGE+ARTI S++ +  ARVH+ +P    F +   +PTASV +              +
Sbjct: 134 RGLEGELARTISSMTSVRNARVHLAIPKDTVFIRDTRKPTASVFLELFSGRKLERDQVAS 193

Query: 191 IRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN--ILGKSLSIVQAIQHEIEMNINKA 248
           I +LVA+++P LD+ DVTV+D  G+LL   + + +  +  K L   ++I+  +   +N  
Sbjct: 194 IANLVASSIPALDVKDVTVVDQRGRLLNMRDKDVDVVLAAKQLEYTRSIEDTLLNRVNSI 253

Query: 249 LAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTV 308
           L   +G+  FR+ V A+++  + +  + +Y+PD    RS +   +++      P      
Sbjct: 254 LQPVVGMGRFRAEVSADVDFTSVEQTDELYNPDLPALRSEQTMDESRVG-NGAPVGIPGA 312

Query: 309 EQNMPHVSDRKVPL--------PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
             N P                       + +K+   N+E++     T H   ++ RL++A
Sbjct: 313 LSNQPPGQSSVPEQASGEGVIAGNGQPGSSRKQATRNFELDRTISYTKHQQGRVRRLTVA 372

Query: 361 VVVNK-GRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VVV+    +    G ++      + L  +  +V  A G ++ RGD++ + +  F   +  
Sbjct: 373 VVVDDLASVNAETGETSRTPWDQNELERLRILVQDAVGFSTLRGDSVNVVNTPFAAEEPI 432

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
            +  + +   +        V+  ++  +  L++ F  L  + R            G  + 
Sbjct: 433 VTEEIPLWKQE----WVMDVMKQVMAAIFVLVLVFGILRPILRNLAAAGTAGNVAGLGAA 488

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
                    +  G    D++   S +  + + + +   ++N          +  M+  + 
Sbjct: 489 GEVSAELEGLEGGDFSADSVTFGSDDGLLPTPNESFDYQLN---------AIRSMVAEDP 539

Query: 540 ERFAKILRKWARSEI 554
            R A+ +++W   + 
Sbjct: 540 ARVAQAVKQWVGDDE 554


>gi|209964124|ref|YP_002297039.1| flagellar MS-ring protein [Rhodospirillum centenum SW]
 gi|209957590|gb|ACI98226.1| flagellar M-ring protein FliF [Rhodospirillum centenum SW]
          Length = 556

 Score =  390 bits (1002), Expect = e-106,   Method: Composition-based stats.
 Identities = 150/550 (27%), Positives = 252/550 (45%), Gaps = 7/550 (1%)

Query: 9   QFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALS 68
            F ++  +LG  R+  +    LV + LF+      +SP    LY  L  +D   I   L 
Sbjct: 8   SFLQTLRNLGAVRLAAIGGATLVIVGLFVYMMSQWSSPGMSLLYSDLTPADGGAIVQQLE 67

Query: 69  EANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQE 128
           +  I ++ S +G+ I VPS  VG+ R+ +A QGLP S  N GYELF++    G TSFMQ 
Sbjct: 68  QQQIPYKASPDGTRIEVPSDQVGRVRMLMAQQGLP-SGGNVGYELFNQPEGLGTTSFMQN 126

Query: 129 ITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVY--K 186
           I ++RALEGE++RT+Q++  + AAR+H+V+P    F +     TASV +R    +    +
Sbjct: 127 IQQLRALEGELSRTVQTLQPVQAARIHLVLPKRELFSRQNQTATASVFVRLRPGASLGKE 186

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT---ANEMERNILGKSLSIVQAIQHEIEM 243
              AI+ LVAAAVP L+   V ++D  G +L     ++ +  +L  +     A +  +  
Sbjct: 187 QVLAIQTLVAAAVPQLEPDMVAIVDDKGNVLARGMGSDSQEAMLATAEEKKLAYEQRLTQ 246

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            +   L+  +G    R+ V AEL+ D       +YDPDS+V RS +   +    +     
Sbjct: 247 TVEDLLSRTVGFGRVRAQVSAELDFDRITTNSEIYDPDSQVVRSTQTVNEQSEDQNRDGI 306

Query: 304 SAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVV 363
             VTV  N+P           S   T + EE  NYEIN        +  ++ RLS+AV+V
Sbjct: 307 DPVTVANNLPTADATNTASGLSSSKTSRAEESINYEINRTVKVHERETGQIRRLSVAVLV 366

Query: 364 NKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGT 423
           +        G S  Q + ++ L ++ ++V +A G ++ RGDT+ + +M F       +G 
Sbjct: 367 DGTYAAAEDGTSTYQPRPEAELDQLRRLVESAIGFDAARGDTVEVVNMRF-ATPDDLAGL 425

Query: 424 VQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPP 483
            + +   +       +   +V  +  +LV  L +  L         +  +          
Sbjct: 426 GEETIFGLPKEDVFRIAQTIVLAIVAILVILLVIKPLVARALDRTPQLEDEPDLLAGGDG 485

Query: 484 PISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFA 543
               A   G      +AL+++  +         +R++  V   S  ++  ++E + E   
Sbjct: 486 VPQLAGPGGGALARELALEAAQANEELEQMIDINRVDGRVRASSLRKVGEIVEKHPEEAV 545

Query: 544 KILRKWARSE 553
            I+R W   E
Sbjct: 546 SIIRNWLYQE 555


>gi|171321708|ref|ZP_02910625.1| flagellar M-ring protein FliF [Burkholderia ambifaria MEX-5]
 gi|171093009|gb|EDT38241.1| flagellar M-ring protein FliF [Burkholderia ambifaria MEX-5]
          Length = 587

 Score =  390 bits (1002), Expect = e-106,   Method: Composition-based stats.
 Identities = 120/528 (22%), Positives = 214/528 (40%), Gaps = 29/528 (5%)

Query: 38  AARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHL 97
           A   +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VPS+ V + R+ L
Sbjct: 76  ALVLWSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPSNQVHETRLKL 135

Query: 98  AAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIV 157
           AA GLP   S  G+EL D    FG++ F +++   RALEGE+ RTI+SI+ +  ARVH+ 
Sbjct: 136 AALGLPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTIESINAVRGARVHLA 193

Query: 158 MPDMGSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
           +P    F +    P+ASV +             +AI  +V++ VP++   +VT++D  G 
Sbjct: 194 IPKPSVFVRDKEAPSASVFVDLYPGRVLDEGQVQAITRMVSSGVPDMPAKNVTIVDQDGN 253

Query: 216 LLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           LLT       +    L  VQ ++   +  I+  LA   G  N RS V A+++    +   
Sbjct: 254 LLTQTASASGLDASQLKYVQQVERNTQKRIDAILAPIFGTGNARSQVSADIDFSKLEQTS 313

Query: 276 IVYDPDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDRKV-------PLPRS 325
             Y P+   +++   S+    +                N P                 +S
Sbjct: 314 ESYAPNGTPQQAAIRSQQTSSATELAQGGASGVPGALSNTPPQPASAPIVAGNGQNGAQS 373

Query: 326 LENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYL 385
              +D+K++ +NYE++            ++RLS+AVVVN   + +  G    Q      L
Sbjct: 374 TPVSDRKDQTTNYELDKTIRHVEQPMGNVKRLSVAVVVNYQPVADAKGHVTMQPLPPPKL 433

Query: 386 AEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVF 445
           A+I ++V  A G + +RGD++ + +  F       +        D+++          + 
Sbjct: 434 AQIEQLVKDAMGYDEKRGDSVNVVNSAFSSVGDPYADLPWWRQPDMIAMAKEAAKWLGIA 493

Query: 446 LVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSN 505
                L       A+RR     +     +             A      P+  +    + 
Sbjct: 494 AAAAALYFMFVRPAMRRAFPPPEPAAPALAAPDDPVALDGLPAPERADEPDPLLLGFENE 553

Query: 506 QDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
           ++                 +++      +   + +  A +++ W   E
Sbjct: 554 KNR---------------YERNLDYARTIARQDPKIVATVVKNWVSDE 586


>gi|161526230|ref|YP_001581242.1| flagellar MS-ring protein [Burkholderia multivorans ATCC 17616]
 gi|189349056|ref|YP_001944684.1| flagellar MS-ring protein [Burkholderia multivorans ATCC 17616]
 gi|160343659|gb|ABX16745.1| flagellar M-ring protein FliF [Burkholderia multivorans ATCC 17616]
 gi|189333078|dbj|BAG42148.1| flagellar M-ring protein [Burkholderia multivorans ATCC 17616]
          Length = 587

 Score =  389 bits (999), Expect = e-106,   Method: Composition-based stats.
 Identities = 121/525 (23%), Positives = 216/525 (41%), Gaps = 29/525 (5%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA 
Sbjct: 79  LWSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPAAQVHETRLKLAAL 138

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D    FG++ F +++   RALEGE+ RTI+SI+ +  ARVH+ +P 
Sbjct: 139 GLPKGGA-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTIESINAVRGARVHLAIPK 196

Query: 161 MGSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV +             +AI  +V++ VP++   +VT++D  G LLT
Sbjct: 197 PSVFVRDREAPSASVFVDLYPGRVLDEGQVQAITRMVSSGVPDMPAKNVTIVDQDGNLLT 256

Query: 219 ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
                  +    L  VQ ++   +  I+  LA   G  N RS V A+++    +     Y
Sbjct: 257 QPASATGLDASQLKYVQQVERNTQKRIDAILAPIFGAGNARSQVSADIDFSKLEQTSESY 316

Query: 279 DPDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDRKV-------PLPRSLEN 328
            P+   +++   S+    S     S          N P                P++   
Sbjct: 317 GPNGSPQQAAIRSQQTSTSTELAQSGASGVPGALSNTPPQPASAPIVAGNGANAPQTTPV 376

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEI 388
           +D+K++ +NYE++            ++RLS+AVVVN   + +  G    Q    + LA+I
Sbjct: 377 SDRKDQTTNYELDKTIRHVEQPMGTVKRLSVAVVVNYQPVADAKGHVTMQPLPPAKLAQI 436

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  A G +++RGD++ + +  F      N+        D+++          +    
Sbjct: 437 EQLVKDAMGYDAKRGDSVNVMNSAFSTATDPNADLPWWRQPDMIALAKEAAKWLGIAAAA 496

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
             L       A+RR     +     +                          L +   + 
Sbjct: 497 AALYFMFVRPAMRRAFPPPEPAAPALALPGEPVVLD---------------GLPAPEPED 541

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
            S    L         +++      +   + +  A +++ W   E
Sbjct: 542 ESDPALLAFENEKNRYERNLDYARTIARQDPKIVATVVKNWVSDE 586


>gi|221215779|ref|ZP_03588738.1| flagellar M-ring protein FliF [Burkholderia multivorans CGD1]
 gi|221164315|gb|EED96802.1| flagellar M-ring protein FliF [Burkholderia multivorans CGD1]
          Length = 587

 Score =  389 bits (999), Expect = e-106,   Method: Composition-based stats.
 Identities = 121/525 (23%), Positives = 217/525 (41%), Gaps = 29/525 (5%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA 
Sbjct: 79  LWSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPAAQVHETRLKLAAL 138

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D    FG++ F +++   RALEGE+ RTI+SI+ +  ARVH+ +P 
Sbjct: 139 GLPKGGA-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTIESINAVRGARVHLAIPK 196

Query: 161 MGSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV +             +AI  +V++ VP++   +VT++D  G LLT
Sbjct: 197 PSVFVRDREAPSASVFVDLYPGRVLDEGQVQAITRMVSSGVPDMPAKNVTIVDQDGNLLT 256

Query: 219 ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
                  +    L  VQ ++   +  I+  LA   G  N RS V A+++    +     Y
Sbjct: 257 QPASATGLDASQLKYVQQVERNTQKRIDAILAPIFGAGNARSQVSADIDFSKLEQTSESY 316

Query: 279 DPDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDRKV-------PLPRSLEN 328
            P+   +++   S+    S     S          N P                P++   
Sbjct: 317 GPNGSPQQAAIRSQQTSTSTELAQSGASGVPGALSNTPPQPASAPIVAGNGANAPQTTPV 376

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEI 388
           +D+K++ +NYE++            ++RLS+AVVVN   + +  G    Q    + LA+I
Sbjct: 377 SDRKDQTTNYELDKTIRHVEQPMGTVKRLSVAVVVNYQPVADAKGHVTMQPLPPAKLAQI 436

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  A G +++RGD++ + +  F      N+        D+++          +    
Sbjct: 437 EQLVKDAMGYDAKRGDSVNVVNSAFSTATDPNADLPWWRQPDMIALAKEAAKWLGIAAAA 496

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
             L       A+RR     +     +                          L +   + 
Sbjct: 497 AALYFMFVRPAMRRAFPPPEPPAPALALPGEPVVLD---------------GLPAPEPED 541

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
            S +  L         +++      +   + +  A +++ W   E
Sbjct: 542 ESDTALLAFENEKNRYERNLDYARTIARQDPKIVATVVKNWVSDE 586


>gi|221201939|ref|ZP_03574976.1| flagellar M-ring protein FliF [Burkholderia multivorans CGD2M]
 gi|221207554|ref|ZP_03580562.1| flagellar M-ring protein FliF [Burkholderia multivorans CGD2]
 gi|221172400|gb|EEE04839.1| flagellar M-ring protein FliF [Burkholderia multivorans CGD2]
 gi|221178359|gb|EEE10769.1| flagellar M-ring protein FliF [Burkholderia multivorans CGD2M]
          Length = 587

 Score =  389 bits (998), Expect = e-106,   Method: Composition-based stats.
 Identities = 121/525 (23%), Positives = 217/525 (41%), Gaps = 29/525 (5%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA 
Sbjct: 79  LWSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPAAQVHETRLKLAAL 138

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D    FG++ F +++   RALEGE+ RTI+SI+ +  ARVH+ +P 
Sbjct: 139 GLPKGGA-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTIESINAVRGARVHLAIPK 196

Query: 161 MGSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV +             +AI  +V++ VP++   +VT++D  G LLT
Sbjct: 197 PSVFVRDREAPSASVFVDLYPGRVLDEGQVQAITRMVSSGVPDMPAKNVTIVDQDGNLLT 256

Query: 219 ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
                  +    L  VQ ++   +  I+  LA   G  N RS V A+++    +     Y
Sbjct: 257 QPASATGLDASQLKYVQQVERNTQKRIDAILAPIFGAGNARSQVSADIDFSKLEQTSESY 316

Query: 279 DPDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDRKV-------PLPRSLEN 328
            P+   +++   S+    S     S          N P                P++   
Sbjct: 317 GPNGSPQQAAIRSQQTSTSTELAQSGASGVPGALSNTPPQPASAPIVAGNGANAPQTTPV 376

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEI 388
           +D+K++ +NYE++            ++RLS+AVVVN   + +  G    Q    + LA+I
Sbjct: 377 SDRKDQTTNYELDKTIRHVEQPMGTVKRLSVAVVVNYQPVADAKGHVTMQPLPPAKLAQI 436

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  A G +++RGD++ + +  F      N+        D+++          +    
Sbjct: 437 EQLVKDAMGYDAKRGDSVNVMNSAFSTATDPNADLPWWRQPDMIALAKEAAKWLGIAAAA 496

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
             L       A+RR     +     +                          L +   + 
Sbjct: 497 AALYFMFVRPAMRRAFPPPEPPAPALALPGEPVVLD---------------GLPAPEPEN 541

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
            S +  L         +++      +   + +  A +++ W   E
Sbjct: 542 ESDTALLAFENEKNRYERNLDYARTIARQDPKIVATVVKNWVSDE 586


>gi|146282929|ref|YP_001173082.1| flagellar MS-ring protein [Pseudomonas stutzeri A1501]
 gi|145571134|gb|ABP80240.1| flagellar M-ring protein [Pseudomonas stutzeri A1501]
          Length = 585

 Score =  389 bits (998), Expect = e-106,   Method: Composition-based stats.
 Identities = 116/585 (19%), Positives = 235/585 (40%), Gaps = 52/585 (8%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F ++ + +   R + L   +   + +  A   +   P Y  L   L   D N++   L
Sbjct: 15  LSFLENLSEMSMLRQIGLLVGLAASVAMGFAVVLWSQQPDYRPLLGSLAGMDANQVMETL 74

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + A+I + +  N  ++ V ++ + +AR+ LA  G+  + SN G+E+ DK    G + FM+
Sbjct: 75  AAADIAYTVEPNSGALLVKANDLARARLKLAGAGIAPADSNIGFEILDKDQGLGTSQFME 134

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN--PSVY 185
                R LEGE+ RTI S++ +  ARVH+ +P    F +   +P+ASV++          
Sbjct: 135 ATRYRRGLEGELGRTISSLNNVKGARVHLAIPKSSVFVRDERKPSASVLVELYPGRALEP 194

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM--ERNILGKSLSIVQAIQHEIEM 243
               AI +LVA +VP L+   +TV+D  G LL+  +   E ++ GK     + ++     
Sbjct: 195 SQVMAIINLVATSVPELNKSQITVVDQKGNLLSDQQELTELSMAGKQFDYSRRMESLYTQ 254

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            ++  L   LG   +++ V A+++    +     ++PD    RS +   + ++S +  P+
Sbjct: 255 RVHNILQPVLGSGRYKAEVSADVDFSAVESTSETFNPDQPALRSEQSVNEQRQS-SLPPQ 313

Query: 304 SAVTVEQNMPHVSDRKVPLPRSL----------------------------------ENT 329
                  N P                                                  
Sbjct: 314 GVPGALSNQPPGPASAPEQANQAAAAAGAVAPGQPLVDANGQQIMDPVTGQPMLAPFPAD 373

Query: 330 DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEIN 389
            +++   NYE++     T   + +L RLS+AVVV+        G           LA   
Sbjct: 374 KREQATRNYELDRSISYTKQQHGRLRRLSVAVVVDDQMSLNAAGEMVRVPWNADDLARFT 433

Query: 390 KIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGT 449
           ++V  A G ++ RGD++++ +  F+ +    +              F  V+  ++ ++  
Sbjct: 434 RLVQDAVGFDASRGDSVSVINTAFVADSFGETFEEIP---FYSQPWFWDVVKQVLGVLFI 490

Query: 450 LLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIF 509
           L++ F  L  + +     +A  G+    + +           G + ND ++L      + 
Sbjct: 491 LVLVFGVLRPVLKSLTNPNA--GKELQVAGMPGELGEDEGLDGGLANDRVSLSGPQNILL 548

Query: 510 SHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                      S   +     + +++  +  R A+++++W  ++ 
Sbjct: 549 PSP--------SEGYEAQLNAIKNLVADDPGRVAQVVKEWINADE 585


>gi|284159411|ref|YP_440758.3| flagellar MS-ring protein [Burkholderia thailandensis E264]
 gi|83653465|gb|ABC37528.1| flagellar M-ring protein FliF [Burkholderia thailandensis E264]
          Length = 677

 Score =  388 bits (996), Expect = e-105,   Method: Composition-based stats.
 Identities = 129/525 (24%), Positives = 219/525 (41%), Gaps = 22/525 (4%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 161 WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 220

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++S++ + AARVH+ +P  
Sbjct: 221 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESVNAVRAARVHLAIPKP 278

Query: 162 GSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++              AI  LV+++VP++   +VT++D  G LLT 
Sbjct: 279 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAITRLVSSSVPDMPAKNVTIVDQDGNLLTQ 338

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 339 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYA 398

Query: 280 PDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDR--------KVPLPRSLEN 328
           P+   ++S   S+    S     S          N P             +   P +   
Sbjct: 399 PNGTPQQSAIRSQQTSTSTELAQSGTSGVPGALSNTPPQPASAPIVASNGQPAAPAATPV 458

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEI 388
           +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q      LA++
Sbjct: 459 SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLTADKLAQV 518

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  A G + +RGD++ + +  F       +        D++           V    
Sbjct: 519 QQLVKDAMGYDEKRGDSVNVVNSAFSAAADPFANLPWWRQPDMIELGKDIAKWLGVAAAA 578

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
             L       ALRR          E          P  +    GL   D   L   +++ 
Sbjct: 579 AALYFMFVRPALRR----AFPPPAEPAAAVPALDGPDDALALDGLPSPDKKQLAEEDEEH 634

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
            +       +      +++      +   + +  A +++ W   E
Sbjct: 635 PALLAFESEK---NRYERNLDYARTIARQDPKIVATVVKNWVSDE 676


>gi|70729030|ref|YP_258764.1| flagellar MS-ring protein [Pseudomonas fluorescens Pf-5]
 gi|68343329|gb|AAY90935.1| flagellar M-ring protein FliF [Pseudomonas fluorescens Pf-5]
          Length = 595

 Score =  388 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 118/586 (20%), Positives = 230/586 (39%), Gaps = 54/586 (9%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  ++   L
Sbjct: 25  LSFLENLSQMTMLRQVGLLVGLAASVAIGFAVVLWSQQPDYRPLYGSLAGMDAKQVMDTL 84

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + A+I + +  N  ++ V +  + +AR+ LAA G+     N G+E+ DK    G + FM+
Sbjct: 85  ASADIPYTVEPNSGALLVKADDLSRARLKLAAAGVAPGDGNVGFEILDKEQGLGTSQFME 144

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPSVY 185
                R LEGE+ARTI S++ +  ARVH+ +P    F +   +P+ASV++          
Sbjct: 145 ATRYRRGLEGELARTISSLNNVKGARVHLAIPKSSVFVRDERKPSASVLVELYSGRSLEP 204

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMER--NILGKSLSIVQAIQHEIEM 243
               AI +LVA +VP L+   VTV+D  G LL+         + GK     + ++  +  
Sbjct: 205 GQVMAIVNLVATSVPELNKSQVTVVDQKGNLLSDQAENSALTMAGKQFDYSRRLEGMLTQ 264

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            ++  L   LG D +++ V A+++    +     ++PD    RS +   + QRS ++ P+
Sbjct: 265 RVHNILQPVLGNDRYKAEVSADVDFSAVESTSEQFNPDQPALRSEQSV-NEQRSSSNGPQ 323

Query: 304 SAVTVEQNMPHVSDRKVPLPRSL----------------------------------ENT 329
                  N P                                                + 
Sbjct: 324 GVPGALSNQPPAPASAPQTTGGATAAAGMVQPGQPLLDANGQQIMDPATGQPMLAPYPSD 383

Query: 330 DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGR-LTEVLGRSADQGKIDSYLAEI 388
            +++   N+E++     T     +L RLS+AVVV+    +    G ++        LA  
Sbjct: 384 KRQQSTKNFELDRSISHTKQQQGRLNRLSVAVVVDDQVKVNPANGETSRAPWSADELARF 443

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  A G ++ RGD++++ ++ F   +      +           F  ++  ++ ++ 
Sbjct: 444 TRLVQDAVGFDASRGDSVSVINVPFSAERGEVIADIPF----YSQPWFWDIVKQVLGVLF 499

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
            L++ F  L  +          K   G                G + ND ++L      +
Sbjct: 500 ILVLVFGVLRPVLNNITGGGKNKELAG--LGSDVELGGMGGLDGELGNDRVSLGGPQSIL 557

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                       S         +  ++  +  R A+++++W  ++ 
Sbjct: 558 LPSP--------SEGYDAQLNAIKSLVAEDPGRVAQVVKEWINADE 595


>gi|292492381|ref|YP_003527820.1| flagellar M-ring protein FliF [Nitrosococcus halophilus Nc4]
 gi|291580976|gb|ADE15433.1| flagellar M-ring protein FliF [Nitrosococcus halophilus Nc4]
          Length = 566

 Score =  388 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 130/561 (23%), Positives = 236/561 (42%), Gaps = 34/561 (6%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           L     +   L   + + L  +I V + L +    +  SP+Y  LY  +   +   I  A
Sbjct: 25  LAVLQANIARLSPLKQVGLLLMIAVSVALGVGIFLWSQSPNYQILYGAVSGKEKGEIVEA 84

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L +ANID+++ +   ++ VP+S V + R+ LA +GLP S+   G+EL ++   FG++ F+
Sbjct: 85  LQKANIDYQLDEATGALMVPASQVHEVRLQLAMEGLPRSAGT-GFELLEQNPGFGVSEFL 143

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP--SV 184
           ++    R LEGE+ARTI +++ + +ARVH+ +P    F +    P+ASV++         
Sbjct: 144 EKARYQRVLEGELARTISTLNNVKSARVHLALPKRSVFIRDRKVPSASVVLDLYPGRMLA 203

Query: 185 YKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMER--NILGKSLSIVQAIQHEIE 242
                AI HLVA+++P L+   VTV++  G LLT  E  +   +        + I+ E  
Sbjct: 204 PGQVAAITHLVASSIPELESAGVTVVNQEGDLLTQPERSQTLEMTASQFEYTRRIEEEYG 263

Query: 243 MNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQP 302
             I + LA  +G D  R+ VVAE++    +  +  Y+P+ +  RS + +++ +      P
Sbjct: 264 HRIQRILAPLVGADKVRAQVVAEVDFTVTEQTQERYEPEKRALRSEQTAEEERIG-GRLP 322

Query: 303 ESAVTVEQNMPHVSDRKVPL----------PRSLENTDKKEEQSNYEINTKSIATTHDNY 352
                   N P    +              P    ++       NYE++           
Sbjct: 323 GGIPGALSNQPPDEAQVPETLNGANEGESQPSEPPSSRSLRATRNYELDRTISHIRLAPG 382

Query: 353 KLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMD 412
            + RLS+AV+V++  +T+  G  +   +    L  I  +V  A G N  RGDTI + +  
Sbjct: 383 DIRRLSVAVLVDEKLVTDAEGNVSTSPRSPQELEHITGLVKEAVGFNPDRGDTINVINAP 442

Query: 413 FLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKG 472
           F+ N+          +       F   +     ++  L +    L    R          
Sbjct: 443 FVPNEELEPLPEPPFWQ---QEWFWVAVKQGGGILAVLFLLLGVLRPTFRRLT------- 492

Query: 473 EVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLL 532
            V     +   P  S      +  D + L S+   +     +          + +  R+ 
Sbjct: 493 TVPEPVTVPSLPKGSDEDKEGLKEDRLTLSSNAPTLQLSGPDSL--------EANLERVR 544

Query: 533 HMIEINEERFAKILRKWARSE 553
            M   + ER A++++ W   +
Sbjct: 545 KMAADDSERVAQVVKNWVSGD 565


>gi|85713555|ref|ZP_01044545.1| flagellar M-ring protein [Nitrobacter sp. Nb-311A]
 gi|85699459|gb|EAQ37326.1| flagellar M-ring protein [Nitrobacter sp. Nb-311A]
          Length = 541

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 140/549 (25%), Positives = 242/549 (44%), Gaps = 13/549 (2%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           +         LG +R++ + +V  V I  F      V +P    L+  L V D + I   
Sbjct: 1   MQGLLAFLKGLGASRLMAMVAVTTVLIAFFAFVIMRVTTPQMTTLFTDLSVEDSSGIIKD 60

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L    I F + ++G+ I VP   V + R+ LA  GLP      GYE+FDK ++ G TSF+
Sbjct: 61  LERQAIPFELRNDGAVIMVPKDKVTRLRMKLAEAGLPKGGG-VGYEIFDKSDALGTTSFV 119

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           Q I R+RALEGE+ARTI++I  I  ARVH+V+P+   F +   +P+AS+++R       +
Sbjct: 120 QNINRLRALEGELARTIRAIDRIQDARVHLVLPERPLFTREAPQPSASIVVRVRGGLEPQ 179

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNIN 246
              AIRHLVA+AV  L    V+++D TG+LL                  A +  +   + 
Sbjct: 180 QIRAIRHLVASAVNGLKPQRVSIVDETGQLLADGSTTDADGVTGDERRTAFEKRMRSQVE 239

Query: 247 KALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAV 306
             +++ +G    R  + A+ + +        +DP+ +V RS +  ++   S T+     V
Sbjct: 240 AIVSSVVGNGRARVQLSADFDYNKITQTSDTFDPEGRVLRSSQTREE--SSLTADNNGQV 297

Query: 307 TVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG 366
           TV   +P       P  ++ + + K EE +NYEI+  +     +  ++ R+S+AV+V+  
Sbjct: 298 TVNNELPGNQPSDNPN-QARDQSKKSEETNNYEISRTTKTEVSEAGRVNRISVAVLVDGT 356

Query: 367 RLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQV 426
              +  G+     +    L  I  +V +A G + +RGD + + ++ F E           
Sbjct: 357 YAKDDKGQMVYTERSKEQLDRIATLVRSAIGFDQKRGDQVEVVNLRFAEPPAIVPLAEPA 416

Query: 427 ---SFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPP 483
                + +        +   V  +  L+V F+ +  L +     +     V   + L  P
Sbjct: 417 GLLGMIALTKDDVMYFVELAVMALLGLVVVFMVIRPLVQRILAAEPAAASVPPAAALPVP 476

Query: 484 PISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFA 543
             ++A  T    N             +      +++   V  QS  R+  + E N    A
Sbjct: 477 ADANAQPTATGQNL------IPGSNATAQLIDVAQVQGQVHAQSVHRVGELAERNPTETA 530

Query: 544 KILRKWARS 552
            I+R+W   
Sbjct: 531 SIIRQWLAE 539


>gi|327481269|gb|AEA84579.1| flagellar MS-ring protein [Pseudomonas stutzeri DSM 4166]
          Length = 594

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 116/585 (19%), Positives = 235/585 (40%), Gaps = 52/585 (8%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F ++ + +   R + L   +   + +  A   +   P Y  L   L   D N++   L
Sbjct: 24  LSFLENLSEMSMLRQIGLLVGLAASVAMGFAVVLWSQQPDYRPLLGSLAGMDANQVMETL 83

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + A+I + +  N  ++ V ++ + +AR+ LA  G+  + SN G+E+ DK    G + FM+
Sbjct: 84  AAADIAYTVEPNSGALLVKANDLARARLKLAGAGIAPADSNIGFEILDKDQGLGTSQFME 143

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN--PSVY 185
                R LEGE+ RTI S++ +  ARVH+ +P    F +   +P+ASV++          
Sbjct: 144 ATRYRRGLEGELGRTISSLNNVKGARVHLAIPKSSVFVRDERKPSASVLVELYPGRALEP 203

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM--ERNILGKSLSIVQAIQHEIEM 243
               AI +LVA +VP L+   +TV+D  G LL+  +   E ++ GK     + ++     
Sbjct: 204 SQVMAIINLVATSVPELNKSQITVVDQKGNLLSDQQELTELSMAGKQFDYSRRMESLYTQ 263

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            ++  L   LG   +++ V A+++    +     ++PD    RS +   + ++S +  P+
Sbjct: 264 RVHNILQPVLGSGRYKAEVSADVDFSAVESTSETFNPDQPALRSEQSVNEQRQS-SLPPQ 322

Query: 304 SAVTVEQNMPHVSDRKVPLPRSL----------------------------------ENT 329
                  N P                                                  
Sbjct: 323 GVPGALSNQPPGPASAPEQANQAAAAAGAVAPGQPLVDANGQQIMDPVTGQPMLAPFPAD 382

Query: 330 DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEIN 389
            +++   NYE++     T   + +L RLS+AVVV+        G           LA   
Sbjct: 383 KREQATRNYELDRSISYTKQQHGRLRRLSVAVVVDDQMSLNAAGEMVRVPWNADDLARFT 442

Query: 390 KIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGT 449
           ++V  A G ++ RGD++++ +  F+ +    +              F  V+  ++ ++  
Sbjct: 443 RLVQDAVGFDASRGDSVSVINTAFVADSFGETFEEIP---FYSQPWFWDVVKQVLGVLFI 499

Query: 450 LLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIF 509
           L++ F  L  + +     +A  G+    + +           G + ND ++L      + 
Sbjct: 500 LVLVFGVLRPVLKSLTNPNA--GKELQVAGMPGELGEDEGLDGGLANDRVSLSGPQNILL 557

Query: 510 SHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                      S   +     + +++  +  R A+++++W  ++ 
Sbjct: 558 PSP--------SEGYEAQLNAIKNLVADDPGRVAQVVKEWINADE 594


>gi|76581502|gb|ABA50977.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 1710b]
          Length = 627

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 128/525 (24%), Positives = 217/525 (41%), Gaps = 21/525 (4%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 110 WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 169

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++SI+ + AARVH+ +P  
Sbjct: 170 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESINAVRAARVHLAIPKP 227

Query: 162 GSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++              A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 228 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 287

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 288 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYG 347

Query: 280 PDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDR--------KVPLPRSLEN 328
           P+   ++S   S+    S     S          N P             +   P +   
Sbjct: 348 PNGTPQQSAIRSQQTSSSTELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 407

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEI 388
           +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q      LA++
Sbjct: 408 SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLAADKLAQV 467

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  A G + +RGD++ + +  F       +        D++           V    
Sbjct: 468 QQLVKDAMGYDEKRGDSVNVVNSAFSAAADPFANLPWWRQPDMIELGKDIAKWLGVAAAA 527

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
             L       ALRR                     P       GL   D   L   +++ 
Sbjct: 528 AALYFMFVRPALRR---AFPPPAEPAAAAVPALDGPDDMLALDGLPSPDKKQLAEEDEEH 584

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
            +       R      +++      +   + +  A +++ W   E
Sbjct: 585 PALLAFENER---NRYERNLDYARTIARQDPKIVATVVKNWVSDE 626


>gi|167813742|ref|ZP_02445422.1| flagellar MS-ring protein [Burkholderia pseudomallei 91]
          Length = 559

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 135/563 (23%), Positives = 228/563 (40%), Gaps = 24/563 (4%)

Query: 7   LLQFFKSGTSLGRTR---ILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           L  F +    L R +    L       + I   +A   +  +P Y  LY  L   D   I
Sbjct: 4   LGGFAERIPGLSRMKTNPRLPFLIGAALAIAAIVALVLWSRAPDYRVLYSNLSDRDGGAI 63

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
             AL +AN+ ++ +D G +I VP++ V + R+ LAA GLP   S  G+EL D    FG++
Sbjct: 64  IAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMGLPKGGS-VGFELMDN-QKFGIS 121

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP- 182
            F +++   RALEGE+ RT++SI+ + AARVH+ +P    F +    P+ASV++      
Sbjct: 122 QFAEQVNYQRALEGELQRTVESINAVRAARVHLAIPKPSVFVRDREAPSASVLVDLYPGR 181

Query: 183 -SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEI 241
                   A+  +V+++VP++   +VT++D  G LLT       +    L  VQ I+   
Sbjct: 182 VLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQTASATGLDASQLKYVQQIERNT 241

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE--- 298
           +  I+  LA   G  N RS V A+++    +     Y P+   ++S   S+    S    
Sbjct: 242 QKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYGPNGTPQQSAIRSQQTSSSTELA 301

Query: 299 TSQPESAVTVEQNMPHVSDR--------KVPLPRSLENTDKKEEQSNYEINTKSIATTHD 350
            S          N P             +   P +   +D+K+  +NYE++         
Sbjct: 302 QSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPVSDRKDSTTNYELDKTVRHVEQS 361

Query: 351 NYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITS 410
              ++RLS+AVVVN    T+  GR   Q      LA++ ++V  A G + +RGD++ + +
Sbjct: 362 MGTIKRLSVAVVVNYQPSTDAKGRVTMQPLAADKLAQVQQLVKDAMGYDEKRGDSVNVVN 421

Query: 411 MDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAK 470
             F       +        D++           V      L       ALRR        
Sbjct: 422 SAFSAAADPFANLPWWRQPDMIELGKDIAKWLGVAAAAAALYFMFVRPALRR---AFPPP 478

Query: 471 KGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLR 530
                        P       GL   D   L   +++  +       R      +++   
Sbjct: 479 AEPAAAAVPALDGPDDMLALDGLPSPDKKQLAEEDEEHPALLAFENER---NRYERNLDY 535

Query: 531 LLHMIEINEERFAKILRKWARSE 553
              +   + +  A +++ W   E
Sbjct: 536 ARTIARQDPKIVATVVKNWVSDE 558


>gi|192359622|ref|YP_001982191.1| flagellar MS-ring protein [Cellvibrio japonicus Ueda107]
 gi|190685787|gb|ACE83465.1| flagellar M-ring protein FliF [Cellvibrio japonicus Ueda107]
          Length = 569

 Score =  386 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 127/560 (22%), Positives = 239/560 (42%), Gaps = 25/560 (4%)

Query: 9   QFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALS 68
            F +  +SL   R + L   +   + +  A   ++    Y  LY +++  D   +   L 
Sbjct: 21  DFLEGFSSLNLLRQIGLIITLAASVAIGFAVVMWMQGDDYRPLYGRMDNLDAANVIDVLD 80

Query: 69  EANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQE 128
           +  I F++  N  +I V +  V  AR+ LA  GLP SS  +G+EL DK    G + F++ 
Sbjct: 81  QHKIKFKMDTNTGAILVAADDVHMARLKLAEFGLP-SSPVAGFELMDKEQPLGTSQFVEN 139

Query: 129 ITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR--AINPSVYK 186
               R++EGE+ARTI SI+ I +ARVH+ MP    F +  A+PTASV +   A       
Sbjct: 140 TRYQRSIEGELARTITSITSIRSARVHLAMPKKTVFVRDAAKPTASVFVEVFAGRTVAPA 199

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNI--LGKSLSIVQAIQHEIEMN 244
             +AI +LVA++VP++ M +VTV+D  G LL+  E   ++    +     + ++  +   
Sbjct: 200 QVKAIMNLVASSVPDMKMENVTVVDQHGSLLSTGEESSDLLLATRQHQYAKEVETSVIQR 259

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPES 304
           IN  L   +G   FR+ V A+++    +     ++PD    RS +   +++         
Sbjct: 260 INSILEPVVGDGKFRAQVNADIDFTAVEQAAETFNPDLPAIRSEQTLNESRTGSEL-AGG 318

Query: 305 AVTVEQNMPHVSDRKVPLP----------RSLENTDKKEEQSNYEINTKSIATTHDNYKL 354
                 N P  +  + P            +     ++++   NYE++     T H    L
Sbjct: 319 IPGALTNQPPGTAAQAPEQIDPATGQPIQQQPPKNNREQATRNYELDRTISYTKHQQGTL 378

Query: 355 ERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFL 414
           +RL++AVVV+   +    G        D+ L  ++ +V  A G ++ RGD++ + +  F 
Sbjct: 379 KRLTVAVVVDDKVVRNAEGVETRVPWTDAELERLSILVRDAVGFSAVRGDSVNVLNSPFS 438

Query: 415 ENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEV 474
                    V+ +      +     I  L  ++  L+V F  L  L +  +   +   + 
Sbjct: 439 GIDASVQTQVEDAMPW-WQQWIMANIKYLAGILVILIVVFGLLRPLFKSLSRTGSSIADE 497

Query: 475 GGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHM 534
                L+    + A     + ++ + L   +  +                ++    +  +
Sbjct: 498 EEARELAALEAAGAGKLDGISDETVTLTGGSAFMLPGPE--------QGYEEQINAIKGL 549

Query: 535 IEINEERFAKILRKWARSEI 554
           I  +  R A++++KW   + 
Sbjct: 550 IADDPGRVAQVVKKWINRDD 569


>gi|167843852|ref|ZP_02469360.1| flagellar MS-ring protein [Burkholderia pseudomallei B7210]
          Length = 565

 Score =  386 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 135/563 (23%), Positives = 228/563 (40%), Gaps = 24/563 (4%)

Query: 7   LLQFFKSGTSLGRTR---ILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           L  F +    L R +    L       + I   +A   +  +P Y  LY  L   D   I
Sbjct: 10  LGGFAERIPGLSRMKTNPRLPFLIGAALAIAAIVALVLWSRAPDYRVLYSNLSDRDGGAI 69

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
             AL +AN+ ++ +D G +I VP++ V + R+ LAA GLP   S  G+EL D    FG++
Sbjct: 70  IAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMGLPKGGS-VGFELMDN-QKFGIS 127

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP- 182
            F +++   RALEGE+ RT++SI+ + AARVH+ +P    F +    P+ASV++      
Sbjct: 128 QFAEQVNYQRALEGELQRTVESINAVRAARVHLAIPKPSVFVRDREAPSASVLVDLYPGR 187

Query: 183 -SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEI 241
                   A+  +V+++VP++   +VT++D  G LLT       +    L  VQ I+   
Sbjct: 188 VLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQTASATGLDASQLKYVQQIERNT 247

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE--- 298
           +  I+  LA   G  N RS V A+++    +     Y P+   ++S   S+    S    
Sbjct: 248 QKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYGPNGTPQQSAIRSQQTSSSTELA 307

Query: 299 TSQPESAVTVEQNMPHVSDR--------KVPLPRSLENTDKKEEQSNYEINTKSIATTHD 350
            S          N P             +   P +   +D+K+  +NYE++         
Sbjct: 308 QSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPVSDRKDSTTNYELDKTVRHVEQS 367

Query: 351 NYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITS 410
              ++RLS+AVVVN    T+  GR   Q      LA++ ++V  A G + +RGD++ + +
Sbjct: 368 MGTIKRLSVAVVVNYQPSTDAKGRVTMQPLAADKLAQVQQLVKDAMGYDEKRGDSVNVVN 427

Query: 411 MDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAK 470
             F       +        D++           V      L       ALRR        
Sbjct: 428 SAFSAAADPFANLPWWRQPDMIELGKDIAKWLGVAAAAAALYFMFVRPALRR---AFPPP 484

Query: 471 KGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLR 530
                        P       GL   D   L   +++  +       R      +++   
Sbjct: 485 AEPAAAAVPALDGPDDMLALDGLPSPDKKQLAEEDEEHPALLAFENER---NRYERNLDY 541

Query: 531 LLHMIEINEERFAKILRKWARSE 553
              +   + +  A +++ W   E
Sbjct: 542 ARTIARQDPKIVATVVKNWVSDE 564


>gi|167568365|ref|ZP_02361239.1| flagellar MS-ring protein [Burkholderia oklahomensis C6786]
          Length = 554

 Score =  386 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 123/525 (23%), Positives = 216/525 (41%), Gaps = 21/525 (4%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G ++ VP++ V + R+ LA+ G
Sbjct: 37  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAVLVPANQVHETRLKLASMG 96

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RTI+SI+ + +ARVH+ +P  
Sbjct: 97  LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTIESINTVRSARVHLAIPKP 154

Query: 162 GSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++              A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 155 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 214

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 215 TASASGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYG 274

Query: 280 PDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDR--------KVPLPRSLEN 328
           P+   +++   S+    +     S          N P             +   P +   
Sbjct: 275 PNGAPQQTAIRSQQTSTATELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 334

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEI 388
           +D+K+  +NYE++            ++RLS+AVVVN     +  GR   Q      LA+I
Sbjct: 335 SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPAADAKGRVTMQPLTAEKLAQI 394

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  A G + +RGD++ + +  F       +        D++           V    
Sbjct: 395 QQLVKDAMGYDEKRGDSVNVVNSAFSTAADPFADLPWWRQPDMIELGKDIAKWLGVAAAA 454

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
             L       ALRR                     P  +    GL   D   L   + + 
Sbjct: 455 AALYFMFVRPALRR---AFPPPAEPAAAAVPALDGPNDAIALDGLPSPDKKQLADEDDEH 511

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
            +       +      +++      +   + +  A +++ W   E
Sbjct: 512 PALLAFESEK---NRYERNLDYARTIARQDPKIVATVVKNWVSDE 553


>gi|224826633|ref|ZP_03699734.1| flagellar M-ring protein FliF [Lutiella nitroferrum 2002]
 gi|224601234|gb|EEG07416.1| flagellar M-ring protein FliF [Lutiella nitroferrum 2002]
          Length = 576

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 130/572 (22%), Positives = 232/572 (40%), Gaps = 33/572 (5%)

Query: 6   QLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISV 65
           ++ +      +L   + ++L + +     + +       +P Y  L+  L   D  +I+ 
Sbjct: 15  RVNEASDRFKALPNNKKILLFAALAAVFSVIVGLLILNRTPDYKVLFANLADRDGGQITA 74

Query: 66  ALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSF 125
           AL + N+ ++I   G  ISVPS  V   R+ LAAQGLP +    G+EL D    FG++ F
Sbjct: 75  ALQQMNVPYQI-GGGGVISVPSDKVYDVRLKLAAQGLPKAGG-VGFELMDN-QKFGISQF 131

Query: 126 MQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVY 185
            +++   RA+EGE+ARTI++I  + +ARVHI +P    F +   +PTASVM+      V 
Sbjct: 132 AEQVNYQRAIEGELARTIEAIGAVESARVHIAIPKQSVFVRDQQQPTASVMLNLYPGRVL 191

Query: 186 K--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG---KSLSIVQAIQHE 240
                  I HLV+++VPNL   +VTV+D  G LL++     N  G   + L  V  I+ +
Sbjct: 192 DGGQISGILHLVSSSVPNLSARNVTVVDQDGNLLSSQSDVNNAAGLDQRQLGYVHQIESD 251

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DAQRS 297
               I   L    G  N R+ V A ++    +     + P+S    S   S+   +   S
Sbjct: 252 FVKRIEGILEPIFGKGNVRAQVTANVDFSEVEQTSETFRPNSTPNPSATRSQQIVEKLGS 311

Query: 298 ETSQPESAVTVEQNMPHVSDRKV---------------PLPRSLENTDKKEEQSNYEINT 342
            ++ P        N P  +                     P       +++  +NYE++ 
Sbjct: 312 GSNLPGGVPGALSNQPPSAASAPLTLPPGAAPGTATLSGQPLGQNGALERQLITNYEVDK 371

Query: 343 KSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRR 402
               T      L+RLS AVVVN   + +  G           + +IN +V    G N+ R
Sbjct: 372 TIQHTKLPKGVLKRLSAAVVVNYRLMPDRNGEVKPTPLTAQEIQQINNLVRETMGYNTER 431

Query: 403 GDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRR 462
           GDT+ + +  F  N    S   +   +D +S +   ++  ++  +  L + F  +  + R
Sbjct: 432 GDTLNVVNAAFAGNAPPASLQEK--VVDYVSSNATDLVKYVLLAIAVLYLLFGVVRPIVR 489

Query: 463 LHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSY 522
                        G +      +   +             +  +            +   
Sbjct: 490 DVLKPAKGDKGQPGAAGEEAGGVPGRLLAVAREEGEAGAAAVEEANLDPRE-----LQRR 544

Query: 523 VSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
               +      +++ +    A+I+++W  S+ 
Sbjct: 545 QYMSNLEAARELVKADPRMAAQIIKEWISSDE 576


>gi|291278937|ref|YP_003495772.1| flagellar M-ring protein FliF [Deferribacter desulfuricans SSM1]
 gi|290753639|dbj|BAI80016.1| flagellar M-ring protein FliF [Deferribacter desulfuricans SSM1]
          Length = 556

 Score =  385 bits (989), Expect = e-105,   Method: Composition-based stats.
 Identities = 130/561 (23%), Positives = 248/561 (44%), Gaps = 18/561 (3%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           MA+ D + QF     SL   + + + +  +   +  +    + N P Y  LY  L   D 
Sbjct: 1   MALKDFINQFKAVFNSLSLIQKVSIVTATVAVFLTIIVLVIWANKPVYKTLYSNLSSDDA 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
            +I   L    I + + DNG +I VP   V + R++LA +GLP S   +G+ELFDK +SF
Sbjct: 61  AKIVEELKANKIPYELKDNGKTILVPEKNVYELRLNLAQKGLP-SGGGAGFELFDK-SSF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F Q +   RAL+GE+ARTI+S+  +  ARVH+ +P    F    + P A+V+++  
Sbjct: 119 GISEFAQNVNYQRALQGELARTIKSLDEVEDARVHLTLPKERIFVSEESSPKATVVLKFR 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN----ILGKSLSIV 234
                  ++ +AI  LVA AV  L + +V V+D+ G+LL+    +      +    L   
Sbjct: 179 NGANISRENIKAIASLVAGAVKGLTIDNVQVVDTKGRLLSEFLSKDYEPLLLTQTQLEYQ 238

Query: 235 QAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDA 294
           + I+  +E  IN  L+  LG DN  + V A+++   + + +  YDP+  V RS +  +  
Sbjct: 239 KHIEKNLESKINSILSRVLGPDNAVAKVTADIDFTKKVVSKEEYDPN-PVLRSQQTVEIE 297

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKL 354
            ++  + P     V  N+   ++       S     K E   N+E+             +
Sbjct: 298 SKNTPNAPGGTPGVSSNLAEPNNI---NNGSNSEYSKAETTQNFEVGKTVTKEEKPIGVV 354

Query: 355 ERLSIAVVVNKGRLTEVLGRSA---DQGKIDSYLAEINKIVSAATGINSRRGDTITITSM 411
           +++++AV++N  ++ +  G+ +           + +I K+V +A GI+  RGD I +T++
Sbjct: 355 KKITVAVLLNDKKVVKEEGKKSKIEYVKWTPEEIEKIKKLVESAAGIDVNRGDRIEVTNI 414

Query: 412 DFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKK 471
            F                        T+   ++ L+  +L  FL +  + +        +
Sbjct: 415 SFDTTHDLEVA--SFYNKQEKMSLIFTIAKYVLALLIVVLFYFLVVRPILKRLETVRETE 472

Query: 472 GEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNL-QSRINSYVSKQSDLR 530
                 +  +    S  ++ G        ++   ++I +         +++  +K    +
Sbjct: 473 EGTFVAAGATGKGESVDISIGEEIKFPKTIEELEKEIENELEESAPVDVDTVKTKVMLKK 532

Query: 531 LLHMIEINEERFAKILRKWAR 551
           L      + E  A +++ W +
Sbjct: 533 LEEAANEDPETIANLIKVWIK 553


>gi|186477678|ref|YP_001859148.1| flagellar MS-ring protein [Burkholderia phymatum STM815]
 gi|184194137|gb|ACC72102.1| flagellar M-ring protein FliF [Burkholderia phymatum STM815]
          Length = 593

 Score =  385 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 133/565 (23%), Positives = 234/565 (41%), Gaps = 29/565 (5%)

Query: 3   ILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNR 62
           +  +      S T +       L   + V I +      +  +P Y  LY  +   D   
Sbjct: 43  LASRFPGLPTSLTQMRGNPRAPLIFAVAVLIAVVAGLVLWSRAPDYKVLYSNVSDQDGGA 102

Query: 63  ISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGL 122
           I  AL +AN+ ++ S+ G +I +P+  V + R+ LA+QGLP S S  G+EL D    FG+
Sbjct: 103 IVAALQQANVPYKFSEAGGAILIPADQVHEMRLRLASQGLPKSGS-VGFELMDN-QKFGI 160

Query: 123 TSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP 182
           + F ++I   RALEGE+ RTI+SIS +  ARVH+ +P    F +    P+ASV++     
Sbjct: 161 SQFAEQINYQRALEGELQRTIESISTVKTARVHLAIPKPTVFVRDREAPSASVLVNLYPG 220

Query: 183 --SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQH 239
                    AI H+VA+AVP++ +  VT++D  G LLT        +    L   Q I+ 
Sbjct: 221 RMLDEGQVVAITHMVASAVPDMSVRGVTIVDQDGNLLTQAGANGAGLDATQLKYRQQIER 280

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE- 298
             +  I+  L    G  N  S+V A+++   Q++    Y P++  +++   S+    +  
Sbjct: 281 NTQQRIDAILGPMFGTGNAHSSVSADIDFSRQELTSEKYAPNNDPQQAAIRSQQTSTATE 340

Query: 299 --TSQPESAVTVEQNMPHVSDRKV--------PLPRSLENTDKKEEQSNYEINTKSIATT 348
              S          N P                   +   +D K+  +NYE++     T 
Sbjct: 341 MSQSGASGVPGALSNQPPQPASAPITASANGASGVTTTPISDHKDSTTNYELSKTVSHTE 400

Query: 349 HDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITI 408
                ++RLS+AVVVN  R+ +  G +  Q      LA+++++V  A G +  RGDT+ +
Sbjct: 401 AAVGGIKRLSVAVVVNYMRVFDAKGHATMQPISADKLAQVDQLVKEAMGYDQARGDTVKV 460

Query: 409 TSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDD 468
            S  F +    ++        D+++ +        + LV   L   +   ALRR      
Sbjct: 461 ISSAFQQIADPDADLPWWRTKDMIAMYKQIATYLGIGLVALFLYFVMVKPALRRAFPPPP 520

Query: 469 AKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSD 528
                +          + +A       +   +L +   D                 +++ 
Sbjct: 521 EAVAALPSPDEPVLDGLPTAAAVAAEEDVEGSLVALESDK-------------AKYERNL 567

Query: 529 LRLLHMIEINEERFAKILRKWARSE 553
                +   + +  A +++ W   E
Sbjct: 568 EYARQIARQDPKIVATVVKSWVSDE 592


>gi|170741410|ref|YP_001770065.1| flagellar MS-ring protein [Methylobacterium sp. 4-46]
 gi|168195684|gb|ACA17631.1| flagellar M-ring protein FliF [Methylobacterium sp. 4-46]
          Length = 572

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 193/571 (33%), Positives = 306/571 (53%), Gaps = 18/571 (3%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M+  +Q  + + +   LG  R+  L  + L   +      ++++ P  + LY  L   DV
Sbjct: 1   MSGREQAERLWNNIIELGARRLAALGIIGLTVFLAVGLGAYYLSRPAQETLYGGLSRDDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
            RI   L +ANI F +S +G+++ VP     +AR+ LA +GLP SS  SGYELF+ + S 
Sbjct: 61  GRIGSVLKDANIPFDVSTDGTAVLVPYGHTAQARMLLAEKGLPQSS-KSGYELFNDLGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQ++ G+ AARVHIV+PD GSFR+    P+ASV++R  
Sbjct: 120 GLTSFMQEVTRVRALEGEIARTIQTMKGVKAARVHIVLPDRGSFRREQQPPSASVVVRTE 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQH 239
                  A+AIRHLVA+A+P +    VTV+ + G LL + +++     GK  ++ + +  
Sbjct: 180 PADDGSGAQAIRHLVASAIPGMKPERVTVIGTDGTLLLSGDDVGNAPTGKMANLEKLVNR 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           EI+ NI + L  +LGV NF  +V A LN D     E +++PD +VERS++ +++ + S+ 
Sbjct: 240 EIQDNIRRTLTPYLGVGNFEVSVAARLNTDKTSTNETIFNPDQRVERSVKATRETENSQN 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
              +   T +QN+P    R      S   T K+E+ +NYEI++K+I T  D Y ++++S+
Sbjct: 300 RSSQRPTTAQQNLPDQRTRSDGNDTSSTETQKREDLTNYEISSKTIQTVSDGYGIKQISV 359

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AV+VNK RL+ + G +A    ID  + EI ++V++A G +  RGD + + ++ F+ +   
Sbjct: 360 AVLVNKSRLSSLAGPNAPPAAIDQQIGEIEQLVASAAGFSKERGDHVKVAAVGFVNDGAP 419

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
                 +S  ++L R  AT+INA   LV   L+ + GL    R      A + E+   + 
Sbjct: 420 LEPVPPLSLTEVLMRQSATLINAATILVVASLLIWFGLRPALRAILEVPAAEQEIAALAA 479

Query: 480 LSPPPISSAVTTGLMPNDNIAL----------------DSSNQDIFSHSRNLQSRINSYV 523
                   A+      +    L                    Q       +L   + + +
Sbjct: 480 EGAAGAVPALPGAEAGSAAAGLLEGSPEAAALAAAGGTPGPAQLGPPVMASLIDDLTNRM 539

Query: 524 SKQSDLRLLHMIEINEERFAKILRKWARSEI 554
           +     +L  MIE +EE+ A IL++W   E 
Sbjct: 540 NSSPQKKLEQMIEFDEEQAANILKRWLMREE 570


>gi|288942636|ref|YP_003444876.1| flagellar M-ring protein FliF [Allochromatium vinosum DSM 180]
 gi|288898008|gb|ADC63844.1| flagellar M-ring protein FliF [Allochromatium vinosum DSM 180]
          Length = 577

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 114/552 (20%), Positives = 220/552 (39%), Gaps = 19/552 (3%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +S   +   R + L   +   ++  +A  F+   P Y  L+ +LE ++   +  AL++ 
Sbjct: 33  LQSFREMPVGRQIALLGTLAGGLVAVVAILFWALKPTYVPLFSQLEGAEAAEVMEALTQL 92

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
            + +R+ ++   I +P   V + R+ LA QGLP S ++ G+EL  + + FG +  ++   
Sbjct: 93  GVPYRVDNSSGRIEIPQQRVAETRLQLAGQGLPKS-ADIGFELLQQESGFGTSRLIEGAR 151

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP--SVYKSA 188
             RALEGE+ R+I ++  +  ARVHI   +   F +    P+ASV++             
Sbjct: 152 FQRALEGELGRSIAALEPVDKARVHIARAERSVFVRERVPPSASVVVHLKGSRGLTDTQV 211

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEME--RNILGKSLSIVQAIQHEIEMNIN 246
            AI HLV+++VP L    VTV+D +G+LLT++  +    +    L     ++      + 
Sbjct: 212 GAIVHLVSSSVPELTPDRVTVVDQSGRLLTSDGEDKSSRLSLDHLEYTHRVESRYVDRVQ 271

Query: 247 KALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAV 306
             L   +G D  R  V A+L+    +  +  YDPD    RS +L+++ +           
Sbjct: 272 SLLVPIVGRDRVRVQVSADLDFSRVERTQESYDPDKTAIRSEQLNEEERIGADPLAGGIP 331

Query: 307 TVEQNMPHV-----SDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAV 361
               N P         +      ++ ++  ++   NYE++            + RL+ AV
Sbjct: 332 GALTNQPPAGGVVGQQQAAQGNATVPSSRSQQTTRNYEVDRTISHIQETPGGVRRLTAAV 391

Query: 362 VVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNS 421
           VV+        G      + D+ +  +  +V  A G N  RGD++ + S  F+     + 
Sbjct: 392 VVDYVDQVNEAGEPIRVPRSDAEMETLRDLVREAIGFNEARGDSLQVRSASFVPESDEDE 451

Query: 422 GTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILS 481
             +               +  +  + G LL   + L  ++   N    K  E        
Sbjct: 452 EPIWTQPW---------FLELVKIVGGLLLALIVMLTVVKPALNQILPKPPEPEKPQEDE 502

Query: 482 PPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEER 541
                +    G    +      S     S    L         +     +  M+  + +R
Sbjct: 503 ETRALTDGIEGEGEGEEGEEIVSLTHEPSGLAALMGPKGPDRQQLDLEAVREMVREDPKR 562

Query: 542 FAKILRKWARSE 553
             +++++W   +
Sbjct: 563 VVQVMKQWLAED 574


>gi|229591853|ref|YP_002873972.1| flagellar MS-ring protein [Pseudomonas fluorescens SBW25]
 gi|229363719|emb|CAY51114.1| flagellar M-ring protein [Pseudomonas fluorescens SBW25]
          Length = 593

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 116/586 (19%), Positives = 225/586 (38%), Gaps = 53/586 (9%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  +I   L
Sbjct: 22  LSFLENLSEMTMLRQVGLMVGLAASVAIGFAVVLWSQQPDYRPLYGSLAGMDSKQIMETL 81

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + A+I + +  N  ++ V +  V +AR+ LAA G+  S SN G+E+ DK    G + FM+
Sbjct: 82  AAADIAYTVEPNSGALLVKADDVARARMKLAAAGVTPSDSNIGFEILDKDQGLGTSQFME 141

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPSVY 185
                R LEGE+ARTI S++ +  ARVH+ +P    F +   +P+ASV++          
Sbjct: 142 ATRYRRGLEGELARTISSLNNVKGARVHLAIPKSSVFVRDERKPSASVLVELFSGRSLEP 201

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNI--LGKSLSIVQAIQHEIEM 243
               AI +LVA +VP L    +TV+D  G LL+       +   GK     + ++  +  
Sbjct: 202 GQVLAIVNLVATSVPELSKSQITVVDQKGNLLSDQGENSALTQAGKQFDYSRRVESMLTQ 261

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            ++  L   LG D +++ V A+++    +     ++PD    RS + + + + +    P+
Sbjct: 262 RVHNILQPVLGNDRYKAEVSADVDFSAVESTSEQFNPDQPALRSEQSTSEQRTAANGPPQ 321

Query: 304 SAVTVEQNMPHVSDRKVPLPRSL----------------------------------ENT 329
                  N P                                                  
Sbjct: 322 GVPGALSNQPPAPASAPQTTGGAAATAGAIQPGQPLLDANGQQIMDPATGQPMLAPYPAD 381

Query: 330 DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEV-LGRSADQGKIDSYLAEI 388
            + +   N+E++     T     ++ RLS++VVV+         G           LA  
Sbjct: 382 KRNQSTKNFELDRSISHTKQQQGRVNRLSVSVVVDDQVKVNAADGAVTRAPWSADELARF 441

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  A G ++ RGD++++ +M F   +                  F  ++  ++ ++ 
Sbjct: 442 TRLVQDAVGFDASRGDSVSVINMPFSAERGEVIAEPAF----YSQPWFWDIVKQVLGVLF 497

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
            L++ F  L  +      +  K  ++                 G + ND ++L      +
Sbjct: 498 ILVLVFGVLRPVLNNITGNGKK--QLAAFGGSDVELGGMGGLDGELANDRVSLGGPQSIL 555

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                       S         +  ++  +  R A+++++W  ++ 
Sbjct: 556 LPSP--------SEGYDAQLNAIKSLVAEDPGRVAQVVKEWINADE 593


>gi|330818622|ref|YP_004362327.1| Flagellar M-ring protein FliF [Burkholderia gladioli BSR3]
 gi|327371015|gb|AEA62371.1| Flagellar M-ring protein FliF [Burkholderia gladioli BSR3]
          Length = 599

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 120/524 (22%), Positives = 213/524 (40%), Gaps = 23/524 (4%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL ++NI ++ +D G +I VP+S+V + R+ LA+ G
Sbjct: 86  WSRAPDYKVLYSNLSDRDGGAIIAALQQSNIPYQFTDAGGAILVPASLVHETRLKLASMG 145

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RTI SI+ + AARVH+ +P  
Sbjct: 146 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELERTIASINAVRAARVHLAIPKP 203

Query: 162 GSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV +              AI  +VA+ VP++   +VT++D  G LL+ 
Sbjct: 204 SVFVREREAPSASVFVDLYPGRVLDDGQVLAITRMVASGVPDMPAKNVTIVDQDGNLLSQ 263

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
            +    +    L  VQ ++   +  I+  LA   G  N R+ V A+++    +     + 
Sbjct: 264 QQSAAGLDANQLKYVQQVERNTQKRIDAILAPMFGAGNTRAQVSADVDFSRAEQTSESFS 323

Query: 280 PDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDRKV-------PLPRSLENT 329
           P+   +++   S+    S     S          N P                      +
Sbjct: 324 PNGTQQQAAIRSQQTSSSTEMSQSGAGGVPGALSNTPPQPASAPITGASGAAGTPPTPIS 383

Query: 330 DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEIN 389
           D+K+  +NYE+N            ++RLS+AVVVN   + +  G    Q      L ++ 
Sbjct: 384 DRKDSTTNYELNKTVSHVEQATGGIKRLSVAVVVNNLPVADAKGHVTMQPLSADKLRQVE 443

Query: 390 KIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGT 449
           ++V  A G +++RGD++ + +  F E     +        D+++          + +   
Sbjct: 444 QLVKDAMGFDAKRGDSVNVVNSQFTELADPLANVPWWRTPDMIAMAKDIAKWLGIGVAAA 503

Query: 450 LLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIF 509
            L       A+RR     +      G       P          +        S      
Sbjct: 504 ALYFMFVRPAMRRAFPPPEPAAASAGALPGPDEPA---------LDGLPALESSLGAQAS 554

Query: 510 SHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
             +  L    +    +++      +   + +  A +++ W   E
Sbjct: 555 PEAALLSFEADKQRYERNLDYAKMIARQDPKIVATVVKNWVTDE 598


>gi|83647861|ref|YP_436296.1| flagellar MS-ring protein [Hahella chejuensis KCTC 2396]
 gi|83635904|gb|ABC31871.1| flagellar M-ring protein FliF [Hahella chejuensis KCTC 2396]
          Length = 572

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 127/568 (22%), Positives = 236/568 (41%), Gaps = 29/568 (5%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
            +++           L   R L+L   +   I +  A   + N P Y  LY  + V D  
Sbjct: 19  DLVENRSDMMLGFNRLSLLRQLVLMVGVAASIAMGAAIILWANEPAYQPLYPDMSVYDST 78

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
            +S  LS+ NI F++     ++ V +  V  AR+ LAA G+ +     GYEL DK    G
Sbjct: 79  EVSDILSQNNIHFKVEPKSGALLVAAEDVSAARMRLAAAGV-TQDRTIGYELLDKDQGLG 137

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
            + FM+     R LEGE+ARTI S+  +  ARVH+ +P    F +   RP+ASV++    
Sbjct: 138 SSQFMESTRYRRGLEGELARTISSLRNVKNARVHLAIPKQSVFVRDKRRPSASVLVELTG 197

Query: 182 PSVY--KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE--MERNILGKSLSIVQAI 237
                    EAI +LVA +VP +D  DVTV+D  G LL+ N    +     +     + +
Sbjct: 198 SRSLHQDQVEAIVNLVAGSVPEMDHRDVTVVDQRGNLLSQNNLTEDDLRTSREFQYARRM 257

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRS 297
           +  +   +N  L   LG   FR+ V A+++    +  +  ++PD +  RS +   + + +
Sbjct: 258 EEVLTGRVNSILEPILGPGRFRAEVSADVDFTAVEQAQETFNPDPQAVRSEQEIGEQRIA 317

Query: 298 ETSQPESAVTVEQNMPHVSDRKVPLPRSLE-----------NTDKKEEQSNYEINTKSIA 346
            +   +       N P                            +K+   NYE++     
Sbjct: 318 GS--NQGVPGALSNQPPGVAAVPEQAGVAGAAANATANSQATDIRKQTVRNYEVDRTVSY 375

Query: 347 TTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTI 406
           T     K++RL++AVVV+  R     G    +   ++ L  +  +V  A G ++ RGD++
Sbjct: 376 TKQHQGKVQRLTVAVVVDDLRRVGADGAVTTEAWPEAELQRLTVLVRDAVGYSAARGDSV 435

Query: 407 TITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNI 466
            + +  F+  ++  S      +          +I   V  +  L++ F  +    +  + 
Sbjct: 436 NVINTPFMAEEVEISDYEAPLWE---QPWIRELIKWGVAFLIVLILVFGVIRPTFKNLSS 492

Query: 467 DDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQ 526
             A    +             ++ +G+   +++ L+++   +   S        S   ++
Sbjct: 493 GGADAKNLALAGDEDGLAELESLGSGVGEGESVGLNAAGDFLLPGS--------SEGYEK 544

Query: 527 SDLRLLHMIEINEERFAKILRKWARSEI 554
               L  +I  +  R A+++R+W  ++ 
Sbjct: 545 KINALKGLIAEDPGRVAQVVRQWVMADE 572


>gi|167909065|ref|ZP_02496156.1| flagellar MS-ring protein [Burkholderia pseudomallei 112]
          Length = 573

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 128/525 (24%), Positives = 217/525 (41%), Gaps = 21/525 (4%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 56  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 115

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++SI+ + AARVH+ +P  
Sbjct: 116 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESINAVRAARVHLAIPKP 173

Query: 162 GSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++              A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 174 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 233

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 234 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYG 293

Query: 280 PDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDR--------KVPLPRSLEN 328
           P+   ++S   S+    S     S          N P             +   P +   
Sbjct: 294 PNGTPQQSAIRSQQTSSSTELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 353

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEI 388
           +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q      LA++
Sbjct: 354 SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLAADKLAQV 413

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  A G + +RGD++ + +  F       +        D++           V    
Sbjct: 414 QQLVKDAMGYDEKRGDSVNVVNSAFSAAADPFANLPWWRQPDMIELGKDIAKWLGVAAAA 473

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
             L       ALRR                     P       GL   D   L   +++ 
Sbjct: 474 AALYFMFVRPALRR---AFPPPAEPAAAAVPALDGPDDMLALDGLPSPDKKQLAEEDEEH 530

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
            +       R      +++      +   + +  A +++ W   E
Sbjct: 531 PALLAFENER---NRYERNLDYARTIARQDPKIVATVVKNWVSDE 572


>gi|34498591|ref|NP_902806.1| flagellar M-ring protein [Chromobacterium violaceum ATCC 12472]
 gi|34104445|gb|AAQ60803.1| flagellar M-ring protein [Chromobacterium violaceum ATCC 12472]
          Length = 579

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 129/572 (22%), Positives = 240/572 (41%), Gaps = 31/572 (5%)

Query: 6   QLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISV 65
           +L +      +L   R ++  + +     + + A     +P Y  L+  L   D  +++ 
Sbjct: 16  RLNEAGDRFKALPNNRKILFLTALAAIFAVVVGAVLLNRTPSYKILFSNLADRDGGQVTA 75

Query: 66  ALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSF 125
           AL + N+ +++   G  ISVP+  V   R+ LAAQGLP +S   G+EL D    FG++ F
Sbjct: 76  ALQQMNVPYQL-GEGGVISVPADKVYDVRLKLAAQGLPKASG-VGFELMDN-QKFGISQF 132

Query: 126 MQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVY 185
            +++   R++EGE+ARTI++IS + +ARVHI  P    F +    PTASVM++     + 
Sbjct: 133 AEQVNYQRSIEGELARTIEAISSVQSARVHIATPKQSVFVREQQSPTASVMLQLYPGRML 192

Query: 186 K--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTAN---EMERNILGKSLSIVQAIQHE 240
                  I HLV+++VPNL + +VT++D  G LL+     +    +  + L  V+ I+  
Sbjct: 193 DGGQVAGILHLVSSSVPNLPLKNVTIVDQDGNLLSKQAGPDENSGLDQRQLGFVRQIEEG 252

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQR---S 297
               I   L    G  N R+ V A ++    +     Y P+S    S   S+       +
Sbjct: 253 YVKRIEDILEPIFGRGNARAQVTANVDFSETEQTSETYRPNSSPNPSATRSQQISEKLVN 312

Query: 298 ETSQPESAVTVEQNMPHVSDRKV---------------PLPRSLENTDKKEEQSNYEINT 342
            ++ P        N P  +                       S   T +++  +NYE++ 
Sbjct: 313 GSANPTGVPGALSNQPPSAASAPITLPPGAAPGTANLSGGSVSASGTLQRDITTNYEVDK 372

Query: 343 KSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRR 402
               T      ++RLS AVVVN  R+ +  G           + +IN +V  A G NS R
Sbjct: 373 TIQHTKVPTGVVKRLSAAVVVNYRRMPDKSGEMKPTPLTPQEVQQINNLVKEAMGYNSGR 432

Query: 403 GDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRR 462
           GDT+ + +  F +N    +       +D +S +  +++   +  +  L + F  +  + R
Sbjct: 433 GDTLNVVNAAFADNAQPVTMQE--RVIDYVSGNGTSLVKYGLLGIAVLYLLFGVVRPIMR 490

Query: 463 LHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSY 522
                 A      G++  +          G+   +     ++             +    
Sbjct: 491 DLVRPPAPAPGAEGEAAAAGAAGPGGRLLGVAGEEGEPGVAAAMAGGGEDPREAQK---R 547

Query: 523 VSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
               +   +  +++ +    A+I+++W  ++ 
Sbjct: 548 QYSSNLEAVRELVKSDPRMAAQIIKEWISADE 579


>gi|126441455|ref|YP_001057275.1| flagellar MS-ring protein [Burkholderia pseudomallei 668]
 gi|217425051|ref|ZP_03456547.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 576]
 gi|254295774|ref|ZP_04963231.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 406e]
 gi|126220948|gb|ABN84454.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 668]
 gi|157805913|gb|EDO83083.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 406e]
 gi|217392071|gb|EEC32097.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 576]
          Length = 598

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 128/525 (24%), Positives = 217/525 (41%), Gaps = 21/525 (4%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 81  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 140

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++SI+ + AARVH+ +P  
Sbjct: 141 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESINAVRAARVHLAIPKP 198

Query: 162 GSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++              A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 199 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 258

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 259 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYG 318

Query: 280 PDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDR--------KVPLPRSLEN 328
           P+   ++S   S+    S     S          N P             +   P +   
Sbjct: 319 PNGTPQQSAIRSQQTSSSTELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 378

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEI 388
           +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q      LA++
Sbjct: 379 SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLAADKLAQV 438

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  A G + +RGD++ + +  F       +        D++           V    
Sbjct: 439 QQLVKDAMGYDEKRGDSVNVVNSAFSAAADPFANLPWWRQPDMIELGKDIAKWLGVAAAA 498

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
             L       ALRR                     P       GL   D   L   +++ 
Sbjct: 499 AALYFMFVRPALRR---AFPPPAEPAAAAVPALDGPDDVLALDGLPSPDKKQLAEEDEEH 555

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
            +       R      +++      +   + +  A +++ W   E
Sbjct: 556 PALLAFENER---NRYERNLDYARTIARQDPKIVATVVKNWVSDE 597


>gi|304312787|ref|YP_003812385.1| Flagellar basal-body M-ring protein [gamma proteobacterium HdN1]
 gi|301798520|emb|CBL46750.1| Flagellar basal-body M-ring protein [gamma proteobacterium HdN1]
          Length = 575

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 111/567 (19%), Positives = 227/567 (40%), Gaps = 33/567 (5%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           + ++       +L   R + L   +   + +      +   P +  L+  + + + ++++
Sbjct: 20  NPIMAALDGLGNLPWLRQVGLMVGLAASVAIGFGVVLWSTEPEFRPLFTDVSMIEASQVA 79

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L+   I F++      + V +  +  AR+ LA +GLP   +N GYEL DK   FG + 
Sbjct: 80  DVLAREKIQFKVDPASGLVMVRAEKINDARMALAKEGLP-GGNNMGYELLDKEQGFGTSQ 138

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV 184
           FM++    R++EGE+A+TI S++ +  ARVH+ +P    F     +PTASV +       
Sbjct: 139 FMEKTRYFRSIEGELAKTISSLTPVRNARVHLAIPKRSVFINDKRKPTASVFVELYPSRS 198

Query: 185 YK--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNI--LGKSLSIVQAIQHE 240
            +     AI HLVA++VP +   DVTV+D  G+LL+ +     +    + L     I+ +
Sbjct: 199 LERDQVAAIVHLVASSVPEMSSKDVTVVDQRGRLLSEDTSNGEMTIAARQLDYQHNIEEK 258

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
               I   L   LG + F+  + A+++ +  +     Y+PD    RS +    +++S  +
Sbjct: 259 YLGRIRDLLEPLLGPERFKVQLTADIDFNVVEQTAESYNPDLPALRSEQTL--SEKSSAA 316

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLEN-----------TDKKEEQSNYEINTKSIATTH 349
            P        N P  +           N             +++   NYE++     T  
Sbjct: 317 GPMGVPGALSNQPPGAASVPEQATGSNNAGNNASSTDAGNQRQQATRNYELDRTISHTRR 376

Query: 350 DNYKLERLSIAVVVNKGRLTEVLG-----RSADQGKIDSYLAEINKIVSAATGINSRRGD 404
               ++RLS+AVV++              +       ++ L  I  ++  A G ++ RGD
Sbjct: 377 QVGGIKRLSVAVVLDDKWQNPAADAAPGTQPTRVALSEAELERITLLIKDAVGYDAARGD 436

Query: 405 TITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLH 464
           ++++ +  F   Q  +   + +         F  VI  +   +  +++ F  L  + +  
Sbjct: 437 SVSVINQPFSPVQFDSIPDLPIW----QQAWFQDVIRQVAGWLVVIILIFGVLRPILKGL 492

Query: 465 NIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVS 524
                   +     + S    + A         + +   ++        N          
Sbjct: 493 ------AFQGKEDEVDSSLESALASVGADGSLGDSSFAGADVTFSGSGPNPLLPGPDASF 546

Query: 525 KQSDLRLLHMIEINEERFAKILRKWAR 551
           +Q    +  ++  +  R A++++ W  
Sbjct: 547 EQHIDAIRALVAEDPRRVAQVVKSWIE 573


>gi|53717872|ref|YP_106858.1| flagellar MS-ring protein [Burkholderia pseudomallei K96243]
 gi|126453288|ref|YP_001064517.1| flagellar MS-ring protein [Burkholderia pseudomallei 1106a]
 gi|134283661|ref|ZP_01770360.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 305]
 gi|162210024|ref|YP_331831.2| flagellar MS-ring protein [Burkholderia pseudomallei 1710b]
 gi|226199798|ref|ZP_03795349.1| flagellar M-ring protein FliF [Burkholderia pseudomallei Pakistan
           9]
 gi|242317746|ref|ZP_04816762.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 1106b]
 gi|254182183|ref|ZP_04888780.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 1655]
 gi|254188113|ref|ZP_04894625.1| flagellar M-ring protein FliF [Burkholderia pseudomallei Pasteur
           52237]
 gi|254196619|ref|ZP_04903043.1| flagellar M-ring protein FliF [Burkholderia pseudomallei S13]
 gi|254259466|ref|ZP_04950520.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 1710a]
 gi|52208286|emb|CAH34218.1| flagellar M-ring protein [Burkholderia pseudomallei K96243]
 gi|126226930|gb|ABN90470.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 1106a]
 gi|134245070|gb|EBA45165.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 305]
 gi|157935793|gb|EDO91463.1| flagellar M-ring protein FliF [Burkholderia pseudomallei Pasteur
           52237]
 gi|169653362|gb|EDS86055.1| flagellar M-ring protein FliF [Burkholderia pseudomallei S13]
 gi|184212721|gb|EDU09764.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 1655]
 gi|225928149|gb|EEH24185.1| flagellar M-ring protein FliF [Burkholderia pseudomallei Pakistan
           9]
 gi|242140985|gb|EES27387.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 1106b]
 gi|254218155|gb|EET07539.1| flagellar M-ring protein FliF [Burkholderia pseudomallei 1710a]
          Length = 598

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 128/525 (24%), Positives = 217/525 (41%), Gaps = 21/525 (4%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 81  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 140

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++SI+ + AARVH+ +P  
Sbjct: 141 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESINAVRAARVHLAIPKP 198

Query: 162 GSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++              A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 199 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 258

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 259 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYG 318

Query: 280 PDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDR--------KVPLPRSLEN 328
           P+   ++S   S+    S     S          N P             +   P +   
Sbjct: 319 PNGTPQQSAIRSQQTSSSTELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 378

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEI 388
           +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q      LA++
Sbjct: 379 SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLAADKLAQV 438

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  A G + +RGD++ + +  F       +        D++           V    
Sbjct: 439 QQLVKDAMGYDEKRGDSVNVVNSAFSAAADPFANLPWWRQPDMIELGKDIAKWLGVAAAA 498

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
             L       ALRR                     P       GL   D   L   +++ 
Sbjct: 499 AALYFMFVRPALRR---AFPPPAEPAAAAVPALDGPDDMLALDGLPSPDKKQLAEEDEEH 555

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
            +       R      +++      +   + +  A +++ W   E
Sbjct: 556 PALLAFENER---NRYERNLDYARTIARQDPKIVATVVKNWVSDE 597


>gi|15964399|ref|NP_384752.1| flagellar MS-ring protein [Sinorhizobium meliloti 1021]
 gi|307311541|ref|ZP_07591182.1| flagellar M-ring protein FliF [Sinorhizobium meliloti BL225C]
 gi|307318896|ref|ZP_07598327.1| flagellar M-ring protein FliF [Sinorhizobium meliloti AK83]
 gi|17380368|sp|O54239|FLIF_RHIME RecName: Full=Flagellar M-ring protein
 gi|15073576|emb|CAC45218.1| Flagellar M-ring transmembrane protein [Sinorhizobium meliloti
           1021]
 gi|306895310|gb|EFN26065.1| flagellar M-ring protein FliF [Sinorhizobium meliloti AK83]
 gi|306899558|gb|EFN30187.1| flagellar M-ring protein FliF [Sinorhizobium meliloti BL225C]
          Length = 557

 Score =  382 bits (980), Expect = e-104,   Method: Composition-based stats.
 Identities = 269/552 (48%), Positives = 358/552 (64%), Gaps = 4/552 (0%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M + DQ   F K+ ++LG+ +++ LA   +V I   + A  +VN P ++ LYV LE SDV
Sbjct: 1   MNLFDQFSTFTKNLSNLGQGKLIALAVAGVVAIGFVLGAGIYVNRPSFETLYVGLERSDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
            +IS+AL+EAN+DF +  +G SI VP  M GKAR+ LA +GLP SS+N+GYELFD V S 
Sbjct: 61  TQISIALAEANVDFEVGTDGGSIQVPVGMTGKARLLLAERGLP-SSANAGYELFDNVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQ ISGI AARVHIVMP+ GSFRK    PTASVMIRA 
Sbjct: 120 GLTSFMQEVTRVRALEGEIARTIQQISGIAAARVHIVMPERGSFRKAEQTPTASVMIRAS 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKS-LSIVQAIQH 239
                 +A +IRHLVA++VP LD+ DVTVLDSTG+LL + +   N      L +VQ +Q 
Sbjct: 180 ATVGRSAASSIRHLVASSVPGLDVDDVTVLDSTGQLLASGDDPSNSALNQSLGVVQNVQS 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           ++E  I+ ALA FLG+DNFR++V A LN D QQI+E V+DP+S+VERS R+ K+ Q+S  
Sbjct: 240 DLEKKIDNALAPFLGMDNFRTSVTARLNTDAQQIQETVFDPESRVERSTRVIKEEQKSSQ 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
            QP++A TV+QN+P  + R     +S +  +KKEEQ+NYEIN+K+IAT  ++Y +ERLSI
Sbjct: 300 QQPDNAATVQQNVPQAAPRGGAGQQSSDEAEKKEEQTNYEINSKTIATVKNSYSIERLSI 359

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AVVVN+GRL  + G  ADQ KID+YL E+ KIVS+A GI+  RGD +T+ +MDF+E QL 
Sbjct: 360 AVVVNRGRLAAMAGEPADQAKIDAYLQEMQKIVSSAAGIDPGRGDVVTLNAMDFVETQLL 419

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
           +        M++L+R+   +INAL F+    LV + G+  L R            G  + 
Sbjct: 420 DQAVPGPGIMEMLTRNLGGIINALAFVAVAFLVVWFGMRPLARQLGFGGQAGKLEGEAAG 479

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSH--SRNLQSRINSYVSKQSDLRLLHMIEI 537
           L  P  S A                  D      +   ++  N  V +  + RL  M+EI
Sbjct: 480 LELPDFSPAGAGAGGALMEGFGSDFGFDGGDDLLNLGDEAGFNRRVKEGPERRLARMVEI 539

Query: 538 NEERFAKILRKW 549
           +EER AKILRKW
Sbjct: 540 SEERAAKILRKW 551


>gi|237810412|ref|YP_002894863.1| flagellar M-ring protein FliF [Burkholderia pseudomallei MSHR346]
 gi|237505247|gb|ACQ97565.1| flagellar M-ring protein FliF [Burkholderia pseudomallei MSHR346]
          Length = 598

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 128/525 (24%), Positives = 217/525 (41%), Gaps = 21/525 (4%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 81  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 140

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++SI+ + AARVH+ +P  
Sbjct: 141 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESINAVRAARVHLAIPKP 198

Query: 162 GSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++              A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 199 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 258

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 259 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYG 318

Query: 280 PDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDR--------KVPLPRSLEN 328
           P+   ++S   S+    S     S          N P             +   P +   
Sbjct: 319 PNGTPQQSAIRSQQTSSSTELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 378

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEI 388
           +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q      LA++
Sbjct: 379 SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLAADKLAQV 438

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  A G + +RGD++ + +  F       +        D++           V    
Sbjct: 439 QQLVKDAMGYDEKRGDSVNVVNSAFSAAADPFANLPWWRQPDMIELGKDIAKWLGVAAAA 498

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
             L       ALRR                     P       GL   D   L   +++ 
Sbjct: 499 AALYFMFVRPALRR---AFPPPAEPAAAAVPALDGPDDVLALDGLPSPDKNQLAEEDEEH 555

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
            +       R      +++      +   + +  A +++ W   E
Sbjct: 556 PALLAFENER---NRYERNLDYARTIARQDPKIVATVVKNWVSDE 597


>gi|167617536|ref|ZP_02386167.1| flagellar MS-ring protein [Burkholderia thailandensis Bt4]
          Length = 594

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 125/525 (23%), Positives = 213/525 (40%), Gaps = 22/525 (4%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 78  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 137

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++S++ + AARVH+ +P  
Sbjct: 138 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESVNAVRAARVHLAIPKP 195

Query: 162 GSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++              AI  LV+++VP++   +VT++D  G LLT 
Sbjct: 196 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAITRLVSSSVPDMPAKNVTIVDQDGNLLTQ 255

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 256 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYA 315

Query: 280 PDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDR--------KVPLPRSLEN 328
           P+   ++S   S+    S     S          N P             +   P +   
Sbjct: 316 PNGTPQQSAIRSQQTSTSTELAQSGTSGVPGALSNTPPQPASAPIVASNGQPAAPAATPV 375

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEI 388
           +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q      LA++
Sbjct: 376 SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLTADKLAQV 435

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  A G + +RGD++ + +  F       +        D++           V    
Sbjct: 436 QQLVKDAMGYDEKRGDSVNVVNSAFSAAADPFANLPWWRQPDMIELGKDIAKWLGVAAAA 495

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
             L       ALRR           V              + +          +     +
Sbjct: 496 AALYFMFVRPALRRAFPPPAEPAAAVPALDGPDDALALDGLPSPDKKQLAEEDEEHPALL 555

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
              S            +++      +   + +  A +++ W   E
Sbjct: 556 AFESEK-------NRYERNLDYARTIARQDPKIVATVVKNWVSDE 593


>gi|896313|gb|AAB06801.1| flagellar MS ring [Pseudomonas aeruginosa]
          Length = 599

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 116/586 (19%), Positives = 238/586 (40%), Gaps = 52/586 (8%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F  + + +   R + L   +   + +  A   +   P Y  LY  L   D NR+  AL
Sbjct: 27  LSFLDNLSEMTMLRQIGLLVGLAASVAIGFAVVLWSQQPDYKPLYGSLNGVDANRVVEAL 86

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + A+I +++  N  ++ V +  +G+AR+ +A+ G+  + +N G+E+ DK  + G + FM+
Sbjct: 87  TAADIPYKVEPNSGALLVKADDLGRARMKVASAGVAPTDNNVGFEILDKEQALGTSQFME 146

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV--Y 185
                R LEGE+ART+ S++ + AARVH+ +P    F +   +P+ASV++          
Sbjct: 147 ATNYRRGLEGELARTVSSLNNVKAARVHLAIPKSSVFVRDDRKPSASVLVELYPGRSLEP 206

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM--ERNILGKSLSIVQAIQHEIEM 243
               AI +LVA +VP LD   VTV+D  G LL+  +   E  +  K     + ++  +  
Sbjct: 207 SQVMAIVNLVATSVPELDKSQVTVVDQKGNLLSDQQELSELTMADKQFDFTRRMEGLLTQ 266

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            ++  L   L     ++ V A+++    +    +Y+PD    RS + + + +++ +  P+
Sbjct: 267 RVHNILQPVLDNGRNKTEVSADVDFSAVESTSEMYNPDQPALRSEQHNNEERQNSS-GPQ 325

Query: 304 SAVTVEQNMPHVSDRKVPLPRSL---------------------------------ENTD 330
                  N P           +                                      
Sbjct: 326 GVPGALSNQPPGPASAPQQATASAPADYVAPGQPLKDANGQTIIDPKTGKPELAPYPTDK 385

Query: 331 KKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVL-GRSADQGKIDSYLAEIN 389
           + +   NYE++     T     +L RLS+AVV++     +   G  + Q      LA   
Sbjct: 386 RDQTTRNYELDRSISYTKQQQGRLRRLSVAVVLDDQMKVDAKTGEVSHQPWSADELARFT 445

Query: 390 KIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGT 449
           ++V  + G ++ RGD++++ +  F   Q     ++           F  ++  ++ ++  
Sbjct: 446 RLVQDSVGYDASRGDSVSVINAPFAPAQAEEIDSIPF----YSQPWFWDIVKQVLGVLFI 501

Query: 450 LLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAV-TTGLMPNDNIALDSSNQDI 508
           L++ F  L  +          K   GG                G + +D +++   +  +
Sbjct: 502 LVLMFGVLRPVLSNITGGGKGKSLAGGGGGRDGDLALGESGLEGSLADDRVSIGGPSSIL 561

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                       +         + +++  +  R A+++++W  ++ 
Sbjct: 562 LPSP--------TEGYDAQLNAIKNLVAQDPGRVAQVVKEWINADE 599


>gi|83591884|ref|YP_425636.1| flagellar MS-ring protein [Rhodospirillum rubrum ATCC 11170]
 gi|83574798|gb|ABC21349.1| Flagellar FliF M-ring protein [Rhodospirillum rubrum ATCC 11170]
          Length = 551

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 149/553 (26%), Positives = 255/553 (46%), Gaps = 9/553 (1%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           +  F ++  +LG  R+  LA V +  I   +     ++    + LY  L  +D  +I   
Sbjct: 1   MNSFVQTMRNLGPVRLAALAGVAIALIGFVIYVASRLSGTSMELLYGDLAPADAKQIIAQ 60

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L E NI ++++++G S+ VPS  V K R+ +A   LP S +  GYE+FD  ++ G T F 
Sbjct: 61  LEERNIPYQMANDGRSVLVPSDQVLKLRVQMAESALP-SGATVGYEIFDSASALGSTQFT 119

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP-SVY 185
           Q I  VRALEGE+ART+++I G+  ARVH+V+P    F +    P+ASV++         
Sbjct: 120 QNINMVRALEGELARTVRTIQGVEGARVHLVLPKREPFTRDQVAPSASVVLLMKGRRLQP 179

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT--ANEMERNILGKSLSIVQAIQHEIEM 243
           +   A+++LVAAAVP +  G V+++D  G LLT    E    I      + +A +  +  
Sbjct: 180 EQVVAVQNLVAAAVPGMKPGQVSIIDERGTLLTRGMGEEGALIAQNQDELRKAEERRLAQ 239

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
           +I + L   +GV   R+ VVA+++ +        +DP+ +V RS     +  +S      
Sbjct: 240 SIEQLLERTIGVGKVRAEVVADMDFNRIVTSRESFDPNGQVVRSTTTVDEQNKSSD--AV 297

Query: 304 SAVTVEQNMPHVS-DRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVV 362
           S V+V+QN+P          P S  + ++ EE  NYEI         +   ++RLS+AV+
Sbjct: 298 SNVSVQQNLPEAQFAGNGGAPTSQTSENRTEETVNYEITKIVTNEVKEAGVVKRLSVAVM 357

Query: 363 VNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG 422
           V+    T   G +  Q + D  + +I  +V +A G +  RGD I + +M F++       
Sbjct: 358 VDGTSTTNDAGVTTWQPRSDDEMQKITSLVRSAMGYDQARGDQIEVVNMQFIDPGALFDD 417

Query: 423 TVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSP 482
                F+         +   L   V  +L+  L +  L +    +     + GG  +L+ 
Sbjct: 418 AAAWEFLGFTKAEVMKMAEGLGVAVVAILIILLVVRPLVQRAFENLPSGADQGGAGLLTA 477

Query: 483 PPISSAVTTGLMPNDNIA--LDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540
              S    TG       A  L   ++   +       ++   V   S  ++  +++ + E
Sbjct: 478 EMQSHPQLTGPGGGSIPAGMLGMPDEMDDAEELIDIDKVEGRVKASSLRKIGEIVDKHPE 537

Query: 541 RFAKILRKWARSE 553
               I+R W   E
Sbjct: 538 EALSIIRNWLYQE 550


>gi|157145268|ref|YP_001452587.1| flagellar MS-ring protein [Citrobacter koseri ATCC BAA-895]
 gi|157082473|gb|ABV12151.1| hypothetical protein CKO_01005 [Citrobacter koseri ATCC BAA-895]
          Length = 558

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 126/569 (22%), Positives = 228/569 (40%), Gaps = 49/569 (8%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +  +P Y  L+  L   D   I   L++ 
Sbjct: 14  LEWLNRLRANPRIPLIVAGSAAVAIIVAMVLWAKAPDYRTLFSNLSDQDGGAIVTQLTQM 73

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +R ++   +I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 74  NIPYRFTEGSGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVN 131

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVM--IRAINPSVYKSA 188
             RALEGE+ARTI+++  +  ARVH+ MP    F +    P+ASV   +           
Sbjct: 132 YQRALEGELARTIETLGPVKRARVHLAMPKPSLFVREQKSPSASVTVNLEPGRALDEGQI 191

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQHEIEMNINK 247
            A+ HLV++AV  L  G+VT++D  G LLT +      +    L     ++  I+  I  
Sbjct: 192 SAVVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSSRDLNDAQLKYASDVEGRIQRRIES 251

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PES 304
            L+  +G  N  + V A+L+   ++  E  Y P+    +++  S+    SE      P  
Sbjct: 252 ILSPIVGNGNVHAQVTAQLDFANKEQTEEQYRPNGDASQAVLRSRQLNESEQIGSGYPGG 311

Query: 305 AVTVEQNMPHVSDRKVPLP------------------RSLENTDKKEEQSNYEINTKSIA 346
                 N P  ++                         ++    ++ E SNYE++     
Sbjct: 312 VPGALSNQPAPANAAPISTPPANQQNAQNTQTTNNTNSNVPRNTQRNETSNYEVDRTIRH 371

Query: 347 TTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTI 406
           T  +   ++RLS+AVVVN   L +              + +I  +   A G + +RGDT+
Sbjct: 372 TKLNVGDVQRLSVAVVVNYRALPDGK----PLPLTTEQMKQIEDLTREAMGFSDKRGDTL 427

Query: 407 TITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNI 466
            + +  F                         +I+A  +L+  L+   L   A+R     
Sbjct: 428 NVVNSPFTATDDLGGELP----FWKQQAFIEQLISAGRWLLVLLVAWILWRKAVRPQLAR 483

Query: 467 DDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQ 526
              +      ++ +                +       ++D  +  R    R+ + V  Q
Sbjct: 484 RAEETKAAQEQAQVR------------QETEEAVEVRLSKDEQTQQRRANQRLGAEVMSQ 531

Query: 527 SDLRLLHMIEINEERFAKILRKWARSEIE 555
              R+  M + +    A ++R+W  ++ E
Sbjct: 532 ---RIREMSDNDPRVVALVIRQWMNNDHE 557


>gi|312962276|ref|ZP_07776768.1| flagellar M-ring protein FliF [Pseudomonas fluorescens WH6]
 gi|311283613|gb|EFQ62202.1| flagellar M-ring protein FliF [Pseudomonas fluorescens WH6]
          Length = 592

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 117/586 (19%), Positives = 227/586 (38%), Gaps = 54/586 (9%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  +I   L
Sbjct: 22  LSFLENLSEMTMLRQVGLMVGLAASVAIGFAVVLWSQQPDYRPLYGSLAGMDSKQIMETL 81

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + A+I + +  N  ++ V +  V +AR+ LAA G+  S SN G+E+ DK    G + FM+
Sbjct: 82  AAADIAYTVEPNSGALLVKADDVARARMKLAAAGVTPSDSNIGFEILDKDQGLGTSQFME 141

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPSVY 185
                R LEGE+ARTI S++ +  ARVH+ +P    F +   +P+ASV++          
Sbjct: 142 ATRYRRGLEGELARTISSLNNVKGARVHLAIPKSSVFVRDERKPSASVLVELFSGRSLEP 201

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNI--LGKSLSIVQAIQHEIEM 243
               AI +LVA +VP L    +TV+D  G LL+       +   GK     + ++  +  
Sbjct: 202 GQVMAIINLVATSVPELSKSQITVVDQKGNLLSDMAENSALTQAGKQFDYSRRMESMLTQ 261

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            ++  L   LG D +++ V A+++    +     ++PD    RS + + +  R+ ++ P+
Sbjct: 262 RVHNILQPILGNDRYKAEVSADVDFSAVESTSEQFNPDQPALRSEQSTSEQ-RTASNGPQ 320

Query: 304 SAVTVEQNMPHVSDRKVPLPRSL----------------------------------ENT 329
                  N P                                                  
Sbjct: 321 GVPGALSNQPPSPASAPQTTGGAAATAGAIQPGQPLLDANGQQIMDPATGQPMLAPYPAD 380

Query: 330 DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEV-LGRSADQGKIDSYLAEI 388
            + +   N+E++     T     ++ RLS++VVV+         G           LA  
Sbjct: 381 KRNQSTKNFELDRSISHTKQQQGRVNRLSVSVVVDDQVKVNPADGAVTRAPWSADELARF 440

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  A G ++ RGD++++ +M F   +                  F  ++  ++ ++ 
Sbjct: 441 TRLVQDAVGFDASRGDSVSVINMPFSAERGETIAEPAF----YSQPWFWDIVKQVLGVLF 496

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
            L++ F  L  +      +  K  ++                 G + ND ++L      +
Sbjct: 497 ILVLVFGVLRPVLNNITGNGKK--QLAAFGGGDVELGGMGGLDGELANDRVSLGGPQSIL 554

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                       S         +  ++  +  R A+++++W  ++ 
Sbjct: 555 LPSP--------SEGYDAQLNAIKSLVAEDPGRVAQVVKEWINADE 592


>gi|161502909|ref|YP_001570021.1| flagellar MS-ring protein [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|160864256|gb|ABX20879.1| hypothetical protein SARI_00968 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 560

 Score =  380 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 127/572 (22%), Positives = 226/572 (39%), Gaps = 52/572 (9%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +  +P Y  L+  L   D   I   L++ 
Sbjct: 14  LEWLNRLRANPRIPLIVAGSAAVAIIVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQM 73

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +R ++   +I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 74  NIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVN 131

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--SA 188
             RALEGE+ARTI+++  + +ARVH+ MP    F +    P+ASV +             
Sbjct: 132 YQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQI 191

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEIEMNINK 247
            A+ HLV++AV  L  G+VT++D +G LLT +    R++    L     ++  I+  I  
Sbjct: 192 SAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEA 251

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PES 304
            L+  +G  N  + V A+L+   ++  E  Y P+    ++   S+    SE      P  
Sbjct: 252 ILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQIGAGYPGG 311

Query: 305 AVTVEQNMPHVSDRKVPLPRSLEN---------------------TDKKEEQSNYEINTK 343
                 N P   +                                  ++ E SNYE++  
Sbjct: 312 VPGALSNQPAPPNEAPIATPPGNQQNAQNTAQTSTSTNSNSTGPRNTQRNETSNYEVDRT 371

Query: 344 SIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRG 403
              T  +   +ERLS+AVVVN   L +              + +I  +   A G + +RG
Sbjct: 372 IRHTKMNVGDIERLSVAVVVNYKTLADGK----PLPLTADQMKQIEDLTREAMGFSDKRG 427

Query: 404 DTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL 463
           DT+ + +  F                         ++ A  +L+  L+   L   A+R  
Sbjct: 428 DTLNVVNSPFSAVDETGGELP----FWQQQSFIDQLLAAGRWLLVLLVAWILWRKAVRPQ 483

Query: 464 HNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYV 523
                 +      ++ +                +       ++D     R    R+ + V
Sbjct: 484 LTRRVEETKAAQEQAQVR------------QETEEAVEVRLSKDEQLQQRRANQRLGAEV 531

Query: 524 SKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
             Q   R+  M + +    A ++R+W  ++ E
Sbjct: 532 MSQ---RIREMSDNDPRVVALVIRQWMSNDHE 560


>gi|260568707|ref|ZP_05839176.1| flagellar M-ring protein FliF [Brucella suis bv. 4 str. 40]
 gi|260155372|gb|EEW90453.1| flagellar M-ring protein FliF [Brucella suis bv. 4 str. 40]
          Length = 580

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 208/561 (37%), Positives = 317/561 (56%), Gaps = 4/561 (0%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
                + Q   +   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 9   NFQQLIEQLKGTLGKLGARKLIALGLVGAALMGAILYMSIYLGRPSYETLYVGLSRDDVN 68

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 69  RMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 127

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 128 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 187

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG-KSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +     N     + S+ Q +   
Sbjct: 188 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASH 247

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  +
Sbjct: 248 VDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNN 307

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLSIA
Sbjct: 308 RNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSKTVSTVSDGYSIKRLSIA 367

Query: 361 VVVNKGRLTEVLGRSADQG-KIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+    
Sbjct: 368 VVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDPAGA 427

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
           +   V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       ++ 
Sbjct: 428 DMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAG 487

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
               P        +       +           +   S +   +   + LRL  MIE++E
Sbjct: 488 EVATPNFIGGAESVGEGVQAVIGGPA-AYADQMKTSLSDLRQRMRMPAKLRLEQMIEMDE 546

Query: 540 ERFAKILRKWARSEIEDRYTQ 560
           ER A +L++W       R   
Sbjct: 547 ERVAAVLKQWIHETASGREAD 567


>gi|149928162|ref|ZP_01916408.1| flagellar M-ring protein FliF [Limnobacter sp. MED105]
 gi|149823147|gb|EDM82385.1| flagellar M-ring protein FliF [Limnobacter sp. MED105]
          Length = 575

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 122/576 (21%), Positives = 236/576 (40%), Gaps = 42/576 (7%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           + +    +    L +   + +   + + I +  +   + N   Y  L+  L   D   I 
Sbjct: 17  NPITNMQQRFAKLPQKNKMGILIGVPLLIAVIASLLMWANQTSYRVLFSGLNDQDGGAIV 76

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
            AL++  + +  +  G++I VPS+ V   R+ LA+QGLP   S SG+E  D     G+T 
Sbjct: 77  EALTQMKVPYEFNTAGTAILVPSNKVYDTRLALASQGLPK-GSVSGFEAMDN-QKLGITQ 134

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV 184
           F +++   RALEGE+ R+IQSIS + +ARVH+ +P    F +    P+AS+++       
Sbjct: 135 FQEQVNYQRALEGELVRSIQSISAVQSARVHLAIPKPSIFIREKQTPSASIVLNLFGSRT 194

Query: 185 YK--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM-ERNILGKSLSIVQAIQHEI 241
                   I HLVA+++P ++  DV+++D +G+LLT     E  +    L+    I+  +
Sbjct: 195 LSEPQINGIVHLVASSLPGMNPEDVSIVDQSGRLLTGKTQLESGLNPTQLAYTNQIEQSL 254

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSK----VERSIRLSKDAQRS 297
              I   L+   G +N R+ V A ++    +  + +Y P+        RS ++S+    S
Sbjct: 255 TSRIVDILSPVFGSENVRATVTANMDYSMSERTDEIYKPNGDTTQATIRSQQISESNDGS 314

Query: 298 ETSQPESAVTVEQNMPHVSDRK-----------------VPLPRSLENTDKKEEQSNYEI 340
             + P+    V  N P                          P    ++ +K+   NYE+
Sbjct: 315 SNANPQGIPGVMANTPPGEAAANIGQNPQQALANGVNGGTSTPTQTNSSTRKDSTVNYEV 374

Query: 341 NTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINS 400
           +     T     K+ERLS AVVVN   +T+  G +         + +++ +V  A G + 
Sbjct: 375 DKSVQYTKSQVGKIERLSAAVVVNYKTITDPKGETRQVPLTPEEITQLDSLVKQAIGFDE 434

Query: 401 RRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHAL 460
           +RGD + + +  F +       T+ +           ++   +   +   ++ F  L  +
Sbjct: 435 QRGDAVNVVNQAFTK---VEEETIPMWAQQETMDLAKSLGMPIGVALIAAILVFGVLRPM 491

Query: 461 RRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRIN 520
            +   +D   +G         P   +              +   N          +  + 
Sbjct: 492 MKPAEVDLFDEGPELLPGQRMPLLANQ-------------VGGDNDAELLEQLQREGTLP 538

Query: 521 SYVSKQSDLRLLHMIEINEERFAKILRKWARSEIED 556
               ++   +L  + + + +  A I++ W   E ++
Sbjct: 539 GMNRQEKMEKLRQLAKEHPQIVASIVKNWVNGETQN 574


>gi|18182538|gb|AAL65160.1|AF453480_2 flagellar MS ring protein [Burkholderia cepacia]
          Length = 587

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 123/528 (23%), Positives = 218/528 (41%), Gaps = 28/528 (5%)

Query: 38  AARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHL 97
           A   +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VPS+ V + R+ L
Sbjct: 75  ALVLWSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPSNQVHETRLKL 134

Query: 98  AAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIV 157
           AA GLP   S  G+EL D    FG++ F ++I   RALEGE+ RTI+SI+ +  ARVH+ 
Sbjct: 135 AAMGLPKGGS-VGFELMDN-QKFGISQFAEQINYQRALEGELQRTIESINAVRGARVHLA 192

Query: 158 MPDMGSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
           +P    F +    P+ASV +             +AI  +V++ VP++   +VT++D  G 
Sbjct: 193 IPKPSVFVRDKEAPSASVFVDLYPGRVLDEGQVQAITRMVSSGVPDMPAKNVTIVDQDGN 252

Query: 216 LLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           LLT       +    L  VQ ++H  +  I+  LA   G  N RS V A+L+    +   
Sbjct: 253 LLTQTASASGLDASQLKYVQQVEHNTQKRIDAILAPIFGAGNARSQVSADLDFSKIEQTS 312

Query: 276 IVYDPDSKVERSIRLSKDAQRSET----------SQPESAVTVEQNMPHVSDRKVPLPRS 325
             Y P+   +++   S+    +            ++  +                  P++
Sbjct: 313 ESYGPNGTPQQAAIRSQQTSSATELAQAARRACRARCRTRRRSRPPRRSSPGNGQNAPQT 372

Query: 326 LENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYL 385
              +D+K++ +NYE++     T      ++RLS+AVVVN   + +  G    Q    + L
Sbjct: 373 TPVSDRKDQTTNYELDKTIRHTEQPMGSVKRLSVAVVVNYQPVADAKGHVTMQPLPPAKL 432

Query: 386 AEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVF 445
           A++ ++V  A G + +RGD++ + +  F       +        D+++          + 
Sbjct: 433 AQVEQLVKDAMGYDEKRGDSVNVVNSAFSTVSDPYADLPWWRQPDMIAMAKEAAKWLGIA 492

Query: 446 LVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSN 505
                L       A+RR     +     +             A        D + L   N
Sbjct: 493 AAAAALYFMFVRPAMRRAFPPPEPAAPALAAPEDAVALDGLPAPDKAAEEPDPLLLGFEN 552

Query: 506 QDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
           +                  +++      +   + +  A +++ W   E
Sbjct: 553 EK--------------NRYERNLDYARTIARQDPKIVATVVKNWVSDE 586


>gi|322616962|gb|EFY13870.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322618201|gb|EFY15093.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322625872|gb|EFY22691.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322626324|gb|EFY23134.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322632739|gb|EFY29484.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322639081|gb|EFY35774.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322640397|gb|EFY37053.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322647242|gb|EFY43741.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322649910|gb|EFY46331.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322660296|gb|EFY56534.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322662977|gb|EFY59184.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322668162|gb|EFY64321.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322674079|gb|EFY70173.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322675569|gb|EFY71643.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322686714|gb|EFY82692.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323195398|gb|EFZ80578.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323198074|gb|EFZ83191.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323207544|gb|EFZ92492.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323211017|gb|EFZ95877.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323217529|gb|EGA02248.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323219604|gb|EGA04088.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323231551|gb|EGA15664.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323235994|gb|EGA20073.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323240564|gb|EGA24607.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323245456|gb|EGA29456.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323250226|gb|EGA34118.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323253963|gb|EGA37787.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323255510|gb|EGA39271.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323262107|gb|EGA45670.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323266230|gb|EGA49720.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323270661|gb|EGA54102.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 560

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 126/572 (22%), Positives = 227/572 (39%), Gaps = 52/572 (9%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +  +P Y  L+  L   D   I   L++ 
Sbjct: 14  LEWLNRLRANPRIPLIVAGSATVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQM 73

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +R ++   +I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 74  NIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVN 131

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--SA 188
             RALEGE+ARTI+++  + +ARVH+ MP    F +    P+ASV +             
Sbjct: 132 YQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQI 191

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEIEMNINK 247
            A+ HLV++AV  L  G+VT++D +G LLT +    R++    L     ++  I+  I  
Sbjct: 192 SAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEA 251

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PES 304
            L+  +G  N  + V A+L+   ++  E  Y P+    ++   S+    SE      P  
Sbjct: 252 ILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGG 311

Query: 305 AVTVEQNMP---------------------HVSDRKVPLPRSLENTDKKEEQSNYEINTK 343
                 N P                       +        +     ++ E SNYE++  
Sbjct: 312 VPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNSAGPRNTQRNETSNYEVDRT 371

Query: 344 SIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRG 403
              T  +   +ERLS+AVVVN   L +              + +I  +   A G + +RG
Sbjct: 372 IRHTKMNVGDIERLSVAVVVNYKTLADGK----PLPLTADQMKQIEDLTREAMGFSDKRG 427

Query: 404 DTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL 463
           DT+ + +  F                         ++ A  +L+  ++   L   A+R  
Sbjct: 428 DTLNVVNSPFSAVDNTGGELP----FWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQ 483

Query: 464 HNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYV 523
                 +      ++ +                +       ++D     R    R+ + V
Sbjct: 484 LTRRVEETKAAQEQAQVR------------QETEEAVEVRLSKDEQLQQRRANQRLGAEV 531

Query: 524 SKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
             Q   R+  M + +    A ++R+W  ++ E
Sbjct: 532 MSQ---RIREMSDNDPRVVALVIRQWMSNDHE 560


>gi|261219820|ref|ZP_05934101.1| flagellar M-ring protein FliF [Brucella ceti B1/94]
 gi|265996839|ref|ZP_06109396.1| flagellar M-ring protein FliF [Brucella ceti M490/95/1]
 gi|260918404|gb|EEX85057.1| flagellar M-ring protein FliF [Brucella ceti B1/94]
 gi|262551136|gb|EEZ07297.1| flagellar M-ring protein FliF [Brucella ceti M490/95/1]
          Length = 580

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 208/561 (37%), Positives = 316/561 (56%), Gaps = 4/561 (0%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
                + Q   +   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 9   NFQQLIEQLKGTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 68

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+  AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 69  RMGRALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 127

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 128 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 187

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG-KSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +     N     + S+ Q +   
Sbjct: 188 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASH 247

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  +
Sbjct: 248 VDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNN 307

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLSIA
Sbjct: 308 RNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSKTVSTVSDGYSIKRLSIA 367

Query: 361 VVVNKGRLTEVLGRSADQG-KIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+    
Sbjct: 368 VVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDPAGA 427

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
           +   V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       ++ 
Sbjct: 428 DMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAG 487

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
               P        +       +           +   S +   +   + LRL  MIE++E
Sbjct: 488 EVATPNFIGGAESVGEGVQAVIGGPA-AYADQMKTSLSDLRQRMRMPAKLRLEQMIEMDE 546

Query: 540 ERFAKILRKWARSEIEDRYTQ 560
           ER A +L++W       R   
Sbjct: 547 ERVAAVLKQWIHETASGREAD 567


>gi|261215451|ref|ZP_05929732.1| flagellar M-ring protein FliF [Brucella abortus bv. 3 str. Tulya]
 gi|260917058|gb|EEX83919.1| flagellar M-ring protein FliF [Brucella abortus bv. 3 str. Tulya]
          Length = 580

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 208/561 (37%), Positives = 317/561 (56%), Gaps = 4/561 (0%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
                + Q   +   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 9   NFQQLIEQLKGTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 68

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 69  RMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 127

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 128 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 187

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG-KSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +     N     + S+ Q +   
Sbjct: 188 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASH 247

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  +
Sbjct: 248 VDDSIRKALAPYLGLGHFQTSVQAVLDTDRRQTKETTYDPESRVERSVRVVRESGDSRNN 307

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLSIA
Sbjct: 308 RNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSKTVSTVSDGYSIKRLSIA 367

Query: 361 VVVNKGRLTEVLGRSADQG-KIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+    
Sbjct: 368 VVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDPAGA 427

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
           +   V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       ++ 
Sbjct: 428 DMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAG 487

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
               P        +       +           +   S +   +   + LRL  MIE++E
Sbjct: 488 EVATPNFIGGAESVGEGVQAVIGGPA-AYADQMKTSLSDLRQRMRMPAKLRLEQMIEMDE 546

Query: 540 ERFAKILRKWARSEIEDRYTQ 560
           ER A +L++W       R   
Sbjct: 547 ERVAAVLKQWIHETASGREAD 567


>gi|254695100|ref|ZP_05156928.1| flagellar MS-ring protein [Brucella abortus bv. 3 str. Tulya]
          Length = 575

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 208/561 (37%), Positives = 317/561 (56%), Gaps = 4/561 (0%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
                + Q   +   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 4   NFQQLIEQLKGTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 63

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 64  RMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 122

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 123 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 182

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG-KSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +     N     + S+ Q +   
Sbjct: 183 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASH 242

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  +
Sbjct: 243 VDDSIRKALAPYLGLGHFQTSVQAVLDTDRRQTKETTYDPESRVERSVRVVRESGDSRNN 302

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLSIA
Sbjct: 303 RNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSKTVSTVSDGYSIKRLSIA 362

Query: 361 VVVNKGRLTEVLGRSADQG-KIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+    
Sbjct: 363 VVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDPAGA 422

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
           +   V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       ++ 
Sbjct: 423 DMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAG 482

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
               P        +       +           +   S +   +   + LRL  MIE++E
Sbjct: 483 EVATPNFIGGAESVGEGVQAVIGGPA-AYADQMKTSLSDLRQRMRMPAKLRLEQMIEMDE 541

Query: 540 ERFAKILRKWARSEIEDRYTQ 560
           ER A +L++W       R   
Sbjct: 542 ERVAAVLKQWIHETASGREAD 562


>gi|256158325|ref|ZP_05456229.1| flagellar MS-ring protein [Brucella ceti M490/95/1]
 gi|256252741|ref|ZP_05458277.1| flagellar MS-ring protein [Brucella ceti B1/94]
          Length = 575

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 208/561 (37%), Positives = 316/561 (56%), Gaps = 4/561 (0%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
                + Q   +   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 4   NFQQLIEQLKGTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 63

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+  AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 64  RMGRALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 122

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 123 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 182

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG-KSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +     N     + S+ Q +   
Sbjct: 183 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASH 242

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  +
Sbjct: 243 VDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNN 302

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLSIA
Sbjct: 303 RNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSKTVSTVSDGYSIKRLSIA 362

Query: 361 VVVNKGRLTEVLGRSADQG-KIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+    
Sbjct: 363 VVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDPAGA 422

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
           +   V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       ++ 
Sbjct: 423 DMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAG 482

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
               P        +       +           +   S +   +   + LRL  MIE++E
Sbjct: 483 EVATPNFIGGAESVGEGVQAVIGGPA-AYADQMKTSLSDLRQRMRMPAKLRLEQMIEMDE 541

Query: 540 ERFAKILRKWARSEIEDRYTQ 560
           ER A +L++W       R   
Sbjct: 542 ERVAAVLKQWIHETASGREAD 562


>gi|52428288|gb|AAU48881.1| flagellar M-ring protein FliF [Burkholderia mallei ATCC 23344]
          Length = 543

 Score =  378 bits (971), Expect = e-103,   Method: Composition-based stats.
 Identities = 126/525 (24%), Positives = 216/525 (41%), Gaps = 21/525 (4%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 26  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 85

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++S + + AARV++ +P  
Sbjct: 86  LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESSNAVRAARVYLAIPKP 143

Query: 162 GSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++              A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 144 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 203

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 204 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYG 263

Query: 280 PDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDR--------KVPLPRSLEN 328
           P+   ++S   S+    S     S          N P             +   P +   
Sbjct: 264 PNGTPQQSAIRSQQTSSSTELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 323

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEI 388
           +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q      LA++
Sbjct: 324 SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLAADKLAQV 383

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  A G + +RGD++ + +  F       +        D++           V    
Sbjct: 384 QQLVKDAMGYDEKRGDSVNVVNSAFSAAADPFANLPWWRQPDMIELGKDIAKWLGVAAAA 443

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
             L       ALRR                     P       GL   D   L   +++ 
Sbjct: 444 AALYFMFVRPALRR---AFPPPAEPAAAAVPALDGPDDMLALDGLPSPDKKQLAEEDEEH 500

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
            +       R      +++      +   + +  A +++ W   E
Sbjct: 501 PALLAFENER---NRYERNLDYARTIARQDPKIVATVVKNWVSDE 542


>gi|256059797|ref|ZP_05449992.1| flagellar MS-ring protein [Brucella neotomae 5K33]
 gi|261323777|ref|ZP_05962974.1| flagellar M-ring protein FliF [Brucella neotomae 5K33]
 gi|261299757|gb|EEY03254.1| flagellar M-ring protein FliF [Brucella neotomae 5K33]
          Length = 580

 Score =  378 bits (971), Expect = e-102,   Method: Composition-based stats.
 Identities = 208/561 (37%), Positives = 318/561 (56%), Gaps = 4/561 (0%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
                + Q   +   LG  ++++L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 9   NFQQLIEQLKGTLGKLGARKLIVLGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 68

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 69  RMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 127

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 128 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 187

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG-KSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +     N     + S+ Q +   
Sbjct: 188 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASH 247

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  +
Sbjct: 248 VDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNN 307

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLSIA
Sbjct: 308 RNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSKTVSTVSDGYSIKRLSIA 367

Query: 361 VVVNKGRLTEVLGRSADQG-KIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+    
Sbjct: 368 VVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDPAGA 427

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
           +   V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       ++ 
Sbjct: 428 DMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAG 487

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
               P        +       +           +   S +   +   + LRL  MIE++E
Sbjct: 488 EVATPNFIGGAESVGEGVQAVIGGPA-AYADQMKTSLSDLRQRMRMPAKLRLEQMIEMDE 546

Query: 540 ERFAKILRKWARSEIEDRYTQ 560
           ER A +L++W       R   
Sbjct: 547 ERVAAVLKQWIHETASGREAD 567


>gi|23500860|ref|NP_700300.1| flagellar MS-ring protein [Brucella suis 1330]
 gi|83269941|ref|YP_419232.1| flagellar MS-ring protein [Brucella melitensis biovar Abortus 2308]
 gi|225628435|ref|ZP_03786469.1| flagellar M-ring protein FliF [Brucella ceti str. Cudo]
 gi|237817511|ref|ZP_04596501.1| flagellar M-ring protein FliF [Brucella abortus str. 2308 A]
 gi|256015905|ref|YP_003105914.1| flagellar M-ring protein FliF [Brucella microti CCM 4915]
 gi|260166802|ref|ZP_05753613.1| flagellar MS-ring protein [Brucella sp. F5/99]
 gi|260544149|ref|ZP_05819970.1| flagellar M-ring protein FliF [Brucella abortus NCTC 8038]
 gi|260757235|ref|ZP_05869583.1| flagellar M-ring protein FliF [Brucella abortus bv. 6 str. 870]
 gi|260759400|ref|ZP_05871748.1| flagellar M-ring protein FliF [Brucella abortus bv. 4 str. 292]
 gi|260762643|ref|ZP_05874975.1| flagellar M-ring protein FliF [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883039|ref|ZP_05894653.1| flagellar M-ring protein FliF [Brucella abortus bv. 9 str. C68]
 gi|261318817|ref|ZP_05958014.1| flagellar M-ring protein FliF [Brucella pinnipedialis B2/94]
 gi|261749710|ref|ZP_05993419.1| flagellar M-ring protein [Brucella suis bv. 5 str. 513]
 gi|261752953|ref|ZP_05996662.1| flagellar M-ring protein FliF [Brucella suis bv. 3 str. 686]
 gi|261756180|ref|ZP_05999889.1| flagellar M-ring protein FliF [Brucella sp. F5/99]
 gi|265987176|ref|ZP_06099733.1| flagellar M-ring protein FliF [Brucella pinnipedialis M292/94/1]
 gi|294852976|ref|ZP_06793648.1| flagellar M-ring protein FliF [Brucella sp. NVSL 07-0026]
 gi|297250144|ref|ZP_06933845.1| flagellar M-ring protein FliF [Brucella abortus bv. 5 str. B3196]
 gi|38257618|sp|Q8FUS3|FLIF_BRUSU RecName: Full=Flagellar M-ring protein FliF
 gi|23464525|gb|AAN34305.1| flagellar M-ring protein FliF [Brucella suis 1330]
 gi|82940215|emb|CAJ13271.1| Flagellar FliF M-ring protein:Type III secretion system outer
           membrane K protein:Secretory protein YscJ/FliF [Brucella
           melitensis biovar Abortus 2308]
 gi|225616281|gb|EEH13329.1| flagellar M-ring protein FliF [Brucella ceti str. Cudo]
 gi|237787266|gb|EEP61484.1| flagellar M-ring protein FliF [Brucella abortus str. 2308 A]
 gi|255998565|gb|ACU50252.1| flagellar M-ring protein FliF [Brucella microti CCM 4915]
 gi|260097420|gb|EEW81294.1| flagellar M-ring protein FliF [Brucella abortus NCTC 8038]
 gi|260669718|gb|EEX56658.1| flagellar M-ring protein FliF [Brucella abortus bv. 4 str. 292]
 gi|260673064|gb|EEX59885.1| flagellar M-ring protein FliF [Brucella abortus bv. 2 str. 86/8/59]
 gi|260677343|gb|EEX64164.1| flagellar M-ring protein FliF [Brucella abortus bv. 6 str. 870]
 gi|260872567|gb|EEX79636.1| flagellar M-ring protein FliF [Brucella abortus bv. 9 str. C68]
 gi|261298040|gb|EEY01537.1| flagellar M-ring protein FliF [Brucella pinnipedialis B2/94]
 gi|261736164|gb|EEY24160.1| flagellar M-ring protein FliF [Brucella sp. F5/99]
 gi|261739463|gb|EEY27389.1| flagellar M-ring protein [Brucella suis bv. 5 str. 513]
 gi|261742706|gb|EEY30632.1| flagellar M-ring protein FliF [Brucella suis bv. 3 str. 686]
 gi|264659373|gb|EEZ29634.1| flagellar M-ring protein FliF [Brucella pinnipedialis M292/94/1]
 gi|294818631|gb|EFG35631.1| flagellar M-ring protein FliF [Brucella sp. NVSL 07-0026]
 gi|297174013|gb|EFH33377.1| flagellar M-ring protein FliF [Brucella abortus bv. 5 str. B3196]
          Length = 580

 Score =  378 bits (971), Expect = e-102,   Method: Composition-based stats.
 Identities = 208/561 (37%), Positives = 317/561 (56%), Gaps = 4/561 (0%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
                + Q   +   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 9   NFQQLIEQLKGTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 68

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 69  RMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 127

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 128 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 187

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG-KSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +     N     + S+ Q +   
Sbjct: 188 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASH 247

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  +
Sbjct: 248 VDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNN 307

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLSIA
Sbjct: 308 RNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSKTVSTVSDGYSIKRLSIA 367

Query: 361 VVVNKGRLTEVLGRSADQG-KIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+    
Sbjct: 368 VVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDPAGA 427

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
           +   V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       ++ 
Sbjct: 428 DMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAG 487

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
               P        +       +           +   S +   +   + LRL  MIE++E
Sbjct: 488 EVATPNFIGGAESVGEGVQAVIGGPA-AYADQMKTSLSDLRQRMRMPAKLRLEQMIEMDE 546

Query: 540 ERFAKILRKWARSEIEDRYTQ 560
           ER A +L++W       R   
Sbjct: 547 ERVAAVLKQWIHETASGREAD 567


>gi|77457763|ref|YP_347268.1| flagellar MS-ring protein [Pseudomonas fluorescens Pf0-1]
 gi|77381766|gb|ABA73279.1| flagellar M-ring protein [Pseudomonas fluorescens Pf0-1]
          Length = 595

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 116/586 (19%), Positives = 227/586 (38%), Gaps = 54/586 (9%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  ++   L
Sbjct: 25  LSFLENLSEMTVLRQVGLLVGLAASVAIGFAVVLWSQQPDYRPLYGSLAGMDAKQVMDTL 84

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + A+I + +  N  ++ V +  + +AR+ LAA G+  S  N G+E+ DK    G + FM+
Sbjct: 85  ASADIPYTVEPNSGALLVKADDLSRARLKLAAAGVTPSDGNIGFEILDKEQGLGTSQFME 144

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPSVY 185
                R LEGE+ARTI S++ +  ARVH+ +P    F +   +P+ASV++          
Sbjct: 145 ATRYRRGLEGELARTISSLNNVKGARVHLAIPKSSVFVRDERKPSASVLVELYSGRSLEP 204

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTAN--EMERNILGKSLSIVQAIQHEIEM 243
               AI +LVA +VP L    +TV+D  G LL+      E  + GK     + ++  +  
Sbjct: 205 GQVVAIINLVATSVPELSKSQITVVDQKGNLLSDQAENAEMTMAGKQFDYSRRMESMLTQ 264

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            ++  L   LG D +++ V A+++    +     ++PD    RS +   + QR+ ++ P+
Sbjct: 265 RVHNILQPVLGNDRYKAEVSADVDFSAVESTAEQFNPDQPALRSEQSV-NEQRTASNGPQ 323

Query: 304 SAVTVEQNMPHVSDRKVPLPRSL----------------------------------ENT 329
                  N P                                                  
Sbjct: 324 GVPGALSNQPPSPASAPQTTGGAAAPASMVQPGQPLVDANGQQIMDPATGQPMLAPYPAD 383

Query: 330 DKKEEQSNYEINTKSIATTHDNYKLERL-SIAVVVNKGRLTEVLGRSADQGKIDSYLAEI 388
            +++   N+E++     T     +L RL    VV ++ ++    G +         LA  
Sbjct: 384 KRQQSTKNFELDRSISHTKQQQGRLNRLSVSVVVDDQVKINPANGETTRAPWSADELARF 443

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  A G ++ RGD++++ +M F   +      +           F  ++  ++ ++ 
Sbjct: 444 TRLVQDAVGFDASRGDSVSVINMPFSAERGEVIADIPF----YSQPWFWDIVKQVLGVLF 499

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
            L++ F  L  +          K   G                G + ND ++L      +
Sbjct: 500 ILVLVFGVLRPVLNNITGGGKSKELAGLGG--DMELGGMGGLDGELSNDRVSLGGPTSIL 557

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                       S         +  ++  +  R A+++++W  ++ 
Sbjct: 558 LPSP--------SEGYDAQLNAIKSLVAEDPGRVAQVVKEWINADE 595


>gi|2916780|emb|CAA11947.1| flagellar basal-body MS-ring protein [Sinorhizobium meliloti]
          Length = 557

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 267/552 (48%), Positives = 356/552 (64%), Gaps = 4/552 (0%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M + DQ   F K+ ++LG+ +++ LA   +V I   + A  +VN   ++ LYV LE SDV
Sbjct: 1   MNLFDQFSTFTKNLSNLGQGKLIALAVAGVVAIGFVLGAGIYVNRRSFETLYVGLERSDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
            +IS+AL+EAN+DF +  +G SI VP  M GKAR+ LA +GLP SS+N+GYELFD V S 
Sbjct: 61  TQISIALAEANVDFEVGTDGGSIQVPVGMTGKARLLLAERGLP-SSANAGYELFDNVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEI RTIQ ISGI AARVHIVMP+ GSFRK    PTASVMIRA 
Sbjct: 120 GLTSFMQEVTRVRALEGEIGRTIQQISGIAAARVHIVMPERGSFRKAEQTPTASVMIRAS 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKS-LSIVQAIQH 239
                 +A +IRHLVA++VP LD+ DVTVLDSTG+LL + +   N      L +VQ +Q 
Sbjct: 180 ATVGRSAASSIRHLVASSVPGLDVDDVTVLDSTGQLLASGDDPSNSALNQSLGVVQNVQS 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           ++E  I+ ALA FLG+DNFR++V A LN D QQI+E V+DP+S+VERS R+ K+ Q+S  
Sbjct: 240 DLEKKIDNALAPFLGMDNFRTSVTARLNTDAQQIQETVFDPESRVERSTRVIKEEQKSSQ 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
            QP++A TV+QN+P  + R     +S +  +KKEEQ+NYEIN+K+IAT  ++Y +ERLSI
Sbjct: 300 QQPDNAATVQQNVPQAAPRGGAGQQSSDEAEKKEEQTNYEINSKTIATVKNSYSIERLSI 359

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AVVVN+GRL  + G  ADQ KID+YL E+ KIVS+A GI+  RGD +T+ +MDF+E QL 
Sbjct: 360 AVVVNRGRLAAMAGEPADQAKIDAYLQEMQKIVSSAAGIDPGRGDVVTLNAMDFVETQLL 419

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
           +        M++L+R+   +INAL F+    LV + G+  L R            G  + 
Sbjct: 420 DQAVPGPGIMEMLTRNLGGIINALAFVAVAFLVVWFGMRPLARQLGFGGQAGKLEGEAAG 479

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSH--SRNLQSRINSYVSKQSDLRLLHMIEI 537
           L  P  S A                  D      +   ++  N  V +  + RL  M+EI
Sbjct: 480 LELPDFSPAGAGAGGALMEGFGSDFGFDGGDDLLNLGDEAGFNRRVKEGPERRLARMVEI 539

Query: 538 NEERFAKILRKW 549
           +EER AKILRKW
Sbjct: 540 SEERAAKILRKW 551


>gi|189023215|ref|YP_001932956.1| flagellar MS-ring protein [Brucella abortus S19]
 gi|254691603|ref|ZP_05154857.1| flagellar MS-ring protein [Brucella abortus bv. 6 str. 870]
 gi|254698196|ref|ZP_05160024.1| flagellar MS-ring protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|254699268|ref|ZP_05161096.1| flagellar MS-ring protein [Brucella suis bv. 5 str. 513]
 gi|254702392|ref|ZP_05164220.1| flagellar MS-ring protein [Brucella suis bv. 3 str. 686]
 gi|254711225|ref|ZP_05173036.1| flagellar MS-ring protein [Brucella pinnipedialis B2/94]
 gi|254731641|ref|ZP_05190219.1| flagellar MS-ring protein [Brucella abortus bv. 4 str. 292]
 gi|256030146|ref|ZP_05443760.1| flagellar MS-ring protein [Brucella pinnipedialis M292/94/1]
 gi|256256791|ref|ZP_05462327.1| flagellar MS-ring protein [Brucella abortus bv. 9 str. C68]
 gi|189021789|gb|ACD74510.1| flagellar M-ring protein FliF [Brucella abortus S19]
          Length = 575

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 208/561 (37%), Positives = 317/561 (56%), Gaps = 4/561 (0%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
                + Q   +   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 4   NFQQLIEQLKGTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 63

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 64  RMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 122

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 123 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 182

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG-KSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +     N     + S+ Q +   
Sbjct: 183 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASH 242

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  +
Sbjct: 243 VDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNN 302

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLSIA
Sbjct: 303 RNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSKTVSTVSDGYSIKRLSIA 362

Query: 361 VVVNKGRLTEVLGRSADQG-KIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+    
Sbjct: 363 VVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDPAGA 422

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
           +   V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       ++ 
Sbjct: 423 DMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAG 482

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
               P        +       +           +   S +   +   + LRL  MIE++E
Sbjct: 483 EVATPNFIGGAESVGEGVQAVIGGPA-AYADQMKTSLSDLRQRMRMPAKLRLEQMIEMDE 541

Query: 540 ERFAKILRKWARSEIEDRYTQ 560
           ER A +L++W       R   
Sbjct: 542 ERVAAVLKQWIHETASGREAD 562


>gi|16760913|ref|NP_456530.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|25304719|pir||AB0752 flagellar basal-body M-ring protein [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16503210|emb|CAD05717.1| flagellar basal-body M-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi]
          Length = 560

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 125/572 (21%), Positives = 226/572 (39%), Gaps = 52/572 (9%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +  +P Y  L+  L   D   I   L++ 
Sbjct: 14  LEWLNRLRANPRIPLIVAGSTAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQM 73

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +R ++   +I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 74  NIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVN 131

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--SA 188
             RALEGE+ARTI+++  + +ARVH+ MP    F +    P+ASV +             
Sbjct: 132 YQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQI 191

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEIEMNINK 247
            A+ HLV++AV  L  G+VT++D +G LLT +    R++    L     ++  I+  I  
Sbjct: 192 SAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEA 251

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PES 304
            L+  +G  N  + V A+L+   ++  E  Y P+    ++   S+    SE      P  
Sbjct: 252 ILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGG 311

Query: 305 AVTVEQNMP---------------------HVSDRKVPLPRSLENTDKKEEQSNYEINTK 343
                 N P                       +        +     ++ E SNYE++  
Sbjct: 312 VPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNNAGPRNTQRNETSNYEVDRT 371

Query: 344 SIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRG 403
              T  +   +ERLS+AVVVN   L +              + +I  +   A G + +RG
Sbjct: 372 IRHTKMNVGDIERLSVAVVVNYKTLADGK----PLPLTADQMKQIEDLTREAMGFSDKRG 427

Query: 404 DTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL 463
           DT+ + +  F                         ++ A  +L+  ++   L   A+   
Sbjct: 428 DTLNVVNSPFSAVDNTGGELP----FWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVHPQ 483

Query: 464 HNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYV 523
                 +      ++ +                +       ++D     R    R+ + V
Sbjct: 484 LTRRVEEAKAAQEQAQVR------------QETEEAVEVRLSKDEQLQQRRANQRLGAEV 531

Query: 524 SKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
             Q   R+  M + +    A ++R+W  ++ E
Sbjct: 532 MSQ---RIREMSDNDPRVVALVIRQWMSNDHE 560


>gi|119899006|ref|YP_934219.1| flagellar MS-ring protein [Azoarcus sp. BH72]
 gi|119671419|emb|CAL95332.1| flagellar M-ring protein [Azoarcus sp. BH72]
          Length = 562

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 134/569 (23%), Positives = 229/569 (40%), Gaps = 40/569 (7%)

Query: 6   QLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISV 65
           +L Q  ++  +L   + +  A+ + + + L + A  +   P Y  L+  L+  D  ++  
Sbjct: 19  RLQQVVQNINALSMRQKIAGAAALALAVALIVGALMWNRQPDYGVLFSNLDERDGGQVIA 78

Query: 66  ALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSF 125
           AL + N+ +R+S NG SI VP   V + R+ LAA GLP      G+EL D     G++ F
Sbjct: 79  ALQQQNVPYRMSPNGLSILVPQEQVHELRLRLAAAGLPRGGL-VGFELMD-TQKLGVSQF 136

Query: 126 MQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP--S 183
            +++   RALEGE++RTIQSI+ + AARVH+ MP   +F +   +PTASVM+        
Sbjct: 137 NEQVNYQRALEGELSRTIQSIAAVAAARVHLAMPKQTAFLRDDQKPTASVMVTLRPGRVL 196

Query: 184 VYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM---ERNILGKSLSIVQAIQHE 240
                  I HLV+++VP +    V ++D  G+LLT       +  +    L  V+ ++  
Sbjct: 197 DANQVAGIVHLVSSSVPRMVESGVNIIDQNGELLTTKNDPLRQTGLDATQLEYVKEVEAG 256

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK-DAQRSET 299
               I   L   +G +NFR+ V A+++ +  +     + P+   +++IR  +   + +  
Sbjct: 257 FIRRIENILQPMVGKNNFRAQVAADVDFNQVEQTAETFKPNPSPDQAIRSQQTTEETNRQ 316

Query: 300 SQPESAVTVEQNMPHVSDRKV---------PLPRSLENTDKKEEQSNYEINTKSIATTHD 350
             P+       N P V                  +   T  +    NYE++         
Sbjct: 317 PGPQGVPGALSNQPPVPATAPITTPPVGPNQAGAAQTGTTSRSAVLNYEVDRTIQHVKQS 376

Query: 351 NYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITS 410
             +L+RLS+AVVVN    T   G++      D  +A IN +V  A G N  RGDTI + S
Sbjct: 377 LGQLKRLSVAVVVNHRTETLPNGQTQTVPLTDEEVARINNLVREAVGYNPARGDTINVAS 436

Query: 411 MDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAK 470
             F          V +     +          L+  +  L   F  +  L R       +
Sbjct: 437 SPFAGIGP--EPAVPLWKDPEMIELGKEGFKYLLVALAVLFAYFAIIRPLMRTVMPPPPE 494

Query: 471 KGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLR 530
                      P           +                          +   +    R
Sbjct: 495 PEVAEAGEPGEPGFEGEEDVEVTLSGAA---------------------QANTYEAKLAR 533

Query: 531 LLHMIEINEERFAKILRKWARSEIEDRYT 559
              + + + +  A ++R+W     E R +
Sbjct: 534 ARELAKEDPKMVANLIREWMGLNEEGRKS 562


>gi|150395469|ref|YP_001325936.1| flagellar MS-ring protein [Sinorhizobium medicae WSM419]
 gi|150026984|gb|ABR59101.1| flagellar M-ring protein FliF [Sinorhizobium medicae WSM419]
          Length = 557

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 266/552 (48%), Positives = 356/552 (64%), Gaps = 4/552 (0%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M + DQ   F K+ ++LG+ +++ LA   +V I   + A  +VN P ++ LYV LE SDV
Sbjct: 1   MNLFDQFSTFTKNLSNLGQGKLIALAVAGIVAIGFVLGAGVYVNRPSFETLYVGLERSDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
            +IS+AL+EAN+DF +  +G SI VP  M GKAR+ LA +GLP SS+N+GYELFD V S 
Sbjct: 61  TQISIALAEANVDFEVGTDGGSIQVPVGMTGKARLLLAERGLP-SSANAGYELFDNVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQ ISGI AARVHIVMP+ GSFRK    PTASVMIRA 
Sbjct: 120 GLTSFMQEVTRVRALEGEIARTIQQISGIAAARVHIVMPERGSFRKAEQTPTASVMIRAS 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKS-LSIVQAIQH 239
                 +A +IRHLVA++VP LD+ DVTVLDSTG+LL + +   N      L +VQ +Q 
Sbjct: 180 ATVGRSAAASIRHLVASSVPGLDVDDVTVLDSTGQLLASGDDPANSALNQSLGVVQNVQT 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           ++E  I+ ALA FLG+DNFR++V A LN D QQI+E V+DP+S+VERS R+ K+ Q+S  
Sbjct: 240 DLEKKIDNALAPFLGMDNFRTSVTARLNTDAQQIQETVFDPESRVERSTRVIKEEQKSSQ 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
            QP++A TV+QN+P  +       +S +   KKEEQ+NYEIN+K+IAT  ++Y +ERLSI
Sbjct: 300 QQPDNAATVQQNVPQAAPTGGAGQQSSDEAAKKEEQTNYEINSKTIATVKNSYSIERLSI 359

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AVVVN+GRL  + G  ADQ KID+YL ++ KIV++A GI+  RGD +T+ +MDF+E QL 
Sbjct: 360 AVVVNRGRLAAMAGEPADQAKIDAYLVQMQKIVASAAGIDPGRGDVVTLNAMDFVETQLL 419

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
           +        M++L+R+   +INAL F+    LV + G+  L R            G  + 
Sbjct: 420 DQAVPGPGMMEVLTRNIGGIINALAFVAVAFLVVWFGMRPLARQMGFGGQSGQLAGEAAG 479

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSH--SRNLQSRINSYVSKQSDLRLLHMIEI 537
           L  P  S A                  D      +   ++  N  V +  + RL  M+EI
Sbjct: 480 LELPDFSPAAAGAGGALMEGFGSDFGFDGGDDLLNLGDEAGFNRRVKEGPERRLARMVEI 539

Query: 538 NEERFAKILRKW 549
           +EER AKILRKW
Sbjct: 540 SEERAAKILRKW 551


>gi|161621189|ref|YP_001595075.1| flagellar MS-ring protein [Brucella canis ATCC 23365]
 gi|161338000|gb|ABX64304.1| flagellar M-ring protein FliF [Brucella canis ATCC 23365]
          Length = 580

 Score =  378 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 208/561 (37%), Positives = 317/561 (56%), Gaps = 4/561 (0%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
                + Q   +   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 9   NFQQLIEQLKGTLGKLGARKLIALGLVGAALMSAILYMSIYLGRPSYETLYVGLSRDDVN 68

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 69  RMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 127

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 128 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 187

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG-KSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +     N     + S+ Q +   
Sbjct: 188 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASH 247

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  +
Sbjct: 248 VDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNN 307

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLSIA
Sbjct: 308 RNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSKTVSTVSDGYSIKRLSIA 367

Query: 361 VVVNKGRLTEVLGRSADQG-KIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+    
Sbjct: 368 VVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDPAGA 427

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
           +   V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       ++ 
Sbjct: 428 DMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAG 487

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
               P        +       +           +   S +   +   + LRL  MIE++E
Sbjct: 488 EVATPNFIGGAESVGEGVQAVIGGPA-AYADQMKTSLSDLRQRMRMPAKLRLEQMIEMDE 546

Query: 540 ERFAKILRKWARSEIEDRYTQ 560
           ER A +L++W       R   
Sbjct: 547 ERVAAVLKQWIHETASGREAD 567


>gi|320325114|gb|EFW81183.1| flagellar MS-ring protein [Pseudomonas syringae pv. glycinea str.
           B076]
          Length = 594

 Score =  378 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 120/587 (20%), Positives = 220/587 (37%), Gaps = 56/587 (9%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  +I   L
Sbjct: 24  LSFLENLSEMTMLRQIGLMVGLAASVAIGFAVVLWSQQPDYRPLYGSLAGMDSKQIMDTL 83

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + ANI++ +  N  ++ V S  V +ARI LA  G+  + +N G+E+ DK    G + FM+
Sbjct: 84  TAANINYTVEPNSGALLVKSDDVQRARIQLAQAGVVQNDANIGFEILDKDQGLGTSQFME 143

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPSVY 185
                R LEGE+ARTI +++ +  ARVH+ +P    F +   +P+ASV++          
Sbjct: 144 ATRYRRGLEGELARTISALNNVKGARVHLAIPKSSVFVRDDRKPSASVLVELYAGRSLEP 203

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN--ILGKSLSIVQAIQHEIEM 243
               AI +LVA +VP L    +TV+D  G LL+         + GK     + ++  +  
Sbjct: 204 SQVMAIINLVATSVPELSKSQITVVDQKGALLSDQAENSELTMAGKQFDYSRRMEGMLTQ 263

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            +   L   LG D +++ V A ++    +     ++PD    RS +   + QRS +S   
Sbjct: 264 RVQNILQPILGNDRYKAEVSAVVDFSAVESTAESFNPDQPALRSEQSV-NEQRSSSSGTG 322

Query: 304 SAVTVEQNMPHVSDRKVPLPRSL-----------------------------------EN 328
                  N P           +                                      
Sbjct: 323 GVPGALSNQPPGPATAPQNATAGAAGAAGPIAPGQPLLDANGQQIMDPATGQPALAPYPA 382

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEV-LGRSADQGKIDSYLAE 387
             + +   N+E++     T     +L RLS+AVVV+    T    G         + LA 
Sbjct: 383 DKRVQSTKNFELDRSISHTKQQQGRLTRLSVAVVVDDMVKTNAANGEVTRAPWSAADLAR 442

Query: 388 INKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLV 447
             ++V  A G ++ RGD++++ ++ F   +                         +   V
Sbjct: 443 FTRLVQDAVGFDASRGDSVSVINVPFSSERAEVLPEASFYSQPWFWD-------IVKQAV 495

Query: 448 GTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQD 507
           G + +  L    LR +       K +                  G + ND ++L      
Sbjct: 496 GVIFILILVFGVLRPVLTNITTGKSKELAGFGGDAELGRMGGLDGELSNDRVSLGGPQSI 555

Query: 508 IFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
           +            +         +  ++  +  R A+++++W  ++ 
Sbjct: 556 LLPSP--------TEGYDAQLNAIKSLVAEDPGRVAQVVKEWINTDE 594


>gi|220935138|ref|YP_002514037.1| flagellar FliF M-ring protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996448|gb|ACL73050.1| flagellar FliF M-ring protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 552

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 119/565 (21%), Positives = 224/565 (39%), Gaps = 28/565 (4%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
             +  L    +    L   R + L   +   + L  +   ++  P Y  LY  L   +  
Sbjct: 3   NSMAVLSNQVRGFGRLPMERQIGLIVALAAAVALVSSLFMWMTRPSYTVLYPNLAEQESG 62

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           +++ AL   NI +R+     +++VP+  +  AR+ LA +GLP  ++  G+EL ++    G
Sbjct: 63  QVAEALGRHNIPYRLDSATGAVTVPARHLHDARLKLATEGLPR-ATGFGFELLEQDQGLG 121

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
            +  ++     RA+EGE+AR+I ++S + +ARVH+ +P    F +  ++P+ASV++    
Sbjct: 122 TSRLIENARYHRAIEGELARSIATLSSVESARVHLALPAQSVFVRDRSKPSASVLVNLYA 181

Query: 182 PSVYKS--AEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE---MERNILGKSLSIVQA 236
                      I HLVA++VP+L+   VTV+D  G+LLT             + L   + 
Sbjct: 182 GRTLDESRIAGIVHLVASSVPDLEPERVTVVDQRGRLLTQPAGDVDGVMASTQQLDFTRR 241

Query: 237 IQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQR 296
           ++      I   L   LG D  R+ V A+L+    +     +DP+  V RS ++S+D  R
Sbjct: 242 MEESYVRRIMDILTPILGADAVRAQVAADLDFSRIERTTEAFDPEFSVVRSEQISEDESR 301

Query: 297 SETSQPESAVTVEQNMPHVSDRKVPLPRSL------ENTDKKEEQSNYEINTKSIATTHD 350
                         N P  +                  +  +    NYE++         
Sbjct: 302 GGGMM--GVPGALTNQPPEAGVIAEEGNGANGQAQVPGSSSRRTVRNYEVDRTVSHIREA 359

Query: 351 NYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITS 410
              L RLSIAVVV+        G        +  +  I  +V  A G ++RRGD+I + +
Sbjct: 360 PGGLRRLSIAVVVDHKEERNEAGELERVPFTEQEMERITTLVREAVGFDARRGDSINVIN 419

Query: 411 MDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAK 470
             F   +          + +        +   ++ ++  +++    +  L +        
Sbjct: 420 ASFRPVEALELPPEPPIWQE---PWVVDLAKTILAVIMVIVLALTVVRPLLKGL------ 470

Query: 471 KGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLR 530
             E G  +         A+  G +  + + L    Q   +    L         +     
Sbjct: 471 -AERGAAARREDQLGHLALPEGELGEEQLRLGQQPQVQGA----LPGPNTKKNYEDQLDS 525

Query: 531 LLHMIEINEERFAKILRKWARSEIE 555
              M+  + +R A++++ W  S+  
Sbjct: 526 ARGMVREDPKRVAQLMKTWIASDGA 550


>gi|289627784|ref|ZP_06460738.1| flagellar MS-ring protein [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289651625|ref|ZP_06482968.1| flagellar MS-ring protein [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|298487835|ref|ZP_07005875.1| Flagellar M-ring protein fliF [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298157560|gb|EFH98640.1| Flagellar M-ring protein fliF [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330866444|gb|EGH01153.1| flagellar MS-ring protein [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330986489|gb|EGH84592.1| flagellar MS-ring protein [Pseudomonas syringae pv. lachrymans str.
           M301315]
 gi|331011063|gb|EGH91119.1| flagellar MS-ring protein [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 594

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 118/587 (20%), Positives = 219/587 (37%), Gaps = 56/587 (9%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  +I   L
Sbjct: 24  LSFLENLSEMTMLRQIGLMVGLAASVAIGFAVVLWSQQPDYRPLYGSLAGMDSKQIMDTL 83

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + ANI++ +  N  ++ V S  V +ARI LA  G+  + +N G+E+ DK    G + FM+
Sbjct: 84  TAANINYTVEPNSGALLVKSDDVQRARIQLAQAGVVQNDANIGFEILDKDQGLGTSQFME 143

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPSVY 185
                R LEGE+ARTI +++ +  ARVH+ +P    F +   +P+ASV++          
Sbjct: 144 ATRYRRGLEGELARTISALNNVKGARVHLAIPKSSVFVRDDRKPSASVLVELYAGRSLEP 203

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN--ILGKSLSIVQAIQHEIEM 243
               AI +LVA +VP L    +TV+D  G LL+         + GK     + ++  +  
Sbjct: 204 SQVMAIINLVATSVPELSKSQITVVDQKGALLSDQAENSELTMAGKQFDYSRRMEGMLTQ 263

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            +   L   LG D +++ V A ++    +     ++PD    RS +   + + S +S   
Sbjct: 264 RVQNILQPILGNDRYKAEVSAVVDFSAVESTAESFNPDQPALRSEQSVNEQRSSSSS-TG 322

Query: 304 SAVTVEQNMPHVSDRKVPLPRSL-----------------------------------EN 328
                  N P           +                                      
Sbjct: 323 GVPGALSNQPPGPATAPQNATAGAAGAAGPIAPGQPLLDANGQQIMDPATGQPALAPYPA 382

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEV-LGRSADQGKIDSYLAE 387
             + +   N+E++     T     +L RLS+AVVV+    T    G         + LA 
Sbjct: 383 DKRVQSTKNFELDRSISHTKQQQGRLTRLSVAVVVDDMVKTNAANGEVTRAPWSAADLAR 442

Query: 388 INKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLV 447
             ++V  A G ++ RGD++++ ++ F   +                         +   V
Sbjct: 443 FTRLVQDAVGFDASRGDSVSVINVPFSSERAEVLPEASFYSQPWFWD-------IVKQAV 495

Query: 448 GTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQD 507
           G + +  L    LR +       K +                  G + ND ++L      
Sbjct: 496 GVIFILILVFGVLRPVLTNITTGKSKELAGFGGDAELGGMGGLDGELSNDRVSLGGPQSI 555

Query: 508 IFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
           +            +         +  ++  +  R A+++++W  ++ 
Sbjct: 556 LLPSP--------TEGYDAQLNAIKSLVAEDPGRVAQVVKEWINTDE 594


>gi|330876010|gb|EGH10159.1| flagellar MS-ring protein [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
 gi|330967111|gb|EGH67371.1| flagellar MS-ring protein [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 594

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 120/587 (20%), Positives = 222/587 (37%), Gaps = 56/587 (9%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  +I   L
Sbjct: 24  LSFLENLSEMTMLRQIGLMVGLAASVAIGFAVVLWSQQPDYRPLYGSLAGMDSKQIMDTL 83

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + ANI++ +  N  ++ V S  V +ARI LA  G+  + +N G+E+ DK    G + FM+
Sbjct: 84  TAANINYTVEPNSGALLVKSDDVQRARIQLAQAGVVQNDANIGFEILDKDQGLGTSQFME 143

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPSVY 185
                R LEGE+ARTI +++ +  ARVH+ +P    F +   +P+ASV++          
Sbjct: 144 ATRYRRGLEGELARTISALNNVKGARVHLAIPKSSVFVRDDRKPSASVLVELYAGRSLEP 203

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN--ILGKSLSIVQAIQHEIEM 243
               AI +LVA +VP L    +TV+D  G LL+         + GK     + ++  +  
Sbjct: 204 SQVLAIINLVATSVPELSKSQITVVDQKGTLLSDQAENSELTMAGKQFDYSRRMEGMLTQ 263

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            +   L   LG D +++ V A ++    +     ++PD    RS +   + + S +S   
Sbjct: 264 RVQNILQPILGNDRYKAEVSAVVDFSAVESTAESFNPDQPALRSEQSVNEQRSSSSS-TG 322

Query: 304 SAVTVEQNMPH-----------------------------------VSDRKVPLPRSLEN 328
                  N P                                          P       
Sbjct: 323 GVPGALSNQPPGPATAPQNAAAGAAGAAGPIAPGQPLLDANGQQIMDPATGQPALAPYPA 382

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEV-LGRSADQGKIDSYLAE 387
             + +   N+E++     T     +L RLS+AVVV+    T    G  +      + LA 
Sbjct: 383 DKRVQSTKNFELDRSISHTKQQQGRLTRLSVAVVVDDMVKTNAANGEVSRAPWSAADLAR 442

Query: 388 INKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLV 447
             ++V  A G ++ RGD++++ ++ F   +                         +   V
Sbjct: 443 FTRLVQDAVGFDASRGDSVSVINVPFSSERAEVLPEASFYTQPWFWD-------IVKQAV 495

Query: 448 GTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQD 507
           G + +  L    LR + N   + K +                  G + ND ++L      
Sbjct: 496 GVIFILILVFGVLRPVLNNITSGKSKELAGFGGDAELGGMGGLDGELSNDRVSLGGPQSI 555

Query: 508 IFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
           +            +         +  ++  +  R A+++++W  ++ 
Sbjct: 556 LLPSP--------TEGYDAQLNAIKSLVAEDPGRVAQVVKEWINTDE 594


>gi|67641495|ref|ZP_00440272.1| flagellar M-ring protein FliF [Burkholderia mallei GB8 horse 4]
 gi|121601133|ref|YP_994240.1| flagellar MS-ring protein [Burkholderia mallei SAVP1]
 gi|124383455|ref|YP_001028106.1| flagellar MS-ring protein [Burkholderia mallei NCTC 10229]
 gi|126448962|ref|YP_001082916.1| flagellar MS-ring protein [Burkholderia mallei NCTC 10247]
 gi|161579508|ref|YP_104753.2| flagellar MS-ring protein [Burkholderia mallei ATCC 23344]
 gi|167004331|ref|ZP_02270091.1| flagellar M-ring protein FliF [Burkholderia mallei PRL-20]
 gi|254175223|ref|ZP_04881884.1| flagellar M-ring protein FliF [Burkholderia mallei ATCC 10399]
 gi|254201855|ref|ZP_04908219.1| flagellar M-ring protein FliF [Burkholderia mallei FMH]
 gi|254207184|ref|ZP_04913535.1| flagellar M-ring protein FliF [Burkholderia mallei JHU]
 gi|254359688|ref|ZP_04975959.1| flagellar M-ring protein FliF [Burkholderia mallei 2002721280]
 gi|121229943|gb|ABM52461.1| flagellar M-ring protein FliF [Burkholderia mallei SAVP1]
 gi|124291475|gb|ABN00744.1| flagellar M-ring protein FliF [Burkholderia mallei NCTC 10229]
 gi|126241832|gb|ABO04925.1| flagellar M-ring protein FliF [Burkholderia mallei NCTC 10247]
 gi|147747749|gb|EDK54825.1| flagellar M-ring protein FliF [Burkholderia mallei FMH]
 gi|147752726|gb|EDK59792.1| flagellar M-ring protein FliF [Burkholderia mallei JHU]
 gi|148028902|gb|EDK86834.1| flagellar M-ring protein FliF [Burkholderia mallei 2002721280]
 gi|160696268|gb|EDP86238.1| flagellar M-ring protein FliF [Burkholderia mallei ATCC 10399]
 gi|238522438|gb|EEP85882.1| flagellar M-ring protein FliF [Burkholderia mallei GB8 horse 4]
 gi|243060331|gb|EES42517.1| flagellar M-ring protein FliF [Burkholderia mallei PRL-20]
          Length = 598

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 126/525 (24%), Positives = 216/525 (41%), Gaps = 21/525 (4%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 81  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 140

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++S + + AARV++ +P  
Sbjct: 141 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESSNAVRAARVYLAIPKP 198

Query: 162 GSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++              A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 199 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 258

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 259 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYG 318

Query: 280 PDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDR--------KVPLPRSLEN 328
           P+   ++S   S+    S     S          N P             +   P +   
Sbjct: 319 PNGTPQQSAIRSQQTSSSTELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 378

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEI 388
           +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q      LA++
Sbjct: 379 SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLAADKLAQV 438

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  A G + +RGD++ + +  F       +        D++           V    
Sbjct: 439 QQLVKDAMGYDEKRGDSVNVVNSAFSAAADPFANLPWWRQPDMIELGKDIAKWLGVAAAA 498

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
             L       ALRR                     P       GL   D   L   +++ 
Sbjct: 499 AALYFMFVRPALRR---AFPPPAEPAAAAVPALDGPDDMLALDGLPSPDKKQLAEEDEEH 555

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
            +       R      +++      +   + +  A +++ W   E
Sbjct: 556 PALLAFENER---NRYERNLDYARTIARQDPKIVATVVKNWVSDE 597


>gi|62317964|ref|YP_223817.1| flagellar MS-ring protein [Brucella abortus bv. 1 str. 9-941]
 gi|68067522|sp|O52069|FLIF_BRUAB RecName: Full=Flagellar M-ring protein
 gi|62198157|gb|AAX76456.1| FliF, flagellar M-ring protein [Brucella abortus bv. 1 str. 9-941]
          Length = 580

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 207/561 (36%), Positives = 316/561 (56%), Gaps = 4/561 (0%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
                + Q   +   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 9   NFQQLIEQLKGTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 68

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 69  RMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 127

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 128 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 187

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG-KSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +     N     + S+ Q +   
Sbjct: 188 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASH 247

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  +
Sbjct: 248 VDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNN 307

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E  D++EE +NYE+N+K+++T  D Y ++RLSIA
Sbjct: 308 RNDNATGVEQNIPQEQIQNRNGESSTEKMDRREELTNYEVNSKTVSTVSDGYSIKRLSIA 367

Query: 361 VVVNKGRLTEVLGRSADQG-KIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+    
Sbjct: 368 VVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDPAGA 427

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
           +   V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       ++ 
Sbjct: 428 DMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAG 487

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
               P        +       +           +   S +   +   + LRL  MIE++E
Sbjct: 488 EVATPNFIGGAESVGEGVQAVIGGPA-AYADQMKTSLSDLRQRMRMPAKLRLEQMIEMDE 546

Query: 540 ERFAKILRKWARSEIEDRYTQ 560
           ER A +L++W       R   
Sbjct: 547 ERVAAVLKQWIHETASGREAD 567


>gi|28869162|ref|NP_791781.1| flagellar M-ring protein FliF [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213967561|ref|ZP_03395709.1| flagellar M-ring protein FliF [Pseudomonas syringae pv. tomato T1]
 gi|301385734|ref|ZP_07234152.1| flagellar MS-ring protein [Pseudomonas syringae pv. tomato Max13]
 gi|302059423|ref|ZP_07250964.1| flagellar MS-ring protein [Pseudomonas syringae pv. tomato K40]
 gi|302134812|ref|ZP_07260802.1| flagellar MS-ring protein [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|28852402|gb|AAO55476.1| flagellar M-ring protein FliF [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213927862|gb|EEB61409.1| flagellar M-ring protein FliF [Pseudomonas syringae pv. tomato T1]
          Length = 594

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 120/587 (20%), Positives = 222/587 (37%), Gaps = 56/587 (9%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  +I   L
Sbjct: 24  LSFLENLSEMTMLRQIGLMVGLAASVAIGFAVVLWSQQPDYRPLYGSLAGMDSKQIMDTL 83

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + ANI++ +  N  ++ V S  V +ARI LA  G+  + +N G+E+ DK    G + FM+
Sbjct: 84  TAANINYTVEPNSGALLVKSDDVQRARIQLAQAGVVQNDANIGFEILDKDQGLGTSQFME 143

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPSVY 185
                R LEGE+ARTI +++ +  ARVH+ +P    F +   +P+ASV++          
Sbjct: 144 ATRYRRGLEGELARTISALNNVKGARVHLAIPKSSVFVRDDRKPSASVLVELYAGRSLEP 203

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN--ILGKSLSIVQAIQHEIEM 243
               AI +LVA +VP L    +TV+D  G LL+         + GK     + ++  +  
Sbjct: 204 SQVLAIINLVATSVPELSKSQITVVDQKGTLLSDQAENSELTMAGKQFDYSRRMEGMLTQ 263

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            +   L   LG D +++ V A ++    +     ++PD    RS +   + + S +S   
Sbjct: 264 RVQNILQPILGNDRYKAEVSAVVDFSAVESTAESFNPDQPALRSEQSVNEQRSSSSS-TG 322

Query: 304 SAVTVEQNMPH-----------------------------------VSDRKVPLPRSLEN 328
                  N P                                          P       
Sbjct: 323 GVPGALSNQPPGPATAPQNAAAGAAGAAGPIAPGQPLLDANGQQIMDPATGQPALAPYPA 382

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEV-LGRSADQGKIDSYLAE 387
             + +   N+E++     T     +L RLS+AVVV+    T    G  +      + LA 
Sbjct: 383 DKRVQSTKNFELDRSISHTKQQQGRLTRLSVAVVVDDMVKTNAANGEVSRAPWSAADLAR 442

Query: 388 INKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLV 447
             ++V  A G ++ RGD++++ ++ F   +                         +   V
Sbjct: 443 FTRLVQDAVGFDASRGDSVSVINVPFSSERAEVLPEASFYSQPWFWD-------IVKQAV 495

Query: 448 GTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQD 507
           G + +  L    LR + N   + K +                  G + ND ++L      
Sbjct: 496 GVIFILILVFGVLRPVLNNITSGKSKELAGFGGDAELGGMGGLDGELSNDRVSLGGPQSI 555

Query: 508 IFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
           +            +         +  ++  +  R A+++++W  ++ 
Sbjct: 556 LLPSP--------TEGYDAQLNAIKSLVAEDPGRVAQVVKEWINTDE 594


>gi|315121860|ref|YP_004062349.1| flagellar MS-ring protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495262|gb|ADR51861.1| flagellar MS-ring protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 560

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 420/560 (75%), Positives = 480/560 (85%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           MAI+DQLLQFFKS  SLGR R+ I+ +V+   I L +AA FF++SP YD+LYVKLE SDV
Sbjct: 1   MAIIDQLLQFFKSAMSLGRMRLFIVGAVMFASIALLLAASFFMSSPIYDSLYVKLEASDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           N+ISVALSEA+IDFRI+ NGSSI VPS ++ KAR+ LA QGLP+SS+NSGYELFDKVNSF
Sbjct: 61  NKISVALSEASIDFRIAGNGSSILVPSHLLSKARLRLAEQGLPNSSNNSGYELFDKVNSF 120

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQEITRVRALEGEI+RTIQ ISGIVAARVHIVMPDMGSFR+IGA+PTASVM+R +
Sbjct: 121 GLTSFMQEITRVRALEGEISRTIQDISGIVAARVHIVMPDMGSFRRIGAKPTASVMVRVV 180

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHE 240
           NPSVYKSAEAIRHLVAAAVP LD+ DVTVLDSTGKLL ANE+ERNI GKSL IVQA+QHE
Sbjct: 181 NPSVYKSAEAIRHLVAAAVPGLDISDVTVLDSTGKLLVANEIERNIFGKSLGIVQAVQHE 240

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           IEMNINKALA FLG+DNFRSAV+AELN D QQI+EIVYDPDS+VERS+RLSKD QRSE+ 
Sbjct: 241 IEMNINKALAPFLGIDNFRSAVIAELNTDIQQIKEIVYDPDSRVERSVRLSKDVQRSESH 300

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           Q ESAVTVEQNMPHVS++    PR+LENTDKKEEQSNYEINTKSI+TTH+NYKLERLSIA
Sbjct: 301 QQESAVTVEQNMPHVSEKNATSPRALENTDKKEEQSNYEINTKSISTTHNNYKLERLSIA 360

Query: 361 VVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN 420
           VVVNKGRL E+LG S +Q K+DSYLAEIN+IVSAATGINS RGD ITITSMDFL++QL N
Sbjct: 361 VVVNKGRLMEMLGPSMEQSKVDSYLAEINRIVSAATGINSIRGDNITITSMDFLDDQLLN 420

Query: 421 SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL 480
           S TVQVSFMDILSR+F+ +INAL FL   LL+   G+H LR  +NID  K+ E+  KS L
Sbjct: 421 SSTVQVSFMDILSRNFSIIINALFFLTLVLLMALFGVHVLRGFNNIDLIKRKEMEAKSAL 480

Query: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540
           S P I+S   T LM +D++A DS  QDI S + N QS IN+YV++QSD RLL MIEINEE
Sbjct: 481 STPSIASTAETTLMSSDDMASDSFRQDILSRNNNFQSDINNYVAEQSDRRLLRMIEINEE 540

Query: 541 RFAKILRKWARSEIEDRYTQ 560
           RF+KI+RKW RSEIE RYTQ
Sbjct: 541 RFSKIIRKWVRSEIESRYTQ 560


>gi|241203091|ref|YP_002974187.1| flagellar MS-ring protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240856981|gb|ACS54648.1| flagellar M-ring protein FliF [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 563

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 294/564 (52%), Positives = 393/564 (69%), Gaps = 10/564 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M +L+QL+Q FK+  SLGRTR++IL  V  V I + +AA  FVN P  + LYV L+  D+
Sbjct: 1   MNLLNQLVQIFKNFGSLGRTRLMILGGVGAVSIAIVLAAALFVNKPAQETLYVGLDSPDL 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           N+IS+AL+EANI+F++  +G+SISVP+ M GKAR+ LA +GLP +S+N+GYELFD V S 
Sbjct: 61  NQISMALAEANINFQVGTDGTSISVPAGMTGKARLMLAERGLP-NSANAGYELFDNVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQSISGI AARVHIVMP++G+FRK   +PTASVMIRA 
Sbjct: 120 GLTSFMQEVTRVRALEGEIARTIQSISGITAARVHIVMPEVGNFRKAEQKPTASVMIRAS 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL-GKSLSIVQAIQH 239
             +   +A +IRHLVA+AVP LD+ DVT+LDS G+LL + +   N    +SL+IVQ +Q 
Sbjct: 180 ATTGRSAATSIRHLVASAVPGLDVDDVTILDSAGQLLASGDEASNSSLNRSLNIVQNVQQ 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           E+E NI+KALA FLG+DNFRS+V A+LN D QQI+E  YDP+SKVERS+R +K+AQ+S+ 
Sbjct: 240 EVESNIDKALAPFLGMDNFRSSVTADLNTDAQQIQETTYDPESKVERSVRSTKEAQQSQQ 299

Query: 300 SQPESAVTVEQNMPHVSDRKVP--LPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
            Q +SA TVEQN+P  +        P S + +DK+EEQ+NYEIN+K+ ATT  +YK+E+L
Sbjct: 300 KQSDSATTVEQNIPQAAPEAGGSAGPESQDKSDKREEQTNYEINSKTTATTRSSYKVEKL 359

Query: 358 SIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           SIAVVVNKGR+ +++G  ADQ K+D+YLAE+ KIV++A GI+++RGD +T+T+MDFLENQ
Sbjct: 360 SIAVVVNKGRIAKMVGEPADQTKVDAYLAEMQKIVASAAGIDAKRGDVVTVTAMDFLENQ 419

Query: 418 LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA------KK 471
           L    T  V  MD+LSR+ A +IN+L F+    LV ++GL  L R  + + +        
Sbjct: 420 LLEDATGGVRVMDMLSRNLAGIINSLAFVAVAFLVVWMGLRPLVRSVSGNGSSAAFGDAT 479

Query: 472 GEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRL 531
            E  G  +    P S A    LM          + +      +     N  V +  + +L
Sbjct: 480 PEAAGLELPDFAPASGAPGGALMDGFGSDFGFDSTEDLLSLGDDDGNFNRRVKEGPERKL 539

Query: 532 LHMIEINEERFAKILRKWARSEIE 555
             M+EINEER AKILRKWA  E  
Sbjct: 540 SRMVEINEERAAKILRKWAIDEAA 563


>gi|331017004|gb|EGH97060.1| flagellar MS-ring protein [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 594

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 120/587 (20%), Positives = 222/587 (37%), Gaps = 56/587 (9%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  +I   L
Sbjct: 24  LSFLENLSEMTMLRQIGLMVGLAASVAIGFAVVLWSQQPDYRPLYGSLAGIDSKQIMDTL 83

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + ANI++ +  N  ++ V S  V +ARI LA  G+  + +N G+E+ DK    G + FM+
Sbjct: 84  TAANINYTVEPNSGALLVKSDDVQRARIQLAQAGVVQNDANIGFEILDKDQGLGTSQFME 143

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPSVY 185
                R LEGE+ARTI +++ +  ARVH+ +P    F +   +P+ASV++          
Sbjct: 144 ATRYRRGLEGELARTISALNNVKGARVHLAIPKSSVFVRDDRKPSASVLVELYAGRSLEP 203

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN--ILGKSLSIVQAIQHEIEM 243
               AI +LVA +VP L    +TV+D  G LL+         + GK     + ++  +  
Sbjct: 204 SQVLAIINLVATSVPELSKSQITVVDQKGTLLSDQAENSELTMAGKQFDYSRRMEGMLTQ 263

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            +   L   LG D +++ V A ++    +     ++PD    RS +   + + S +S   
Sbjct: 264 RVQNILQPILGNDRYKAEVSAVVDFSAVESTAESFNPDQPALRSEQSVNEQRSSSSS-TG 322

Query: 304 SAVTVEQNMPH-----------------------------------VSDRKVPLPRSLEN 328
                  N P                                          P       
Sbjct: 323 GVPGALSNQPPGPATAPQNAAAGAAGAAGPIAPGQPLLDANGQQIMDPATGQPALAPYPA 382

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEV-LGRSADQGKIDSYLAE 387
             + +   N+E++     T     +L RLS+AVVV+    T    G  +      + LA 
Sbjct: 383 DKRVQSTKNFELDRSISHTKQQQGRLTRLSVAVVVDDMVKTNAANGEVSRAPWSAADLAR 442

Query: 388 INKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLV 447
             ++V  A G ++ RGD++++ ++ F   +                         +   V
Sbjct: 443 FTRLVQDAVGFDASRGDSVSVINVPFSSERAEVLPEASFYSQPWFWD-------IVKQAV 495

Query: 448 GTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQD 507
           G + +  L    LR + N   + K +                  G + ND ++L      
Sbjct: 496 GVIFILILVFGVLRPVLNNITSGKSKELAGFGGDAELGGMGGLDGELSNDRVSLGGPQSI 555

Query: 508 IFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
           +            +         +  ++  +  R A+++++W  ++ 
Sbjct: 556 LLPSP--------TEGYDAQLNAIKSLVAEDPGRVAQVVKEWINTDE 594


>gi|71734724|ref|YP_275541.1| flagellar MS-ring protein [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|71555277|gb|AAZ34488.1| flagellar M-ring protein FliF [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 594

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 118/587 (20%), Positives = 219/587 (37%), Gaps = 56/587 (9%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  +I   L
Sbjct: 24  LSFLENLSEMTMLRQIGLMVGLAASVAIGFAVVLWSQQPDYRPLYGSLAGMDSKQIMDTL 83

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + ANI++ +  N  ++ V S  V +ARI LA  G+  + +N G+E+ DK    G + FM+
Sbjct: 84  TAANINYTVEPNSGALLVKSDDVQRARIQLAQAGVVQNDANIGFEILDKDQGLGTSQFME 143

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPSVY 185
                R LEGE+ARTI +++ +  ARVH+ +P    F +   +P+ASV++          
Sbjct: 144 ATRYRRGLEGELARTISALNNVKGARVHLAIPKSSVFVRDDRKPSASVLVELYAGRSLEP 203

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN--ILGKSLSIVQAIQHEIEM 243
               AI +LVA +VP L    +TV+D  G LL+         + GK     + ++  +  
Sbjct: 204 SQVMAIINLVATSVPELSKSQITVVDQKGALLSDQAENSELTMAGKQFDYSRRMEGMLTQ 263

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            +   L   LG D +++ V A ++    +     ++PD    RS +   + + S +S   
Sbjct: 264 RVQNILQPILGNDRYKAEVSAVVDFSAVESTAESFNPDQPALRSEQSVNEQRSSSSS-TG 322

Query: 304 SAVTVEQNMPHVSDRKVPLPRSL-----------------------------------EN 328
                  N P           +                                      
Sbjct: 323 GVPGALSNQPPGPATAPQNATAGAAGAAGPIAPGQPLLDANGQQIMDPATGQPALAPYPA 382

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEV-LGRSADQGKIDSYLAE 387
             + +   N+E++     T     +L RLS+AVVV+    T    G         + LA 
Sbjct: 383 DKRVQSTKNFELDRSISHTKQQQGRLTRLSVAVVVDDMVKTNAANGEVTRAPWSAADLAR 442

Query: 388 INKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLV 447
             ++V  A G ++ RGD++++ ++ F   +                         +   V
Sbjct: 443 FTRLVQDAVGFDASRGDSVSVINVPFSIERAEVLPEASFYSQPWFWD-------IVKQAV 495

Query: 448 GTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQD 507
           G + +  L    LR +       K +                  G + ND ++L      
Sbjct: 496 GVIFILILVFGVLRPVLTNITTGKSKELAGFGGDAELGGMGGLDGELSNDRVSLGGPQSI 555

Query: 508 IFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
           +            +         +  ++  +  R A+++++W  ++ 
Sbjct: 556 LLPSP--------TEGYDAQLNAIKSLVAEDPGRVAQVVKEWINTDE 594


>gi|170748099|ref|YP_001754359.1| flagellar MS-ring protein [Methylobacterium radiotolerans JCM 2831]
 gi|170654621|gb|ACB23676.1| flagellar M-ring protein FliF [Methylobacterium radiotolerans JCM
           2831]
          Length = 546

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 194/560 (34%), Positives = 309/560 (55%), Gaps = 17/560 (3%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M   + L + + +   LG  R++ L  V L   +      ++++ P  + LY  L   DV
Sbjct: 1   MPGREHLQKLWTNILDLGPRRLIALGLVGLTVFLAVGLGAYYLSRPLRETLYSGLSRDDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           +R+  AL +A I F IS +G+S+ V      +AR+ LA +GLP S   +GYELF+ + S 
Sbjct: 61  SRMGAALKDAGIPFDISADGTSVLVSYGQTAQARMLLAEKGLPQSG-KAGYELFNDLGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQ+ITRVRALEGEIARTIQ++  + AARVHIVMPD GSFR+     +ASV++R  
Sbjct: 120 GLTSFMQDITRVRALEGEIARTIQTLKSVKAARVHIVMPDPGSFRREQQPASASVVVRTE 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLS-IVQAIQH 239
             +    A AIR LVAAA+P +    VTVL++ G +L A +         L+ + Q++  
Sbjct: 180 PANDATVAPAIRQLVAAAIPGMKPDKVTVLNTDGTVLLAGDDATTAPAGRLANLEQSVNR 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           EI+ NI + L  +LG +NF  +VVA LN D  +  E +++PD KVERS+R  K++  S+ 
Sbjct: 240 EIQDNIRRTLTPYLGPNNFEVSVVARLNTDKTKTDETIFNPDQKVERSLRTIKESDSSQN 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
             P+   T +QN+P    R      S   + ++EE +N+EI++K++ T  D Y ++ LS+
Sbjct: 300 RAPQKPTTAQQNLPDQRVRSEGAENSSAESQRREELTNFEISSKTVQTVSDGYSIKTLSV 359

Query: 360 AVVVNKGRLTEVLGRSA--DQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           AV+VN+ RL  + G +       +D  +AEI ++V++A G+N  RGD + + ++ F++  
Sbjct: 360 AVLVNRSRLEALAGGAKGGTAPPLDPQVAEIEQLVTSAAGVNRARGDQLKVAAVSFIDEG 419

Query: 418 LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGK 477
              +    + F D+L R   T+INA   L+   L+ + GL       N   A+  E G +
Sbjct: 420 QPLAPAPALGFTDVLMRQSGTLINAATILIVGCLLIWFGLRPAV---NAILARPAETGTE 476

Query: 478 SILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEI 537
             L+ P   S +             S+ +   S   +L   +  ++++    +L  ++E+
Sbjct: 477 LALATPDAGSGLDG----------PSAEKGGTSPEPSLIEDLTEHMARSPIRKLEQLVEL 526

Query: 538 NEERFAKILRKWARSEIEDR 557
           +EE+ A IL++W   E   R
Sbjct: 527 DEEQVANILKQWLTREEVAR 546


>gi|329901251|ref|ZP_08272776.1| Flagellar M-ring protein fliF [Oxalobacteraceae bacterium IMCC9480]
 gi|327549183|gb|EGF33775.1| Flagellar M-ring protein fliF [Oxalobacteraceae bacterium IMCC9480]
          Length = 564

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 123/567 (21%), Positives = 222/567 (39%), Gaps = 43/567 (7%)

Query: 13  SGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANI 72
           S       R L+L     + I +      +   P Y  L+      D   I   L + N+
Sbjct: 16  SFAESQGGRNLLLMLGAAIVIAVMAGVWMWSQQPDYRVLFSNFTDRDGGAIVTQLQQMNV 75

Query: 73  DFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRV 132
            ++ ++ G +I VP+  V  AR+ +AA GLP    N G+EL  +    G++ F++++   
Sbjct: 76  PYKFAEGGGAILVPADQVHDARLRIAAMGLPK-GGNVGFELM-ENQKLGVSQFLEQVNFQ 133

Query: 133 RALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVY--KSAEA 190
           RALEGE+AR++QSI  + +ARVH+ MP    F +   +PTASV++          +   A
Sbjct: 134 RALEGELARSVQSIGAVESARVHLAMPKASVFVRDQQKPTASVVLNLNPGRSLSEQQVSA 193

Query: 191 IRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG---KSLSIVQAIQHEIEMNINK 247
           I HLVA++VP+L  G+++V+D  G LL+         G     L  +Q +Q  I   I  
Sbjct: 194 IVHLVASSVPDLPPGNISVIDQNGNLLSDTSKAAKATGLDPTQLKYIQEVQQNIVRRIES 253

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE--TSQPESA 305
            +   +G +N R+   A+++  T +     Y P+S   +S   S+ +  S+         
Sbjct: 254 IITPIVGPNNVRAEATADIDFSTSEQAAETYKPNSPPNQSTMRSQQSSESQGSNPGAGGV 313

Query: 306 VTVEQNMPHVS------------------DRKVPLPRSLENTDKKEEQSNYEINTKSIAT 347
                N P  +                          +     +K+   NYE++      
Sbjct: 314 PGALSNQPAANATAPINPPAPAPAPAAGQGVSTGATATAAVPSQKDMTVNYEVDKTVRYV 373

Query: 348 THDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTIT 407
                 ++R+S+AVVVN  ++T+  G+       ++   +I  +V  A G N  RGDT+ 
Sbjct: 374 QQPMGGVKRISVAVVVNYKQVTDKAGKVTATPLTEAERVQITDLVKEAMGFNKDRGDTLN 433

Query: 408 ITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNID 467
           + +  F          V +     + +    +   L+  +  L + F  L  + +  N  
Sbjct: 434 VVNSAFAGVPKEVFPEVPIWKRPEMIQLAKELGKYLLGGIALLYLFFGVLRPMLKKFNTP 493

Query: 468 DAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQS 527
             K   V                        +  +S++                   +Q+
Sbjct: 494 QPKIRAVVDDEDDEAETPEMRAMHAAERTTEVPAESASMA----------------YQQN 537

Query: 528 DLRLLHMIEINEERFAKILRKWARSEI 554
                 + + + +  A I++ W     
Sbjct: 538 LDLAKQLAKDDPKVVANIVKNWVSGNE 564


>gi|167034925|ref|YP_001670156.1| flagellar MS-ring protein [Pseudomonas putida GB-1]
 gi|166861413|gb|ABY99820.1| flagellar M-ring protein FliF [Pseudomonas putida GB-1]
          Length = 592

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 119/584 (20%), Positives = 232/584 (39%), Gaps = 57/584 (9%)

Query: 10  FFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSE 69
           F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  ++   L+ 
Sbjct: 27  FLENISQMPMLRQIGLMVGLAASVAIGFAVVLWSQQPDYRPLYGSLSGMDTKQVMDTLAA 86

Query: 70  ANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEI 129
           A+I + +  N  ++ V +  + +AR+ LAA G+  S  N G+EL DK    G + FM+  
Sbjct: 87  ADIPYNVEPNSGALLVKADDLSRARLKLAAAGVAPSDGNVGFELLDKEQGLGTSQFMEAT 146

Query: 130 TRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--S 187
              R+LEGE+ART+ S++ + AARVH+ +P    F +   +P+ASV++        +   
Sbjct: 147 RYRRSLEGELARTVSSLNNVKAARVHLAIPKSSVFVRDERKPSASVLVELYPGRALEAGQ 206

Query: 188 AEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA--NEMERNILGKSLSIVQAIQHEIEMNI 245
             AI +LVA +VP LD   VTV+D  G LL+    +      GK     + ++  +   +
Sbjct: 207 VMAIVNLVATSVPELDKSQVTVVDQKGNLLSEQIQDSSLTQAGKQFDYSRRVESMLTQRV 266

Query: 246 NKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESA 305
           +  L   LG D +++ V A+L+    +     ++PD    RS +   + + S +  P+  
Sbjct: 267 HNILQPVLGNDRYKAEVSADLDFSAVESTSEQFNPDQPALRSEQSVDEQRAS-SQGPQGV 325

Query: 306 VTVEQNMPHVSDRKVPLPRSL----------------------------------ENTDK 331
                N P  +                                             +  +
Sbjct: 326 PGALSNQPPGAASAPQTTGGAATPASAIQPGQPLVDANGQQIMDPATGQPMLAPYPSDKR 385

Query: 332 KEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEV-LGRSADQGKIDSYLAEINK 390
           ++   N+E++     T     ++ RLS+AVVV+     +   G +         LA   +
Sbjct: 386 QQSTKNFELDRSISHTRQQQGRMTRLSVAVVVDDQVKLDPATGDATRAPWAAEDLARFTR 445

Query: 391 IVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTL 450
           +V  A G ++ RGD++T+ ++ F  ++      +           F  ++  ++ +V  L
Sbjct: 446 LVQDAVGFDASRGDSVTVINVPFAADRGEEIADIAF----YQQPWFWDIVKQVLGVVFIL 501

Query: 451 LVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFS 510
           ++ F  L  +         +       S             G + ND ++L      +  
Sbjct: 502 VLVFGVLRPVLNNITGGGKQAA-----SDSDMELGGMMGLDGELANDRVSLGGPTSILLP 556

Query: 511 HSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                     S   +     +  ++  +  R A++++ W  ++ 
Sbjct: 557 SP--------SEGYEAQLNAIKGLVAEDPGRVAQVVKDWINADE 592


>gi|320329373|gb|EFW85366.1| flagellar MS-ring protein [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330880568|gb|EGH14717.1| flagellar MS-ring protein [Pseudomonas syringae pv. glycinea str.
           race 4]
          Length = 594

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 118/587 (20%), Positives = 219/587 (37%), Gaps = 56/587 (9%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  +I   L
Sbjct: 24  LSFLENLSEMTMLRQIGLMVGLAASVAIGFAVVLWSQQPDYRPLYGSLAGMDSKQIMDTL 83

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + ANI++ +  N  ++ V S  V +ARI LA  G+  + +N G+E+ DK    G + FM+
Sbjct: 84  TAANINYTVEPNSGALLVKSDDVQRARIQLAQAGVVQNDANIGFEILDKDQGLGTSQFME 143

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPSVY 185
                R LEGE+ARTI +++ +  ARVH+ +P    F +   +P+ASV++          
Sbjct: 144 ATRYRRGLEGELARTISALNNVKGARVHLAIPKSSVFVRDDRKPSASVLVELYAGRSLEP 203

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN--ILGKSLSIVQAIQHEIEM 243
               AI +LVA +VP L    +TV+D  G LL+         + GK     + ++  +  
Sbjct: 204 SQVMAIINLVATSVPELSKSQITVVDQKGALLSDQAENSELTMAGKQFDYSRRMEGMLTQ 263

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            +   L   LG D +++ V A ++    +     ++PD    RS +   + + S +S   
Sbjct: 264 RVQNILQPILGNDRYKAEVSAVVDFSAVESTAESFNPDQPALRSEQSVNEQRSSSSS-TG 322

Query: 304 SAVTVEQNMPHVSDRKVPLPRSL-----------------------------------EN 328
                  N P           +                                      
Sbjct: 323 GVPGALSNQPPGPATAPQNATAGAAGAAGPIAPGQPLLDANGQQIMDPATGQPALAPYPA 382

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEV-LGRSADQGKIDSYLAE 387
             + +   N+E++     T     +L RLS+AVVV+    T    G         + LA 
Sbjct: 383 DKRVQSTKNFELDRSISHTKQQQGRLTRLSVAVVVDDMVKTNAANGEVTRAPWSAADLAR 442

Query: 388 INKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLV 447
             ++V  A G ++ RGD++++ ++ F   +                         +   V
Sbjct: 443 FTRLVQDAVGFDASRGDSVSVINVPFSSERAEVLPEASFYSQPWFWD-------IVKQAV 495

Query: 448 GTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQD 507
           G + +  L    LR +       K +                  G + ND ++L      
Sbjct: 496 GVIFILILVFGVLRPVLTNITTGKSKELAGFGGDAELGRMGGLDGELSNDRVSLGGPQSI 555

Query: 508 IFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
           +            +         +  ++  +  R A+++++W  ++ 
Sbjct: 556 LLPSP--------TEGYDAQLNAIKSLVAEDPGRVAQVVKEWINTDE 594


>gi|325918317|ref|ZP_08180454.1| flagellar basal-body M-ring protein/flagellar hook-basal body
           protein FliF [Xanthomonas vesicatoria ATCC 35937]
 gi|325535457|gb|EGD07316.1| flagellar basal-body M-ring protein/flagellar hook-basal body
           protein FliF [Xanthomonas vesicatoria ATCC 35937]
          Length = 574

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 118/568 (20%), Positives = 231/568 (40%), Gaps = 28/568 (4%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           ++  Q+F    SL  TR L + ++I + +   +A  F+   P Y +LY  L+       +
Sbjct: 15  EKAGQWFDRVRSLQITRKLTMMAMIALAVGAGLAVFFWSQKPGYQSLYTGLDEKGNAEAA 74

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L  A I F+I     +ISVP   +  AR+ LA  GL    +  G+EL +K   FG++ 
Sbjct: 75  DLLRTAQIPFKIDQGTGAISVPQDRLYDARLKLAGSGLTGKETGGGFELMEKDPGFGVSQ 134

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INP 182
           F++      ALE E++RTI ++  +  ARVH+ +P   +F +     +ASV++       
Sbjct: 135 FVENARYQHALETELSRTIGTLRPVREARVHLAIPKPSAFTRQRDVASASVVLELRGGQG 194

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL--GKSLSIVQAIQHE 240
                 +AI +LVA+++P++    VTV+D +G++L+  +   +          V+  +  
Sbjct: 195 LERNQVDAIVNLVASSIPDMTPERVTVVDQSGRMLSIADPNSDAAQHAAQFEQVRRQESS 254

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
               I + L    G       V  +++    +    +Y+ +    RS ++S     +  +
Sbjct: 255 YNQRIRELLEPMTGPGRVNPEVSVDMDFSVVEEARELYNGEPAKLRSEQVS--DSSTSAT 312

Query: 301 QPESAVTVEQNMPHV--------------SDRKVPLPRSLENTDKKEEQSNYEINTKSIA 346
            P+       N P                +        +      K    NYE++     
Sbjct: 313 GPQGPPGATSNSPGQPPAPAVAGAPGTPAAANGQAAAPAAPTESSKSATRNYELDRTLQH 372

Query: 347 TTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTI 406
           T     +++R+S+AV+++        G+  +Q    + L  I  +V  A G ++ RGDT+
Sbjct: 373 TRQPAGRIKRVSVAVLLDNVPRPGAKGKMVEQPLTAAELTRIEGLVKQAVGFDAARGDTV 432

Query: 407 TITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNI 466
           ++ +  F+   +      +      +       +  LV  V  L + F  +    R    
Sbjct: 433 SVMNAPFVREAVAGEEGPKWWEDPRVQN----GLRLLVGAVVVLALLFGVVRPTLRQLTG 488

Query: 467 DDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQ 526
             A K +  G      P         ++  DN  +     D     +  ++ I    + +
Sbjct: 489 VTAVKDKERGAGNDGTPQS---ADVRMVNEDNDLMPGLEDDTAQIGQEKKTPIALPDAYE 545

Query: 527 SDLRL-LHMIEINEERFAKILRKWARSE 553
             +R+    ++ + +R A++++ W  SE
Sbjct: 546 ERMRVAREAVKADSKRVAQVVKGWVASE 573


>gi|148558201|ref|YP_001258009.1| flagellar MS-ring protein [Brucella ovis ATCC 25840]
 gi|148369486|gb|ABQ62358.1| flagellar M-ring protein FliF [Brucella ovis ATCC 25840]
          Length = 568

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 208/556 (37%), Positives = 317/556 (57%), Gaps = 4/556 (0%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           + Q   +   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVNR+ +A
Sbjct: 2   IEQLKGTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVNRMGLA 61

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S GLTSFM
Sbjct: 62  LGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLGLTSFM 120

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           QEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA      +
Sbjct: 121 QEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEGGFSAE 180

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG-KSLSIVQAIQHEIEMNI 245
           SA++IR LVAAAVP+LD   VTVLD+ G LL +     N     + S+ Q +   ++ +I
Sbjct: 181 SAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASHVDDSI 240

Query: 246 NKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESA 305
            KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  ++ ++A
Sbjct: 241 RKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNNRNDNA 300

Query: 306 VTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNK 365
             VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLSIAVV+++
Sbjct: 301 TGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSKTVSTVSDGYSIKRLSIAVVIDQ 360

Query: 366 GRLTEVLGRSADQG-KIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTV 424
            RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+    +   V
Sbjct: 361 ARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDPAGADMEPV 420

Query: 425 QVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPP 484
              + D L R   +  NAL  L    L+ + GL  L R  N+  A       ++     P
Sbjct: 421 SAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAGEVATP 480

Query: 485 ISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAK 544
                   +       +           +   S +   +   + LRL  MIE++EER A 
Sbjct: 481 NFIGGAESVGEGVQAVIGGPA-AYADQMKTSLSDLRQRMRMPAKLRLEQMIEMDEERVAA 539

Query: 545 ILRKWARSEIEDRYTQ 560
           +L++W       R   
Sbjct: 540 VLKQWIHETASGREAD 555


>gi|285018180|ref|YP_003375891.1| flagellar biosynthesis lipoprotein flif [Xanthomonas albilineans
           GPE PC73]
 gi|283473398|emb|CBA15903.1| probable flagellar biosynthesis lipoprotein flif [Xanthomonas
           albilineans]
          Length = 569

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 121/567 (21%), Positives = 227/567 (40%), Gaps = 29/567 (5%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           ++   +F    SL  TR + L ++I V +   +   F+   P Y  LY  L+       +
Sbjct: 13  EKAGAWFDRLQSLQITRRIGLMAMIAVAVAAGLFVFFWSQKPDYTPLYTGLDEKGTAEAT 72

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L  A I F++  +  +I+VP   +  AR+ LA  GL  SS N G+E+ +K   FG++ 
Sbjct: 73  DLLRTAQIPFKLDPSTGAITVPQEKLYDARLKLAGSGLTDSSGNMGFEVMEKDPGFGVSQ 132

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN--P 182
           F++      ALE E+ARTI S+  +  ARVH+ +P   +F +     +ASV++       
Sbjct: 133 FVENARYQHALETELARTIASLRPVREARVHLAIPKPSAFTRQREAASASVVLELRGGNT 192

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL--GKSLSIVQAIQHE 240
                 +AI ++VA+++P+L    VTV+D +G++LT  +   +          ++  +  
Sbjct: 193 LERNQVDAIVNMVASSIPDLSPNRVTVVDQSGRMLTIADPNSDAALNAAQFDQIRRQESS 252

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
               I + L    G       V  +++    +    +Y+ D    RS ++S     +   
Sbjct: 253 FNQRIRELLEPMTGPGRVNPEVSVDMDFSVTEEARELYNGDPPKLRSEQVS--DSNTSKG 310

Query: 301 QPESAVTVEQNMPHVSDRKV-------------PLPRSLENTDKKEEQSNYEINTKSIAT 347
            P+       N P  +                     +      K    NYE++     T
Sbjct: 311 GPQGVPGATSNSPGATPTGQPAAAGTPAAAAGANQQAANPTESSKSATRNYELDRTLQHT 370

Query: 348 THDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTIT 407
                +++R+S+AV+V+        G+  +Q    + L  I  +V  A G N+ RGDT++
Sbjct: 371 RQPAGRIKRVSVAVLVDHVPRPGPKGKMVEQALSAAELTRIEGLVKQAVGFNAERGDTVS 430

Query: 408 ITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNID 467
           + +  F+      +                + +  ++     L + F  L    R     
Sbjct: 431 VMNAPFVHEATETTDKPSWWQDPR----VMSGLRMVLGAAVVLALLFGVLRPALRQIAGP 486

Query: 468 DAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQS 527
               G     +              ++ + N  L S  +D  S + +    I    + + 
Sbjct: 487 APAAGAKDKDNATPHDAKL-----SMLEDGNPMLQSLGEDTASIAGSGNPAIALPDAYEE 541

Query: 528 DLRL-LHMIEINEERFAKILRKWARSE 553
            LRL    ++ + +R A++++ W  SE
Sbjct: 542 RLRLAREAVKQDSKRVAQVVKGWVASE 568


>gi|148546737|ref|YP_001266839.1| flagellar MS-ring protein [Pseudomonas putida F1]
 gi|148510795|gb|ABQ77655.1| flagellar M-ring protein FliF [Pseudomonas putida F1]
          Length = 592

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 118/584 (20%), Positives = 231/584 (39%), Gaps = 57/584 (9%)

Query: 10  FFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSE 69
           F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  ++   L+ 
Sbjct: 27  FLENISQMPMLRQIGLMVGLAASVAIGFAVVLWSQQPDYRPLYGSLSGMDTKQVMDTLAA 86

Query: 70  ANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEI 129
           A+I + +  N  ++ V +  + +AR+ LAA G+  S  N G+EL DK    G + FM+  
Sbjct: 87  ADIPYNVEPNSGALLVKADDLSRARLKLAAAGVAPSDGNVGFELLDKEQGLGTSQFMEAT 146

Query: 130 TRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--S 187
              R+LEGE+ART+ S++ + AARVH+ +P    F +   +P+ASV++        +   
Sbjct: 147 RYRRSLEGELARTVSSLNNVKAARVHLAIPKSSVFVRDERKPSASVLVELYPGRALEAGQ 206

Query: 188 AEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA--NEMERNILGKSLSIVQAIQHEIEMNI 245
             AI +LVA +VP LD   VTV+D  G LL+    +      GK     + ++  +   +
Sbjct: 207 VMAIVNLVATSVPELDKSQVTVVDQKGNLLSEQIQDSALTQAGKQFDYSRRVESMLTQRV 266

Query: 246 NKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESA 305
           +  L   LG D +++ V A+L+    +     ++PD    RS +   + + S +  P+  
Sbjct: 267 HNILLPVLGNDRYKAEVSADLDFSAVESTSEQFNPDQPALRSEQSVDEQRAS-SQGPQGV 325

Query: 306 VTVEQNMPHVSDRKVPLPRSL----------------------------------ENTDK 331
                N P  +                                             +  +
Sbjct: 326 PGALSNQPPGAASAPQTTGGAATPAAAIQPGQPLVDANGQQIMDPATGQPMLAPYPSDKR 385

Query: 332 KEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGR-LTEVLGRSADQGKIDSYLAEINK 390
           ++   N+E++     T     ++ RLS+AVVV+    +    G +         LA   +
Sbjct: 386 QQSTKNFELDRSISHTRQQQGRMTRLSVAVVVDDQVKIDPATGDTTRAPWGAEDLARFTR 445

Query: 391 IVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTL 450
           +V  A G ++ RGD++T+ ++ F  ++      +           F  ++  ++ +V  L
Sbjct: 446 LVQDAVGFDASRGDSVTVINVPFAADRGEEIADIAF----YQQPWFWDIVKQVLGVVFIL 501

Query: 451 LVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFS 510
           ++ F  L  +         +                     G + ND ++L      +  
Sbjct: 502 VLVFGVLRPVLNNITGGGKQAA-----PDSDMELGGMMGLDGELANDRVSLGGPTSILLP 556

Query: 511 HSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                     S   +     +  ++  +  R A++++ W  ++ 
Sbjct: 557 SP--------SEGYEAQLNAIKGLVAEDPGRVAQVVKDWINADE 592


>gi|306845426|ref|ZP_07478000.1| flagellar M-ring protein FliF [Brucella sp. BO1]
 gi|306274169|gb|EFM55985.1| flagellar M-ring protein FliF [Brucella sp. BO1]
          Length = 575

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 207/561 (36%), Positives = 317/561 (56%), Gaps = 4/561 (0%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
                + Q   +   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 4   NFQQLIEQLKGTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 63

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA+I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 64  RMGLALGEADIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 122

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEIT VRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 123 LTSFMQEITHVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 182

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG-KSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +     N     + S+ Q +   
Sbjct: 183 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALITASLEQQVASH 242

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  +
Sbjct: 243 VDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNN 302

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLSIA
Sbjct: 303 RNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSKTVSTVSDGYSIKRLSIA 362

Query: 361 VVVNKGRLTEVLGRSADQG-KIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+    
Sbjct: 363 VVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNANRGDVINVTAVNFLDPAGA 422

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
           +   V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       ++ 
Sbjct: 423 DMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAG 482

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
               P        +       +           +   S +   +   + LRL  MIE++E
Sbjct: 483 EVAMPNFIGGAESVGEGVQAVIGGPA-AYADQMKTSLSDLRQRMRMPAKLRLEQMIEMDE 541

Query: 540 ERFAKILRKWARSEIEDRYTQ 560
           ER A +L++W       R   
Sbjct: 542 ERVAAVLKQWIHETASGREAD 562


>gi|313497796|gb|ADR59162.1| FliF [Pseudomonas putida BIRD-1]
          Length = 592

 Score =  376 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 118/584 (20%), Positives = 231/584 (39%), Gaps = 57/584 (9%)

Query: 10  FFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSE 69
           F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  ++   L+ 
Sbjct: 27  FLENISQMPMLRQIGLMVGLAASVAIGFAVVLWSQQPDYRPLYGSLSGMDTKQVMDTLAA 86

Query: 70  ANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEI 129
           A+I + +  N  ++ V +  + +AR+ LAA G+  S  N G+EL DK    G + FM+  
Sbjct: 87  ADIPYNVEPNSGALLVKADDLSRARLKLAAAGVAPSDGNVGFELLDKEQGLGTSQFMETT 146

Query: 130 TRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--S 187
              R+LEGE+ART+ S++ + AARVH+ +P    F +   +P+ASV++        +   
Sbjct: 147 RYRRSLEGELARTVSSLNNVKAARVHLAIPKSSVFVRDERKPSASVLVELYPGRALEAGQ 206

Query: 188 AEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA--NEMERNILGKSLSIVQAIQHEIEMNI 245
             AI +LVA +VP LD   VTV+D  G LL+    +      GK     + ++  +   +
Sbjct: 207 VMAIVNLVATSVPELDKSQVTVVDQKGNLLSEQIQDSALTQAGKQFDYSRRVESMLTQRV 266

Query: 246 NKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESA 305
           +  L   LG D +++ V A+L+    +     ++PD    RS +   + + S +  P+  
Sbjct: 267 HNILQPVLGNDRYKAEVSADLDFSAVESTSEQFNPDQPALRSEQSVDEQRAS-SQGPQGV 325

Query: 306 VTVEQNMPHVSDRKVPLPRSL----------------------------------ENTDK 331
                N P  +                                             +  +
Sbjct: 326 PGALSNQPPGAASAPQTTGGAATPAAAIQPGQPLVDANGQQIMDPATGQPMLAPYPSDKR 385

Query: 332 KEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGR-LTEVLGRSADQGKIDSYLAEINK 390
           ++   N+E++     T     ++ RLS+AVVV+    +    G +         LA   +
Sbjct: 386 QQSTKNFELDRSISHTRQQQGRMTRLSVAVVVDDQVKIDPATGDTTRAPWGAEDLARFTR 445

Query: 391 IVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTL 450
           +V  A G ++ RGD++T+ ++ F  ++      +           F  ++  ++ +V  L
Sbjct: 446 LVQDAVGFDASRGDSVTVINVPFAADRGEEIADIAF----YQQPWFWDIVKQVLGVVFIL 501

Query: 451 LVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFS 510
           ++ F  L  +         +                     G + ND ++L      +  
Sbjct: 502 VLVFGVLRPVLNNITGGGKQAA-----PDSDMELGGMMGLDGELANDRVSLGGPTSILLP 556

Query: 511 HSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                     S   +     +  ++  +  R A++++ W  ++ 
Sbjct: 557 SP--------SEGYEAQLNAIKGLVAEDPGRVAQVVKDWINADE 592


>gi|161610775|ref|NP_946615.2| flagellar MS-ring protein [Rhodopseudomonas palustris CGA009]
          Length = 538

 Score =  376 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 137/551 (24%), Positives = 233/551 (42%), Gaps = 21/551 (3%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           +         LG  R++ + +V +  +  F      V+ P    LY  L V D + I   
Sbjct: 1   MQNLLGFLKGLGAARLMAMIAVTVALVGFFAFVIMRVSQPQMTTLYTDLSVEDSSSIIKE 60

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L    I F + ++G+ + VP   V + R+ LA           GYE+FDK ++ G TSF+
Sbjct: 61  LERQGIPFEMRNDGAILLVPKDKVTRLRMKLAEG-GLPKGGGVGYEIFDKSDALGTTSFV 119

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           Q I  +RALEGE++RTI++I  + AARVH+V+P+   F +    P+AS+++R       +
Sbjct: 120 QNINHLRALEGELSRTIRAIDRVQAARVHLVLPERPLFSREAPEPSASIVLRVRGALEPQ 179

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNI--LGKSLSIVQAIQHEIEMN 244
              AIRHLVA+AV  L    V+++D  G+LL              S     A +  +   
Sbjct: 180 QVRAIRHLVASAVNGLKPQRVSIVDEAGQLLADGSASGEQVEGATSDERRAAFEKRMRNQ 239

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPES 304
           I   +++ +G    R  V A+ + +        +DP+ +V RS +  ++   + TS  + 
Sbjct: 240 IEGIVSSVVGSGRARVQVSADFDYNKITQTSDKFDPEGRVLRSSQTREE--SAATSAADG 297

Query: 305 AVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVN 364
            VTV   +P  +  +     + + + K EE +NYEI+  +     +  ++ RLS+AV+V+
Sbjct: 298 QVTVNNELPGAN--QGQGAGARDVSKKSEETNNYEISRVTKTEVTEAGRVNRLSVAVLVD 355

Query: 365 KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTV 424
                   G      +    L  I  +V +A G + +RGD I + ++ F E         
Sbjct: 356 GAYTKNDKGELVYAERPKEQLDRIAALVRSAIGFDQKRGDQIEVVNLKFAEAPQVEKLPE 415

Query: 425 QV---SFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILS 481
                            +I   V  +  L+V F+ +  L +     +      GG   L+
Sbjct: 416 PAGLMGMFQFTKDDIMNMIQLGVMFLLGLVVLFMVIRPLVKRILAAEPAPEAAGGLPALA 475

Query: 482 PPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEER 541
              +             I  D         S    +++   V  QS  R+  + E N   
Sbjct: 476 DGTVP-----------QIGADGQPVPASVPSMIDIAQVQGQVHAQSVHRVGELAERNPNE 524

Query: 542 FAKILRKWARS 552
            A I+R+W   
Sbjct: 525 TAAIIRQWLAE 535


>gi|104782821|ref|YP_609319.1| flagellar MS-ring protein [Pseudomonas entomophila L48]
 gi|95111808|emb|CAK16532.1| flagellar basal-body M-ring protein FliF [Pseudomonas entomophila
           L48]
          Length = 592

 Score =  376 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 118/584 (20%), Positives = 236/584 (40%), Gaps = 57/584 (9%)

Query: 10  FFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSE 69
           F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  ++   L+ 
Sbjct: 27  FLENISQMPMLRQVGLLVGLAASVAIGFAVVLWSQQPDYRPLYGSLAGMDTKQVMDTLAS 86

Query: 70  ANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEI 129
           A+I + +  N  ++ V +  + +AR+ LAA G+  S  N G+EL DK    G + FM+  
Sbjct: 87  ADIPYHVEPNSGALLVKADDLSRARLKLAAAGVAPSDGNVGFELLDKEQGLGTSQFMETT 146

Query: 130 TRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--S 187
              R+LEGE+ART+ S++ + AARVH+ +P    F +   +P+ASV++        +   
Sbjct: 147 RYRRSLEGELARTVSSLNNVKAARVHLAIPKSSVFVRDERKPSASVLVELYPGRALEAGQ 206

Query: 188 AEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA--NEMERNILGKSLSIVQAIQHEIEMNI 245
             AI +LVA +VP LD   VTV+D  G LL+    +   ++ GK     + ++  +   +
Sbjct: 207 VMAIVNLVATSVPELDKSQVTVVDQKGNLLSDQLQDTALSMAGKQFDYSRRMEGLLTQRV 266

Query: 246 NKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESA 305
           +  L   LG D +++ V A+++    +     ++PD    RS +   + + S +  P+  
Sbjct: 267 HNILQPVLGNDRYKAEVSADVDFSAVESTSEQFNPDQPALRSEQSVNEQRAS-SQGPQGV 325

Query: 306 VTVEQNMPHVSDRKVPLPRSL----------------------------------ENTDK 331
                N P          R+                                    +  +
Sbjct: 326 PGALSNQPPAGASAPENARAAATPAGAIQPGQPLVDANGQQIMDPATGQPMLAPYPSDKR 385

Query: 332 KEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVL-GRSADQGKIDSYLAEINK 390
           ++   N+E++     T     +L RLS+AVVV+     +   G +         LA   +
Sbjct: 386 QQSTKNFELDRSISHTRQQQGRLTRLSVAVVVDDQVKLDAASGEATRTPWGAEDLARFTR 445

Query: 391 IVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTL 450
           +V  A G ++ RGD++T+ ++ F  ++      +           F  ++  ++ ++  L
Sbjct: 446 LVQDAVGFDASRGDSVTVINVPFAADRGDELVDIPF----YSQPWFWDIVKQVLGVLFIL 501

Query: 451 LVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFS 510
           ++ F  L  +         +       +             G + ND ++L      +  
Sbjct: 502 VLVFGVLRPVLTNITGGGKQAA-----TDSDMELGGMIGLDGELANDRVSLGGPTSILLP 556

Query: 511 HSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                     S   +     +  ++  +  R A+++++W  ++ 
Sbjct: 557 SP--------SEGYEAQLNAIKGLVAEDPGRVAQVVKEWINADE 592


>gi|122065185|sp|Q8YDM4|FLIF_BRUME RecName: Full=Flagellar M-ring protein
          Length = 580

 Score =  376 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 207/561 (36%), Positives = 317/561 (56%), Gaps = 4/561 (0%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
                + Q   +   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 9   NFQQLIEQLKGTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 68

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 69  RMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 127

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 128 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 187

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG-KSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +     N     + S+ Q +   
Sbjct: 188 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASH 247

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  +
Sbjct: 248 VDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNN 307

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E TD++EE +NYE+N+ +++T  D Y ++RLSIA
Sbjct: 308 RNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSMTVSTVSDGYSIKRLSIA 367

Query: 361 VVVNKGRLTEVLGRSADQG-KIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL++   
Sbjct: 368 VVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDSAGA 427

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
           +   V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       ++ 
Sbjct: 428 DMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAG 487

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
               P        +       +           +   S +   +   + LRL  MIE++E
Sbjct: 488 EVATPNFIGGAESVGEGVQAVIGGPA-AYADQMKTSLSDLRQRMRMPAKLRLEQMIEMDE 546

Query: 540 ERFAKILRKWARSEIEDRYTQ 560
           ER A +L++W       R   
Sbjct: 547 ERVAAVLKQWIHETASGREAD 567


>gi|192289867|ref|YP_001990472.1| flagellar MS-ring protein [Rhodopseudomonas palustris TIE-1]
 gi|192283616|gb|ACE99996.1| flagellar M-ring protein FliF [Rhodopseudomonas palustris TIE-1]
          Length = 538

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 137/551 (24%), Positives = 233/551 (42%), Gaps = 21/551 (3%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           +         LG  R++ + +V +  +  F      V+ P    LY  L V D + I   
Sbjct: 1   MQNLLGFLKGLGAARLMAMIAVTVALVGFFAFVIMRVSQPQMTTLYTDLSVEDSSSIIKE 60

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L    I F + ++G+ + VP   V + R+ LA           GYE+FDK ++ G TSF+
Sbjct: 61  LERQGIPFEMRNDGAILMVPKDKVTRLRMKLAEG-GLPKGGGVGYEIFDKSDALGTTSFV 119

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           Q I  +RALEGE++RTI++I  + AARVH+V+P+   F +    P+AS+++R       +
Sbjct: 120 QNINHLRALEGELSRTIRAIDRVQAARVHLVLPERPLFSREAPEPSASIVLRVRGALEPQ 179

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNI--LGKSLSIVQAIQHEIEMN 244
              AIRHLVA+AV  L    V+++D  G+LL              S     A +  +   
Sbjct: 180 QVRAIRHLVASAVNGLKPQRVSIVDEAGQLLADGSASGEQVEGATSDERRAAFEKRMRNQ 239

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPES 304
           I   +++ +G    R  V A+ + +        +DP+ +V RS +  ++   + TS  + 
Sbjct: 240 IEGIVSSVVGSGRARVQVSADFDYNKITQTSDKFDPEGRVLRSSQTREE--SAATSAADG 297

Query: 305 AVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVN 364
            VTV   +P  +  +     + + + K EE +NYEI+  +     +  ++ RLS+AV+V+
Sbjct: 298 QVTVNNELPGAN--QGQGAGARDVSKKSEETNNYEISRVTKTEVTEAGRVNRLSVAVLVD 355

Query: 365 KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTV 424
                   G      +    L  I  +V +A G + +RGD I + ++ F E         
Sbjct: 356 GAYTKNDKGELVYAERPKEQLDRIAALVRSAIGFDQKRGDQIEVVNLKFAEAPQVEKLPE 415

Query: 425 QV---SFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILS 481
                            +I   V  +  L+V F+ +  L +     +      GG   L+
Sbjct: 416 PAGLMGMFQFTKDDIMNMIQLGVMFLLGLVVLFMVIRPLVKRILAAEPAPEAAGGLPALA 475

Query: 482 PPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEER 541
              +             I  D         S    +++   V  QS  R+  + E N   
Sbjct: 476 DGTVP-----------QIGADGQPVPASVPSMIDIAQVQGQVHAQSVHRVGELAERNPNE 524

Query: 542 FAKILRKWARS 552
            A I+R+W   
Sbjct: 525 TAAIIRQWLAE 535


>gi|26991058|ref|NP_746483.1| flagellar MS-ring protein [Pseudomonas putida KT2440]
 gi|24986091|gb|AAN69947.1|AE016633_5 flagellar basal-body M-ring protein FliF [Pseudomonas putida
           KT2440]
          Length = 592

 Score =  375 bits (963), Expect = e-101,   Method: Composition-based stats.
 Identities = 118/584 (20%), Positives = 231/584 (39%), Gaps = 57/584 (9%)

Query: 10  FFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSE 69
           F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  ++   L+ 
Sbjct: 27  FLENISQMPMLRQIGLLVGLAASVAIGFAVVLWSQQPDYRPLYGSLSGMDTKQVMDTLAA 86

Query: 70  ANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEI 129
           A+I + +  N  ++ V +  + +AR+ LAA G+  S  N G+EL DK    G + FM+  
Sbjct: 87  ADIPYNVEPNSGALLVKADDLSRARLKLAAAGVAPSDGNVGFELLDKEQGLGTSQFMEAT 146

Query: 130 TRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--S 187
              R+LEGE+ART+ S++ + AARVH+ +P    F +   +P+ASV++        +   
Sbjct: 147 RYRRSLEGELARTVSSLNNVKAARVHLAIPKSSVFVRDERKPSASVLVELYPGRALEAGQ 206

Query: 188 AEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA--NEMERNILGKSLSIVQAIQHEIEMNI 245
             AI +LVA +VP LD   VTV+D  G LL+    +      GK     + ++  +   +
Sbjct: 207 VMAIVNLVATSVPELDKSQVTVVDQKGNLLSEQIQDSALTQAGKQFDYSRRVESMLTQRV 266

Query: 246 NKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESA 305
           +  L   LG D +++ V A+L+    +     ++PD    RS +   + + S +  P+  
Sbjct: 267 HNILQPVLGNDRYKAEVSADLDFSAVESTSEQFNPDQPALRSEQSVDEQRAS-SQGPQGV 325

Query: 306 VTVEQNMPHVSDRKVPLPRSL----------------------------------ENTDK 331
                N P  +                                             +  +
Sbjct: 326 PGALSNQPPGAASAPQTTGGAATPAAAIQPGQPLVDANGQQIMDPATGQPMLAPYPSDKR 385

Query: 332 KEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGR-LTEVLGRSADQGKIDSYLAEINK 390
           ++   N+E++     T     ++ RLS+AVVV+    +    G +         LA   +
Sbjct: 386 QQSTKNFELDRSISHTRQQQGRMARLSVAVVVDDQVKIDPATGDTTRAPWGAEDLARFTR 445

Query: 391 IVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTL 450
           +V  A G ++ RGD++T+ ++ F  ++      +           F  ++  ++ +V  L
Sbjct: 446 LVQDAVGFDASRGDSVTVINVPFAADRGEEIADIAF----YQQPWFWDIVKQVLGVVFIL 501

Query: 451 LVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFS 510
           ++ F  L  +         +                     G + ND ++L      +  
Sbjct: 502 VLVFGVLRPVLNNITGGGKQAA-----PDSDMELGGMMGLDGELANDRVSLGGPTSILLP 556

Query: 511 HSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                     S   +     +  ++  +  R A++++ W  ++ 
Sbjct: 557 SP--------SEGYEAQLNAIKGLVAEDPGRVAQVVKDWINADE 592


>gi|209884352|ref|YP_002288208.1| flagellar M-ring protein FliF [Oligotropha carboxidovorans OM5]
 gi|209872548|gb|ACI92344.1| flagellar M-ring protein FliF [Oligotropha carboxidovorans OM5]
          Length = 537

 Score =  375 bits (962), Expect = e-101,   Method: Composition-based stats.
 Identities = 122/551 (22%), Positives = 226/551 (41%), Gaps = 22/551 (3%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           +        SLG  R+  + +V +  +  F      V +P    LY  L   D   +   
Sbjct: 1   MQGLVSFIRSLGAARLAAMLAVAMALLGFFGFVILRVTAPQMITLYTDLGYDDAAGVIKE 60

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L    I + + ++G+ I VP   V + R+ LA  GLP   S  GYE+FDK  + G TSF+
Sbjct: 61  LDRQGIPYEMKNDGAIIMVPKDKVTRLRMKLAESGLPK-GSGVGYEIFDKSETLGSTSFV 119

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           Q +  +RALEGE+ARTI++I  I   RVH+V+P+   F +    P+A++++R       +
Sbjct: 120 QNVNHLRALEGELARTIKAIDRIQGVRVHLVLPERPLFSREKPEPSAAIVVRVRGALEAQ 179

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA--NEMERNILGKSLSIVQAIQHEIEMN 244
              AIRHLVA++V  L    V+++D  G+LL     +        +     A ++ +   
Sbjct: 180 QVRAIRHLVASSVNGLKPQRVSIVDENGQLLADGSGDANGMGDVGADERRVAYENRLRKQ 239

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPES 304
           I   + + +G    R  + A+ + +        +DP+ +V RS +  +++  +       
Sbjct: 240 IESIVTSVVGGGRARVQLSADFDYNKVTETSDKFDPEGRVLRSSQTREESSATSNGLNGQ 299

Query: 305 AVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVN 364
                 N    + ++       +   K EE +NYEI+  +     +  +++R+S+AV+V+
Sbjct: 300 V--TVNNEMPGNQQQNAANAGKDQAKKSEEINNYEISRTTKTEVTEAGRVQRMSVAVLVD 357

Query: 365 KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTV 424
                   G      +    L  I  +V +A G +  RGD + + ++ F +         
Sbjct: 358 GVYSRNEKGDQVYAPRSQEDLERIATLVRSAIGFDKARGDQVEVVNLRFADAPSAIPLPD 417

Query: 425 QVSF---MDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILS 481
              +              I   V  + +++V F+ +  L +    +D            +
Sbjct: 418 SNGWLSVFQFTKDDVMYFIELGVMSLLSIVVVFMVVRPLVKRVLAEDVPLANAAPALPEA 477

Query: 482 PPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEER 541
           P P              +A+        +      +++   V  QS  R+  + + N   
Sbjct: 478 PQP--------------VAVAGPVHTAATAQMIDVAQVQGQVHAQSVHRVGELADRNPNE 523

Query: 542 FAKILRKWARS 552
              I+R+W   
Sbjct: 524 TVAIIRQWLTE 534


>gi|227820842|ref|YP_002824812.1| flagellar MS-ring protein [Sinorhizobium fredii NGR234]
 gi|227339841|gb|ACP24059.1| flagellar M-ring protein FliF [Sinorhizobium fredii NGR234]
          Length = 559

 Score =  375 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 268/554 (48%), Positives = 365/554 (65%), Gaps = 6/554 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M + DQ   F K+ ++LG+++++ LA   +V I   + A  +VN P Y+ LYV LE SDV
Sbjct: 1   MNLFDQFSTFTKNLSNLGQSKLIALAVAGIVAIGFVLGAAIYVNKPAYETLYVGLERSDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
            +IS+AL+EAN+DF +  +G SI VP  M GKAR+ LA +GLP SS+N+GYELFD V S 
Sbjct: 61  TQISIALAEANLDFEVGSDGGSIQVPVGMTGKARLLLAERGLP-SSANAGYELFDNVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQ ISGI AARVHIVMP+ GSFRK    PTASVMIRA 
Sbjct: 120 GLTSFMQEVTRVRALEGEIARTIQQISGIAAARVHIVMPERGSFRKAEQTPTASVMIRAS 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKS-LSIVQAIQH 239
                 +A +IRHLVA++VP LD+ DVT+LDSTG+LL + +   N      L +VQ +Q 
Sbjct: 180 ATVGRGAASSIRHLVASSVPGLDIDDVTILDSTGQLLASGDDPANSALNQSLGVVQNVQT 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           ++E  I+ ALA FLG+DNFR++V A LN D QQI+E V+DP+S+VERS R+ K+ Q+S  
Sbjct: 240 DLEKKIDNALAPFLGMDNFRTSVTASLNTDAQQIQETVFDPESRVERSTRVIKEEQKSSQ 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
            QP++A TV+QN+P  + R     +S +   KKEEQ+NYEIN+K+IAT  ++Y +ERLSI
Sbjct: 300 QQPDNAATVQQNVPQAAPRGGAGQQSNDEAAKKEEQTNYEINSKTIATVKNSYSIERLSI 359

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AVVVN+GRL  ++G  ADQ KID+YL ++ KIV++A G+++ RGD +T+ +MDF+E QL 
Sbjct: 360 AVVVNRGRLAAMVGEGADQAKIDAYLQDMQKIVASAAGVDTNRGDVVTLNAMDFVETQLL 419

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
           +        M++L+R+   +IN+L F++   LV +LG+  L R            G  + 
Sbjct: 420 DQAVAGPGVMEMLTRNLGGIINSLAFILVAFLVVWLGMRPLARQMGFGGQSGHLEGEGAG 479

Query: 480 LSPPPISS----AVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMI 535
           L  P  S     A    LM          + D   +  +  +  N  V +  + RL  M+
Sbjct: 480 LELPDFSPAGASAAGGALMEGFGSDFGFDSTDDLLNISDEGNGFNRRVKEGPERRLARMV 539

Query: 536 EINEERFAKILRKW 549
           EI+EER AKILRKW
Sbjct: 540 EISEERAAKILRKW 553


>gi|182679604|ref|YP_001833750.1| flagellar MS-ring protein [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182635487|gb|ACB96261.1| flagellar M-ring protein FliF [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 547

 Score =  375 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 195/556 (35%), Positives = 308/556 (55%), Gaps = 11/556 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M + +Q+ + + +   LG  R++ LA V +    +   A +F++ P  + LY  L+  DV
Sbjct: 1   MTVREQIERLWANLLKLGTKRLITLAVVGVSVFAMTGLAGYFLSRPALEVLYSGLDRQDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           +RI+ AL EA+I F ++ +G+S+ V      +AR+ LA +GLP +S N+G ELFDK+ S 
Sbjct: 61  SRIASALKEADIPFDVNADGNSVLVRFGETARARMLLAEKGLP-NSPNAGNELFDKLGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGE+ARTIQ + G+ AARVHIVMPD GSFR+    P+ASV++R  
Sbjct: 120 GLTSFMQEVTRVRALEGELARTIQLMHGVKAARVHIVMPDEGSFRRTRQPPSASVVVRME 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAIQH 239
           +     +A+AIRHLVA+AVP + + +VTVL++ G LL +  +         + + +A+  
Sbjct: 180 SNDDPSAAKAIRHLVASAVPGMTVEEVTVLNTEGVLLASGADTVDGAPSGMIMLEKAVSR 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           EI  NI K L  +LG+ NF+ +V A LN D +Q  E +Y+PDSKVERSI +++  Q S+ 
Sbjct: 240 EIIDNIRKTLTPYLGLRNFQISVAARLNTDKRQTNETIYNPDSKVERSIHVTRQNQNSQN 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
           S  +S  +VE+N+P  + R     +S E + K++E +NYEI++K + T    Y ++ LS+
Sbjct: 300 STVQSPTSVERNLPQENARSDDGKQSTEESQKRDELTNYEISSKVVNTVSGGYGIDNLSV 359

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AV+VN+  L   LG       +   + EI  +V++A G +  RGD + I+++DF++    
Sbjct: 360 AVLVNRASLISSLGEKPTPDALAKQMNEIEMLVASAAGAHKERGDIVKISAVDFIDPSHE 419

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
                  S  ++  R    ++NA   LV  +L+ + GL           A K  +     
Sbjct: 420 LEPQPPPSIGEMFLRQSTNLVNAATILVVAILLIWFGLRP---------ATKAILANTRS 470

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
            +               D+ A  +          NL   + S        RL  ++E +E
Sbjct: 471 TATAIDLRDEEEFQALEDDDAPPALPVWSPPSEPNLIEDLTSTPRHTPQKRLEQIVEYDE 530

Query: 540 ERFAKILRKWARSEIE 555
           ++ A +L++W     E
Sbjct: 531 QQAAAVLKQWIHQGEE 546


>gi|330972435|gb|EGH72501.1| flagellar MS-ring protein [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 594

 Score =  375 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 120/586 (20%), Positives = 222/586 (37%), Gaps = 56/586 (9%)

Query: 9   QFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALS 68
            F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  +I   L+
Sbjct: 25  SFLENLSEMTMLRQIGLMVGLAASVAIGFAVVLWSQQPDYRPLYGSLAGMDSKQIMDTLT 84

Query: 69  EANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQE 128
            ANI++ +  N  ++ V S  V +ARI LA  G+  + +N G+E+ DK    G + FM+ 
Sbjct: 85  AANINYTVEPNSGALLVKSDDVQRARIQLAQAGVVQNDANIGFEILDKDQGLGTSQFMEA 144

Query: 129 ITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPSVYK 186
               R LEGE+ARTI +++ +  ARVH+ +P    F +   +P+ASV++           
Sbjct: 145 TRYRRGLEGELARTISALNNVKGARVHLAIPKSSVFVRDDRKPSASVLVELYAGRSLEPS 204

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN--ILGKSLSIVQAIQHEIEMN 244
              AI +LVA +VP L    +TV+D  G LL+         + GK     + ++  +   
Sbjct: 205 QVMAIINLVATSVPELSKSQITVVDQKGTLLSDQAENSELTMAGKQFDYSRRMEGMLTQR 264

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPES 304
           +   L   LG D +++ V A ++    +     ++PD    RS +   + QRS +S    
Sbjct: 265 VQNILQPILGNDRYKAEVSAVVDFSAVESTAESFNPDQPALRSEQSV-NEQRSSSSSSGG 323

Query: 305 AVTVEQNMPHVSDRKVPLPRSL-----------------------------------ENT 329
                 N P                                                   
Sbjct: 324 VPGALSNQPPGPATAPQTAGGGAAGAAGPIAPGQPLLDANGQQIMDPATGQPALAPYPAD 383

Query: 330 DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEV-LGRSADQGKIDSYLAEI 388
            + +   N+E++     T     +L RLS+AVVV+    T    G         + LA  
Sbjct: 384 KRVQSTKNFELDRSISHTKQQQGRLTRLSVAVVVDDMVKTNAANGEVTRAPWSAADLARF 443

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  A G ++ RGD++++ ++ F   +                  F  ++   V ++ 
Sbjct: 444 TRLVQDAVGFDASRGDSVSVINVPFSSERAEVLPEASF----YSQPWFWDIVKQAVGVIF 499

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
            L++ F  L  +         K+    G               G + ND ++L      +
Sbjct: 500 ILILVFGVLRPVLNNITNGKRKELAGFGG---DAELGGMGGLDGELSNDRVSLGGPQSIL 556

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                       +         +  ++  +  R A+++++W  ++ 
Sbjct: 557 LPSP--------TEGYDAQLNAIKSLVAEDPGRVAQVVKEWINTDE 594


>gi|115522990|ref|YP_779901.1| flagellar MS-ring protein [Rhodopseudomonas palustris BisA53]
 gi|115516937|gb|ABJ04921.1| flagellar M-ring protein FliF [Rhodopseudomonas palustris BisA53]
          Length = 535

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 136/551 (24%), Positives = 229/551 (41%), Gaps = 23/551 (4%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           +         LG  R++ + +V    I  F      V +P    L+  L V D + I   
Sbjct: 1   MEGLVNFLKGLGAARLMAMIAVTAALIGFFAFVILRVTTPQMTTLFTDLSVEDSSGIIKD 60

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L    I F I + GS I VP   V + R+ LA  GLP      GYE+FDK  + G TSF+
Sbjct: 61  LERQAIPFEIRNEGSVIMVPKDKVTRLRMKLAEAGLPKGGG-VGYEIFDKSEALGSTSFV 119

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           Q I  +RALEGE+ARTI++I  I AARVH+V+P+   F +    P+AS+++R       +
Sbjct: 120 QNINHLRALEGELARTIRAIDRIQAARVHLVLPERPLFSRETPEPSASIVLRVRGALEPQ 179

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG--KSLSIVQAIQHEIEMN 244
              AIRH+VA+AV  L    V+++D  G+LL                    A +  +   
Sbjct: 180 QVRAIRHVVASAVNGLKPQRVSIVDEAGQLLADGAAGDPSTEGVTGDERRAAFEKRMRNQ 239

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPES 304
           +   +++ +G    R  + A+ + +        +DP+ +       S++   +  +  + 
Sbjct: 240 VEAIVSSVVGTGRARVQLTADFDYNKITQTSDKFDPEGR-VLRSSQSREESSATLNPTDG 298

Query: 305 AVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVN 364
            VTV   +P          R  + + K EE +NYEI+  +     +  ++ R+S+AV+V+
Sbjct: 299 QVTVNNELPGAQGGAGAAAR--DQSKKSEETNNYEISRVTKTEVTEVGRVNRVSVAVLVD 356

Query: 365 KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ---LFNS 421
                   G    Q +    L  I  +V +A G + +RGD + I ++ F E       N 
Sbjct: 357 GLYNKNDKGELVYQERSKEELDRIAALVRSAIGFDQKRGDQVEIVNLRFAEGPAVVPINE 416

Query: 422 GTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILS 481
            T  +  +         VI   V ++  ++V F+ +  L R     +             
Sbjct: 417 PTGILGMLKFTKDDVMYVIELGVMMLLGMVVIFMVIRPLVRRILAAEPGSPTALPALTDG 476

Query: 482 PPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEER 541
                           ++  D         S    +++   V  QS  R+  + + N   
Sbjct: 477 TV--------------SVGADGQPLPTPGPSMIDIAQVQGQVHAQSVHRVGELADRNPNE 522

Query: 542 FAKILRKWARS 552
            A I+R+W + 
Sbjct: 523 TAAIIRQWLQE 533


>gi|254785458|ref|YP_003072887.1| flagellar MS-ring protein [Teredinibacter turnerae T7901]
 gi|237683992|gb|ACR11256.1| flagellar M-ring protein FliF [Teredinibacter turnerae T7901]
          Length = 558

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 116/561 (20%), Positives = 225/561 (40%), Gaps = 25/561 (4%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           +      +   +L   R   L   +   + +  A   +     Y  LY  L+  D   + 
Sbjct: 11  NPAGDLIEGFNNLNLIRQAGLMVGLAASVAIGFAVVLWSQGEDYKPLYGSLDRLDSAEVG 70

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L   +I ++I  +  ++ VP   + KARI LA  G+       G+EL D+    G + 
Sbjct: 71  QVLDFNDIPYKIDGSTGALLVPVDKLQKARILLAENGI-QGDKTIGFELLDQEQPLGTSQ 129

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS- 183
           FM+     R+LEGE+ARTI SI+ + +ARVH+ +P    F + G  P+ASV +       
Sbjct: 130 FMEATRYRRSLEGELARTIASINSVRSARVHLAIPKRSVFVRDGREPSASVFLDLYPGRP 189

Query: 184 -VYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL--TANEMERNILGKSLSIVQAIQHE 240
              K    I +LVAA++P LD  +VT++D  G L+     + +     + L   + ++ +
Sbjct: 190 IKPKQIAGIANLVAASIPELDSTNVTIVDQKGNLMEVAPEDEKLAQASQHLDYTRKVEDD 249

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           I + I + L   +G  NF++ V A+L+    +     ++PD    RS + S++ +     
Sbjct: 250 IVLRIRRLLTPIIGDANFKTEVAADLDFTEMEQAAETFNPDLPAIRSEQTSEEQRIGAGG 309

Query: 301 QPESAVTVEQNMPHVSDRK-------VPLPRSLENTDKKEEQSNYEINTKSIATTHDNYK 353
                  +    P                 ++     +     NYE++     T H   +
Sbjct: 310 PGGIPGALTNQPPADGAAPEVAVPGGGGDGQTPPQQSQSRATRNYELDRTVSYTKHQKGR 369

Query: 354 LERLSIAVVVNKGRLTEVL-GRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMD 412
           L RL++AVVV+         G +      ++ L  +  +V  A G ++ RGD++ + +  
Sbjct: 370 LRRLTVAVVVDDKVQRNAETGEATRVPWTEAELERLAILVRDAVGFSAARGDSVNVLNEP 429

Query: 413 FLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKG 472
           F+    F+SG + +   D     F ++   L   +  + +    +  + +      AK  
Sbjct: 430 FVAQLDFDSGDLPIWKED----WFLSLAKQLAGFLIIVALILGLMRPVLKSLAGAGAKTK 485

Query: 473 EVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLL 532
                  L     +   +   + ++ + L   +                   +Q    + 
Sbjct: 486 AEEEAKELEALQAAGIDSFDSLSDETVTLTGGDALALPSPEET--------YEQQLNAVK 537

Query: 533 HMIEINEERFAKILRKWARSE 553
            ++  +  R A+++++W   E
Sbjct: 538 GLVAEDPGRVAQVIKRWINEE 558


>gi|170722857|ref|YP_001750545.1| flagellar MS-ring protein [Pseudomonas putida W619]
 gi|169760860|gb|ACA74176.1| flagellar M-ring protein FliF [Pseudomonas putida W619]
          Length = 592

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 121/583 (20%), Positives = 233/583 (39%), Gaps = 55/583 (9%)

Query: 10  FFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSE 69
           F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  ++   L+ 
Sbjct: 27  FLENISQMPMLRQVGLLVGLAASVAIGFAVVLWSQQPDYRPLYGSLAGMDTKQVMDTLAA 86

Query: 70  ANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEI 129
           A+I + +  N  ++ V +  + +AR+ LAA G+  S  N G+EL DK    G + FM+  
Sbjct: 87  ADIPYNVEPNSGALLVKADDLSRARLKLAAAGVAPSDGNVGFELLDKEQGLGTSQFMEAT 146

Query: 130 TRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--S 187
              R+LEGE+ART+ S++ + AARVH+ +P    F +   +P+ASV++        +   
Sbjct: 147 RYRRSLEGELARTVSSLNNVKAARVHLAIPKSSVFVRDERKPSASVLVELYPGRSLEAGQ 206

Query: 188 AEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTAN--EMERNILGKSLSIVQAIQHEIEMNI 245
             AI +LVA +VP LD   VTV+D  G LL+    +    + GK     + ++  +   +
Sbjct: 207 VMAIVNLVATSVPELDKSQVTVVDQKGNLLSDQLQDTALTMAGKQFDYSRRMEGMLTQRV 266

Query: 246 NKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESA 305
           +  L   LG D +++ V A+L+    +     ++PD    RS +   + + S +  P+  
Sbjct: 267 HNILQPVLGNDRYKAEVSADLDFSAVESTSEQFNPDQPALRSEQSVNEQRASSS-GPQGV 325

Query: 306 VTVEQNMPH----------------------------------VSDRKVPLPRSLENTDK 331
                N P                                         P+        +
Sbjct: 326 PGALSNQPPAGAAAPENATAAAPAAGAIQPGQPLVDANGQQIMDPATGQPMLAPYPADKR 385

Query: 332 KEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKI 391
            +   N+E++     T     +L RLS+AVVV+     +  G +         LA   ++
Sbjct: 386 LQTTKNFELDRSISHTRQQQGRLTRLSVAVVVDDQVKVDAAGETTRAPWGAEDLARFTRL 445

Query: 392 VSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLL 451
           V  A G ++ RGD++T+ ++ F  ++      +           F  ++  ++ +V  L+
Sbjct: 446 VQDAVGFDASRGDSVTVINVPFAADRGEEIADIAF----YQQPWFWDIVKQVLGVVFILV 501

Query: 452 VTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSH 511
           + F  L  +         +         L           G + ND ++L      +   
Sbjct: 502 LVFGVLRPVLNNITGGGKQAAATDSDMELGGMIG----LDGELANDRVSLGGPTSILLPS 557

Query: 512 SRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                    S   +     +  ++  +  R A+++++W  ++ 
Sbjct: 558 P--------SEGYEAQLNAIKGLVAEDPGRVAQVVKEWINADE 592


>gi|316935488|ref|YP_004110470.1| flagellar M-ring protein FliF [Rhodopseudomonas palustris DX-1]
 gi|315603202|gb|ADU45737.1| flagellar M-ring protein FliF [Rhodopseudomonas palustris DX-1]
          Length = 537

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 134/551 (24%), Positives = 231/551 (41%), Gaps = 22/551 (3%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           +         LG  R++ + +V +  +  F      V+ P    LY  L V D + I   
Sbjct: 1   MQNLLSFLKGLGAARLMAMIAVTVALVGFFAFVIMRVSQPQMTTLYTDLSVEDSSSIIKE 60

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L    I F + + G+ + VP   V + R+ LA           GYE+FDK ++ G TSF+
Sbjct: 61  LERQGIPFEMRNEGAILLVPKDKVTRLRMKLAEG-GLPKGGGVGYEIFDKSDALGTTSFV 119

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           Q I  +RALEGE++RTI++I  + AARVH+V+P    F +    P+AS+++R       +
Sbjct: 120 QNINHLRALEGELSRTIRAIDRVQAARVHLVLPARPLFSREAPEPSASIVLRVRGALEPQ 179

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL--GKSLSIVQAIQHEIEMN 244
              AIRHLVA+AV  L    V+++D  G+LL         +    S     A +  +   
Sbjct: 180 QVRAIRHLVASAVNGLKPQRVSIVDEAGQLLADGSASGEQMEGATSDERRAAFEKRMRHQ 239

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPES 304
           I   +++ +G    R  V A+ + +        +DP+ +V RS +  ++   + TS  + 
Sbjct: 240 IEGIVSSVVGSGRARVQVSADFDYNKITQTSDTFDPEGRVLRSSQTREE--SAATSAADG 297

Query: 305 AVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVN 364
            VTV   +P  +  +     + + + K EE +NYEI+  +     +  ++ RLS+AV+V+
Sbjct: 298 QVTVNNELPGAN--QGQGAGARDVSKKSEETNNYEISRVTKTEVTEAGRVNRLSVAVLVD 355

Query: 365 KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTV 424
                +  G      +    L  I  +V +A G + +RGD I + ++ F E         
Sbjct: 356 GAYTKDDKGELVYAERSKEQLDRIAALVRSAIGFDQKRGDQIEVVNLKFAEAPQIEKLPE 415

Query: 425 QV---SFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILS 481
                            +I   V  +  L+V F+ +  L +     +      G  ++  
Sbjct: 416 PAGLMGMFQFTKDDIMNMIQLGVMFLLGLVVLFMVIRPLVKRVLAAEQTPEAAGLPALAD 475

Query: 482 PPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEER 541
                  V    +                 S    +++   V  QS  R+  + E N   
Sbjct: 476 GTVPQIGVDGQPVAPG------------MPSMIDIAQVQGQVHAQSVHRVGELAERNPNE 523

Query: 542 FAKILRKWARS 552
            A I+R+W   
Sbjct: 524 TAAIVRQWLAE 534


>gi|66046686|ref|YP_236527.1| flagellar MS-ring protein [Pseudomonas syringae pv. syringae B728a]
 gi|63257393|gb|AAY38489.1| Flagellar FliF M-ring protein [Pseudomonas syringae pv. syringae
           B728a]
          Length = 594

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 120/586 (20%), Positives = 222/586 (37%), Gaps = 56/586 (9%)

Query: 9   QFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALS 68
            F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  +I   L+
Sbjct: 25  SFLENLSEMTMLRQIGLMVGLAASVAIGFAVVLWSQQPDYRPLYGSLAGMDSKQIMDTLT 84

Query: 69  EANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQE 128
            ANI++ +  N  ++ V S  V +ARI LA  G+  + +N G+E+ DK    G + FM+ 
Sbjct: 85  AANINYTVEPNSGALLVKSDDVQRARIQLAQAGVVQNDANIGFEILDKDQGLGTSQFMEA 144

Query: 129 ITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPSVYK 186
               R LEGE+ARTI +++ +  ARVH+ +P    F +   +P+ASV++           
Sbjct: 145 TRYRRGLEGELARTISALNNVKGARVHLAIPKSSVFVRDDRKPSASVLVELYAGRSLEPS 204

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN--ILGKSLSIVQAIQHEIEMN 244
              AI +LVA +VP L    +TV+D  G LL+         + GK     + ++  +   
Sbjct: 205 QVMAIINLVATSVPELSKSQITVVDQKGALLSDQAENSELTMAGKQFDYSRRMEGMLTQR 264

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPES 304
           +   L   LG D +++ V A ++    +     ++PD    RS +   + QRS +S    
Sbjct: 265 VQNILQPILGNDRYKAEVSAVVDFSAVESTAESFNPDQPALRSEQSV-NEQRSSSSSSGG 323

Query: 305 AVTVEQNMPHVSDRKVPLPRSL-----------------------------------ENT 329
                 N P                                                   
Sbjct: 324 VPGALSNQPPGPATAPQTAGGGAAGAAGPIAPGQPLLDANGQQIMDPATGQPALAPYPAD 383

Query: 330 DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEV-LGRSADQGKIDSYLAEI 388
            + +   N+E++     T     +L RLS+AVVV+    T    G         + LA  
Sbjct: 384 KRVQSTKNFELDRSISHTKQQQGRLTRLSVAVVVDDMVKTNAANGEVTRAPWSAADLARF 443

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  A G ++ RGD++++ ++ F   +                  F  ++   V ++ 
Sbjct: 444 TRLVQDAVGFDASRGDSVSVINVPFSSERAEVLPEASF----YSQPWFWDIVKQAVGVIF 499

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
            L++ F  L  +         K+    G               G + ND ++L      +
Sbjct: 500 ILILVFGVLRPVLNNITNGKRKELAGFGG---DAELGGMGGLDGELSNDRVSLGGPQSIL 556

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                       +         +  ++  +  R A+++++W  ++ 
Sbjct: 557 LPSP--------TEGYDAQLNAIKSLVAEDPGRVAQVVKEWINTDE 594


>gi|330953748|gb|EGH54008.1| flagellar MS-ring protein [Pseudomonas syringae Cit 7]
          Length = 594

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 120/586 (20%), Positives = 222/586 (37%), Gaps = 56/586 (9%)

Query: 9   QFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALS 68
            F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  +I   L+
Sbjct: 25  SFLENLSEMTMLRQIGLMVGLAASVAIGFAVVLWSQQPDYRPLYGSLAGMDSKQIMDTLT 84

Query: 69  EANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQE 128
            ANI++ +  N  ++ V S  V +ARI LA  G+  + +N G+E+ DK    G + FM+ 
Sbjct: 85  AANINYTVEPNSGALLVKSDDVQRARIQLAQAGVVQNDANIGFEILDKDQGLGTSQFMEA 144

Query: 129 ITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPSVYK 186
               R LEGE+ARTI +++ +  ARVH+ +P    F +   +P+ASV++           
Sbjct: 145 TRYRRGLEGELARTISALNNVKGARVHLAIPKSSVFVRDDRKPSASVLVELYAGRSLEPS 204

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN--ILGKSLSIVQAIQHEIEMN 244
              AI +LVA +VP L    +TV+D  G LL+         + GK     + ++  +   
Sbjct: 205 QVMAIINLVATSVPELSKSQITVVDQKGALLSDQAENSELTMAGKQFDYSRRMESMLTQR 264

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPES 304
           +   L   LG D +++ V A ++    +     ++PD    RS +   + QRS +S    
Sbjct: 265 VQNILQPILGNDRYKAEVSAVVDFSAVESTAESFNPDQPALRSEQSV-NEQRSSSSSSGG 323

Query: 305 AVTVEQNMPHVSDRKVPLPRSL-----------------------------------ENT 329
                 N P                                                   
Sbjct: 324 VPGALSNQPPGPATAPQTAGGGAAGAAGPIAPGQPLLDANGQQIMDPGTGQPALAPYPAD 383

Query: 330 DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEV-LGRSADQGKIDSYLAEI 388
            + +   N+E++     T     +L RLS+AVVV+    T    G         + LA  
Sbjct: 384 KRVQSTKNFELDRSISHTKQQQGRLTRLSVAVVVDDMVKTNAANGEVTRAPWSAADLARF 443

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  A G ++ RGD++++ ++ F   +                  F  ++   V ++ 
Sbjct: 444 TRLVQDAVGFDASRGDSVSVINVPFSSERAEVLPEASF----YSQPWFWDIVKQAVGVIF 499

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
            L++ F  L  +         K+    G               G + ND ++L      +
Sbjct: 500 ILILVFGVLRPVLNNITNGKRKELAGFGG---DAELGGMGGLDGELSNDRVSLGGPQSIL 556

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                       +         +  ++  +  R A+++++W  ++ 
Sbjct: 557 LPSP--------TEGYDAQLNAIKSLVAEDPGRVAQVVKEWINTDE 594


>gi|58760481|gb|AAW82147.1| FliF [Stenotrophomonas maltophilia]
          Length = 545

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 116/553 (20%), Positives = 222/553 (40%), Gaps = 24/553 (4%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           ++  Q+F    SL  TR L L ++I V ++       +   P    LY  L+       +
Sbjct: 13  EKAGQWFDRLQSLQITRRLGLMAMIAVAVVSVFF---WSQKPGMVPLYTGLDQKATAEAT 69

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L  A I F +      I+VP   +  AR+ LA  GL + S   G+EL ++   FG++ 
Sbjct: 70  DLLRAAQIPFALDPATGGITVPEKNLHDARLKLAGSGL-TDSGKLGFELMERDPGFGVSQ 128

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INP 182
           F++      ALE E++RTI ++  +  +RVH+ +P   +F +     +ASV +       
Sbjct: 129 FVESARYQHALETELSRTINTLRPVRDSRVHLAIPKPSAFTRQRDVASASVTLELRGGQQ 188

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL--GKSLSIVQAIQHE 240
                 +AI H+VAA++P+L    VTV+D +G++L+  +              V+  +  
Sbjct: 189 LERSQVDAIVHMVAASIPDLAPERVTVVDQSGRMLSITDPNSEAAVNAAQFEQVRRQETS 248

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
               I + L    G       V  +++    +    +Y+ + +  RS ++S+    + T 
Sbjct: 249 FNQRIRELLEPMTGPGRVNPEVSVDMDFSVTEEARELYNGEPQKLRSEQMSE--NTTSTP 306

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
            P+       N P          ++   + K     NYE++     T     +++R+S+A
Sbjct: 307 GPQGVPGATSNSPPGQQAAPATAQTPTESSK-NATRNYELDRTLQHTRQPAGRIKRVSVA 365

Query: 361 VVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN 420
           V+V+        G+ + Q    + L  +  +V  A G N+ RGDT+++ +  F+ +    
Sbjct: 366 VLVDNVPRAGANGKMSPQPLSAAELTRVEALVKQAVGFNAERGDTVSVMNAPFVRDTTPV 425

Query: 421 SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL 480
            G                    L+  V  L + F  L    R     + K  E       
Sbjct: 426 EGPAWWEL-----PWVHDAGRMLLGAVVVLALLFGVLRPALRAITGQNRKNDE------- 473

Query: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540
            P          L+ +D + L +   D  S +      +     ++        ++ + +
Sbjct: 474 -PALEPHTADVQLVDDDGMPLPALGADRASLAGPDALALPVDSYEERLRMAREAVKTDSK 532

Query: 541 RFAKILRKWARSE 553
           R A++++ W  ++
Sbjct: 533 RVAQVVKGWVAND 545


>gi|291617848|ref|YP_003520590.1| FliF [Pantoea ananatis LMG 20103]
 gi|291152878|gb|ADD77462.1| FliF [Pantoea ananatis LMG 20103]
          Length = 572

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 132/548 (24%), Positives = 229/548 (41%), Gaps = 56/548 (10%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P+Y  L+  L   D   I   L++ N+ +R +DNG ++ VP   V + R+ LA Q
Sbjct: 47  LWAKTPNYSVLFSNLSNEDGGAIVTQLTQMNVPYRFADNGGALMVPEDKVHELRLRLAEQ 106

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP    N G+EL DK   FG++ F +++   RALEGE+ARTI+S+  +  ARVH+ MP 
Sbjct: 107 GLPK-GGNVGFELLDKE-KFGISQFSEQVNYQRALEGELARTIESLGPVKTARVHLAMPK 164

Query: 161 MGSFRKIGARPTASVMIRAINPSVYK--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV +             +AI H+V+++V  L  G+VTV+D +G LLT
Sbjct: 165 PTLFVREQKAPSASVTLTLQPGRALDEGQIQAITHMVSSSVAGLPPGNVTVVDQSGHLLT 224

Query: 219 ANEM-ERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIV 277
            ++   R++    L     ++   +  I   L   LG  N  + V A++N DT +  +  
Sbjct: 225 RSDAVGRDLNDAQLKYAAEVEARYQQRIEAILNPILGQGNVHAQVTAQINFDTSEQTDEK 284

Query: 278 YDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVSDRKVPLPRSL-------- 326
           Y P+   + +   S+    SE S    P        N P  ++       +         
Sbjct: 285 YQPNGDPKNASIRSQQTSTSEQSGSPYPGGVPGALSNQPAPANTAPVNAPNTNAANGQNA 344

Query: 327 --------------------ENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG 366
                                   ++++  NYE++     T  +   ++RLS+AVVVN  
Sbjct: 345 NGQNNAANGQRTSTASASSVPTNSRRDDTVNYELDRTIRHTKMNVGDVQRLSVAVVVNYR 404

Query: 367 RLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQV 426
                  +       +  L +I  +   A G + +RGD++ + +  F   +   S     
Sbjct: 405 ----EDDKGKALALNEQQLKQIEDLTREAMGYSQQRGDSVNVVNSQFNTTEPTVSELP-- 458

Query: 427 SFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPIS 486
                    F  +I+A  +L+  L+   L    +R         +            P  
Sbjct: 459 --FWQQQSFFDQLISAGKWLLVALVAFILYRKTVRPHVLRKKEAE---ESGCRSDGCPCC 513

Query: 487 SAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKIL 546
           +A  +G +         + Q      R   +R+++ V  Q   R+  M E +    A ++
Sbjct: 514 TAKRSGSLQ------RPAQQREMEQERKTNNRMSAEVMSQ---RIRDMSENDPRVVALVI 564

Query: 547 RKWARSEI 554
           R+W  +E+
Sbjct: 565 REWMGNEL 572


>gi|78485783|ref|YP_391708.1| flagellar M-ring protein FliF [Thiomicrospira crunogena XCL-2]
 gi|78364069|gb|ABB42034.1| Flagellar M-ring protein FliF [Thiomicrospira crunogena XCL-2]
          Length = 561

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 125/553 (22%), Positives = 241/553 (43%), Gaps = 25/553 (4%)

Query: 10  FFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSE 69
             K+ TSL   + + L   +   + L +    +  S  Y  L+  ++  D+N +   L +
Sbjct: 22  LLKNLTSLSVAKQVSLVIALAASVALAIGIILWSQSASYTLLFGSMDAKDMNEVIQTLDQ 81

Query: 70  ANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEI 129
            N+ ++I  N  +I VP+  V   R+ LAAQG P   + +GY++ D    FG++ F +  
Sbjct: 82  ENVPYKIEQNSGAILVPNEQVHSLRLKLAAQGYPKQ-APTGYQILDIDQGFGISQFKETT 140

Query: 130 TRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN--PSVYKS 187
              RALEGE+A+++ SI+ + +ARV + MP    F +    PTASV ++         + 
Sbjct: 141 RYQRALEGELAKSVSSINAVKSARVMLGMPKRSVFVRKQQEPTASVTVKLYPGRALNEEQ 200

Query: 188 AEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNI--LGKSLSIVQAIQHEIEMNI 245
             AI +LV++++PN+    VTV+D  G LLT++     +    K L   + ++  +   I
Sbjct: 201 VSAIVYLVSSSIPNMKPKGVTVVDQQGNLLTSDSHSGIMNVSLKQLGYTRQVEDTLSQRI 260

Query: 246 NKALAAFLGVD-NFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPES 304
            + L    G D   R+ V AEL+   Q+     Y+PD +  RS +  K+  R+E   P  
Sbjct: 261 IRLLTPVAGGDHKVRAQVTAELDFTQQEQTRENYEPDPEAIRSEQEIKEINRNE--GPMG 318

Query: 305 AVTVEQNMPHVSDRKV-----PLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
                 N P  +         P         K+++  NYE++       +    + RLS+
Sbjct: 319 IPGALTNQPPRAGIAPEEGYKPENDPNLKNSKEKKTKNYELDRTVSHIKNSVGSIRRLSV 378

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AVV++     +  G +      +  L    ++VS A G++  RGDT++I +  F++ +  
Sbjct: 379 AVVLDDKLTVDDNGDTVRTPLTEDELQRYRRLVSDAVGLDEARGDTLSIVNASFIQEKQE 438

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
           +    ++         F T++  ++  +  L++ F  +  + +  +  +           
Sbjct: 439 DFAGPEIWEEP----WFWTLVKQILAGLAVLIIIFGVIRPMLKDLSKREEVA-------- 486

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
           +  P         L   D I+      +     +  +   +S   K+   ++  ++  + 
Sbjct: 487 MDYPEDVPEEEEELENADEISRALEQMNEEVEQKAEEVDEDSEKDKEMLEKVKAVVSADP 546

Query: 540 ERFAKILRKWARS 552
           +  A I+++W   
Sbjct: 547 KLAAHIIKQWMSK 559


>gi|154252631|ref|YP_001413455.1| flagellar M-ring protein FliF [Parvibaculum lavamentivorans DS-1]
 gi|154156581|gb|ABS63798.1| flagellar M-ring protein FliF [Parvibaculum lavamentivorans DS-1]
          Length = 552

 Score =  373 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 129/555 (23%), Positives = 241/555 (43%), Gaps = 14/555 (2%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           +        SLG  R+  L  V +     F      + +     L+  + V D  ++   
Sbjct: 1   MSNVSNLLQSLGTMRLAALGLVAIALFSFFAFIALRMGNEPKALLFSDVGVEDAAKMIAE 60

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L  A + + +  NG  I VP + V + R+ LA +GLP +    GYE+FD  ++ G TSF+
Sbjct: 61  LDAAKVSYELRGNGGMIYVPQADVLRLRMMLAGKGLP-AGGTVGYEIFDNADALGTTSFL 119

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA-INPSVY 185
           Q I  +RALEGE+ARTI++I GI  ARVH+V+P+   F +    PTAS++++   N    
Sbjct: 120 QNINHLRALEGELARTIRAIEGIGGARVHLVLPERELFSRDRREPTASIVLKVSRNSLTT 179

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA---NEMERNILGKSLSIVQAIQHEIE 242
           +  +AI++LVA+AV  L  G V+++D  G LL +    + +  ++          ++ + 
Sbjct: 180 QQVKAIQYLVASAVDGLSPGRVSIVDERGALLASGVGEDTQSLLVTSVDERRTGYENRLR 239

Query: 243 MNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQP 302
            ++   L   +G D  R  V A+++ +        +DP+ +V RS +   D   S     
Sbjct: 240 THLENILQRVVGADKARVEVTAQMDYNRITQTSDTFDPNGQVVRSTQTVDDNSTSADGAQ 299

Query: 303 ESAVTVEQNMPHVS-DRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAV 361
              VTV  N+P+ +         S + +++ EE  NYEI+  +     +  +++RLS+AV
Sbjct: 300 NDGVTVGNNLPNANLGGAEAETGSRQASNRTEETVNYEISRTTKTEVLEPGRVKRLSVAV 359

Query: 362 VVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN- 420
           +V+     +  G +    + +  L +I  +V +A G ++ RGD + I ++ F      + 
Sbjct: 360 LVDGSYAADAEGNTVYTPRTEQELGKIEALVKSAIGFDTSRGDQVEIVNLQFAAAPDLDV 419

Query: 421 ---SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGK 477
                     FMD        +    V  +  L+     L  +           G++   
Sbjct: 420 GLSEEEEAKGFMDFTRAEVMRMAEMAVLTILALVAMLFVLRPMLSRAFSGSTTTGQIAYT 479

Query: 478 SILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEI 537
           +        + + +    +       +   +        +++   V + S  ++  ++  
Sbjct: 480 NNS----AQAVLESPDGLDVPAGALPAPDQLSEDMMIDIAQVAGKVKQSSVRKIGELVTS 535

Query: 538 NEERFAKILRKWARS 552
           + +    ILR W   
Sbjct: 536 HPDESISILRSWLHE 550


>gi|330961220|gb|EGH61480.1| flagellar MS-ring protein [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 596

 Score =  373 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 120/587 (20%), Positives = 225/587 (38%), Gaps = 54/587 (9%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  +I   L
Sbjct: 24  LSFLENLSEMTMLRQVGLMVGLAASVAIGFAVVLWSQQPDYRPLYGSLAGLDSKQIMDTL 83

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + ANI + +  N  ++ V S  V +ARI LA  G+  + +N G+E+ DK    G + FM+
Sbjct: 84  TAANIVYTVEPNSGALLVKSDDVQRARIQLAQAGVVQNDANIGFEILDKDQGLGTSQFME 143

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPSVY 185
                R LEGE+ARTI +++ +  ARVH+ +P    F +   +P+ASV++          
Sbjct: 144 ATRYRRGLEGELARTISALNNVKGARVHLAIPKSSVFVRDDRKPSASVLVELYAGRSLEP 203

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN--ILGKSLSIVQAIQHEIEM 243
               AI +LVA +VP L    +TV+D  G LL+         + GK     + ++  +  
Sbjct: 204 SQVLAIINLVATSVPELSKSQITVVDQKGTLLSDQAENSELTMAGKQFDYSRRMEGMLTQ 263

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            +   L   LG D +++ V A ++    +     ++PD    RS +   + QRS +S   
Sbjct: 264 RVQNILQPILGNDRYKAEVSAVVDFSAVESTAESFNPDQPALRSEQSV-NEQRSSSSSSG 322

Query: 304 SAVTVEQNMPHVSDRKVPLPRSL-----------------------------------EN 328
                  N P                                                  
Sbjct: 323 GVPGALSNQPPGPATAPQTAGGGAAGAAGPIAAGQPLLDANGQQIMDPATGQPALAPFPA 382

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEV-LGRSADQGKIDSYLAE 387
             + +   N+E++     T     +L RLS+AVVV+    T    G  +      + LA 
Sbjct: 383 DKRVQSTKNFELDRSISHTKQQQGRLTRLSVAVVVDDMVKTNAANGEISRAPWSATDLAR 442

Query: 388 INKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLV 447
             ++V  A G ++ RGD++++ ++ F   +                  F  ++   V ++
Sbjct: 443 FTRLVQDAVGFDASRGDSVSVINVPFSSERAEVLPEASF----YSQPWFWDIVKQAVGVI 498

Query: 448 GTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQD 507
             L++ F  L  +        +K+ ++                 G + ND ++L      
Sbjct: 499 FILILVFGVLRPVLNNITNGKSKQ-QLAAFGGGDAELGGMGGLDGELSNDRVSLGGPQSI 557

Query: 508 IFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
           +            +         +  ++  +  R A+++++W  ++ 
Sbjct: 558 LLPSP--------TEGYDAQLNAIKSLVAEDPGRVAQVVKEWINTDE 596


>gi|331673452|ref|ZP_08374220.1| flagellar M-ring protein FliF [Escherichia coli TA280]
 gi|331069650|gb|EGI41037.1| flagellar M-ring protein FliF [Escherichia coli TA280]
          Length = 552

 Score =  372 bits (954), Expect = e-100,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 236/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+    ++   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQANTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMQAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|239834433|ref|ZP_04682761.1| flagellar M-ring protein FliF [Ochrobactrum intermedium LMG 3301]
 gi|239822496|gb|EEQ94065.1| flagellar M-ring protein FliF [Ochrobactrum intermedium LMG 3301]
          Length = 590

 Score =  371 bits (953), Expect = e-100,   Method: Composition-based stats.
 Identities = 210/565 (37%), Positives = 324/565 (57%), Gaps = 7/565 (1%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
                + Q   +   LG  +++ L  V    +   +    +++ P Y+ LYV L   DVN
Sbjct: 9   NFQQLIEQLKGTLGKLGARKLVALGLVGAALMAAILYTSIYLSRPSYETLYVGLSRDDVN 68

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 69  RMGLALGEAGIPFDVKADGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 127

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 128 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 187

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG-KSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G+LL +     N     + S+ Q +   
Sbjct: 188 GFAAESAQSIRQLVAAAVPSLDASAVTVLDTNGRLLASAGEAANGAALMTASLEQQVAGN 247

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q  E ++DP+S+VERS+R+ +++  S  +
Sbjct: 248 VDDSIRKALAPYLGMGHFQTSVQAVLDTDRRQTNETIFDPESRVERSVRVVRESGDSRNN 307

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLSIA
Sbjct: 308 RNDNATGVEQNIPQEEIQNRNGESSSEKTDRREELTNYEMNSKTVSTVSDGYTVKRLSIA 367

Query: 361 VVVNKGRLTEVLGRSADQG-KIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL E  G +      +D  +A+I  +V+ A G+N+ RGD I +T+++FL+    
Sbjct: 368 VVIDQARLLETAGTTPPPANFVDQQIAKIRDLVATAAGLNADRGDVINVTAVNFLDPAGA 427

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
           +   V   + D + R   + +NAL  L    L+ + GL  L R  N   A       ++ 
Sbjct: 428 DMEPVSTPWTDTVLRQSGSYVNALAILAAVGLLIWFGLRPLLRDQNARTAGTEVAIRETS 487

Query: 480 LSPPPI----SSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMI 535
               P      +A           A+    +      +   S +   +   + LRL  MI
Sbjct: 488 DVAAPDFVGGQAAGEGVQGAQGVQAVIGGPEAYADQMKTSLSDLRQRMRMPAKLRLEQMI 547

Query: 536 EINEERFAKILRKWARSEIEDRYTQ 560
           +++EER A +L++W       R  Q
Sbjct: 548 DMDEERVAAVLKQWIHETAASREGQ 572


>gi|153011515|ref|YP_001372729.1| flagellar MS-ring protein [Ochrobactrum anthropi ATCC 49188]
 gi|151563403|gb|ABS16900.1| flagellar M-ring protein FliF [Ochrobactrum anthropi ATCC 49188]
          Length = 579

 Score =  371 bits (953), Expect = e-100,   Method: Composition-based stats.
 Identities = 213/561 (37%), Positives = 322/561 (57%), Gaps = 5/561 (0%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
                + Q   +   LG  +++ L  V    +   +    +++ P Y+ LYV L   DVN
Sbjct: 4   NFQQLIEQLKGTLGKLGARKLIALGLVGAALMGAILYTSIYLSRPSYETLYVGLSRDDVN 63

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +  +GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 64  RMGLALGEAGIPFDVKADGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 122

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIVM + GSFR+   +P+ASV+IRA  
Sbjct: 123 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVMAEKGSFRRGDQKPSASVVIRAEG 182

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG-KSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G+LL +     N     + S+ Q +   
Sbjct: 183 GFAAESAQSIRQLVAAAVPSLDASAVTVLDTNGRLLASAGEAANGAALMTASLEQQVAGN 242

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +QI E  YDP+S+VERS+R+ +++  S  +
Sbjct: 243 VDDSIRKALAPYLGIGHFQTSVQAVLDTDRRQINETTYDPESRVERSVRVVRESGDSRNN 302

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLSIA
Sbjct: 303 RNDNATGVEQNIPQEEIQNRNGESSTEKTDRREELTNYEMNSKTVSTVSDGYTVKRLSIA 362

Query: 361 VVVNKGRLTEVLGRSADQG-KIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL E  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+    
Sbjct: 363 VVIDQARLLETAGTTPPPANFVDQQITKIRDLVATAAGLNADRGDVINVTAVNFLDPAGA 422

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
           +   V   + D + R   + +NAL  L    L+ + GL  L R  N      G       
Sbjct: 423 DMEPVSTPWTDTVLRQSGSYVNALAILAAVGLLIWFGLRPLLRDQNAK--PTGTEVAVRE 480

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
            S   + + V          A+    +      +   S +   +   + LRL  MI+++E
Sbjct: 481 TSEVAMPNFVGGQAAGEGVQAVIGGPEAYADQMKTSLSDLRQRMRMPAKLRLEQMIDMDE 540

Query: 540 ERFAKILRKWARSEIEDRYTQ 560
           ER A IL++W       R  Q
Sbjct: 541 ERVASILKQWIHETAASREAQ 561


>gi|222149996|ref|YP_002550953.1| flagellar MS-ring protein [Agrobacterium vitis S4]
 gi|221736978|gb|ACM37941.1| flagellar M-ring protein [Agrobacterium vitis S4]
          Length = 568

 Score =  371 bits (952), Expect = e-100,   Method: Composition-based stats.
 Identities = 276/563 (49%), Positives = 377/563 (66%), Gaps = 9/563 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M + +QLLQ FK+ +SLG T++  LA V +V + L + A FF+N P ++ LYV LE +DV
Sbjct: 7   MNLFNQLLQVFKNLSSLGPTKLWTLAGVGVVSVALVIGAAFFINKPAFETLYVGLEATDV 66

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           N+IS+AL+EA + F+   +G SI V + M GKAR+ LA +GLP +S+N+GYELFD V S 
Sbjct: 67  NQISIALAEAGVGFQTGADGKSIQVQAGMTGKARLLLAERGLP-NSTNAGYELFDNVGSL 125

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQ I+GI AARVHIVMPD+G+FR+   +PTASVMIRA 
Sbjct: 126 GLTSFMQEVTRVRALEGEIARTIQQINGIAAARVHIVMPDVGNFRRGAQKPTASVMIRAG 185

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHE 240
           + +  KSA +IRHLVA+AVP L++ DVT+LDSTG+LL + +       ++L + Q++Q E
Sbjct: 186 SDAGRKSAASIRHLVASAVPGLEIDDVTILDSTGQLLASGDETGGAANRNLGVAQSVQQE 245

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           IE NI+KALA FLG+DNFRS+V A+LN D QQI+E VYDP+SKVERS R +K+AQ+S+  
Sbjct: 246 IESNIDKALAPFLGMDNFRSSVTAQLNTDQQQIQETVYDPESKVERSTRTTKEAQKSQQR 305

Query: 301 QPESAVTVEQNMPHVSDRKVP-LPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
           Q ++A TVEQN+P  + +     P S +  DKKEEQ+NYEIN+K+IAT  + Y L++LS+
Sbjct: 306 QSDTAATVEQNIPQAAPQAGGAGPESSDQQDKKEEQTNYEINSKTIATVKNGYTLDKLSV 365

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AVVVNK R+  ++G   DQ KID+YLAE+ KIV +A G++ +RGD +T+T+MDFLENQL 
Sbjct: 366 AVVVNKQRIATMVGEPVDQAKIDAYLAEMQKIVKSAAGLDDKRGDVVTLTAMDFLENQLL 425

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
           +        M+ILSR+ A +IN+L FL    LV ++G+  + R          E G  ++
Sbjct: 426 SEAPTGPGVMEILSRNMAGIINSLAFLAVAFLVVWMGIRPMVRSMGGGGTAALEGGSDAV 485

Query: 480 LSPPPISSAVTTGLMPNDNIALD-------SSNQDIFSHSRNLQSRINSYVSKQSDLRLL 532
                   +          +           S  D+ +   +     N  V +  + RL 
Sbjct: 486 AGLELPDFSPGLDAGAGGGLMDGFGSDFGFDSADDVLALDNDPNGGFNRRVKEGPERRLA 545

Query: 533 HMIEINEERFAKILRKWARSEIE 555
            M+EI+EER AKILRKWA     
Sbjct: 546 RMVEISEERAAKILRKWAVENAA 568


>gi|121997300|ref|YP_001002087.1| flagellar M-ring protein FliF [Halorhodospira halophila SL1]
 gi|121588705|gb|ABM61285.1| flagellar M-ring protein FliF [Halorhodospira halophila SL1]
          Length = 595

 Score =  371 bits (952), Expect = e-100,   Method: Composition-based stats.
 Identities = 124/560 (22%), Positives = 224/560 (40%), Gaps = 15/560 (2%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSP-HYDNLYVKLEVSDVNRI 63
           +   +           R L L + +L    L +A  F+   P     LY  L   D   +
Sbjct: 43  EDWREQLTRVLGDNPLRKLGLGAGLLAVAGLGVAIFFWAQEPAELRTLYADLSSDDAAEV 102

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
             AL E  +     +    I VP + V +ARI LA++GLP   S  GYE+ +    FG++
Sbjct: 103 INALEEQGVRVEFDERTGDIKVPENAVHRARIFLASEGLPR-GSGFGYEMLEDDPGFGVS 161

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS 183
            FM+     RALE E+AR+I+++ G+V+ARVH+  P    F +      ASV++      
Sbjct: 162 EFMEHARFDRALETELARSIETLRGVVSARVHLDDPQESVFVRDRRDAKASVVLELDQDR 221

Query: 184 VY--KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNI--LGKSLSIVQAIQH 239
               +  E I HLVA+AV +L+ G+V+V+D  G+LLTA +         +   + + ++ 
Sbjct: 222 QLPDRQVEGIIHLVASAVSDLEHGNVSVVDHRGRLLTAEDEPTEATRSAQQFELTRRLEE 281

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
            I+  +   +   +G D  R+ V A LN D ++  E ++DP+S   RS ++S+       
Sbjct: 282 RIQRRVEDMVEPIIGPDRVRAQVSARLNFDERRQIEELFDPESSAIRSEQMSER-SGGGG 340

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTD--KKEEQSNYEINTKSIATTHDNYKLERL 357
             P        N P                     +E  N+E+             ++RL
Sbjct: 341 QWPIGIPGALTNQPPGPGTLDGEELEGGGGTPFSSDETRNWEVGRTLSEVQPAIGVIDRL 400

Query: 358 SIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           ++ V+V+   +    G    +   D  +  +  +V  A G ++ RGD +++ ++ F E  
Sbjct: 401 TVGVLVDHRYVQNEDGEVVREALSDEEIQTLENLVQDAVGYDADRGDAVSVATVPFAEIV 460

Query: 418 LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGK 477
                  +V   +        +I   VF    LL+  + +  +       + +  E  G 
Sbjct: 461 EPPDPPEEVWEQE----WVRDLIRLAVFAAIGLLIYIVAIRPIVNRMLGGEDELDEESGG 516

Query: 478 SILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEI 537
           +        +     L          +   +   S    S +     +     +L ++E 
Sbjct: 517 AETEGLERPAG--ESLASPGRGQEGEAALQLAGISGEQLSDMRERPYEAKLQAVLELVEN 574

Query: 538 NEERFAKILRKWARSEIEDR 557
             E  A  ++ W   + + +
Sbjct: 575 EPELAANAVKAWLDEDDKRK 594


>gi|325920574|ref|ZP_08182496.1| flagellar basal-body M-ring protein/flagellar hook-basal body
           protein FliF [Xanthomonas gardneri ATCC 19865]
 gi|325548967|gb|EGD19899.1| flagellar basal-body M-ring protein/flagellar hook-basal body
           protein FliF [Xanthomonas gardneri ATCC 19865]
          Length = 576

 Score =  371 bits (952), Expect = e-100,   Method: Composition-based stats.
 Identities = 113/571 (19%), Positives = 229/571 (40%), Gaps = 32/571 (5%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           ++  Q+F    SL  TR L + ++I + +   +A  ++   P Y +LY  L+       +
Sbjct: 15  EKAGQWFDRVRSLQITRKLTMMAMIALAVGAGLAVFYWSQKPGYQSLYTGLDDKGNAEAA 74

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L  A I ++I  N  +ISVP   +  AR+ LA  GL    +  G+EL +K   FG++ 
Sbjct: 75  DLLRTAQIPYKIDQNTGAISVPQDRLYDARLKLAGSGLTGKETGGGFELMEKDPGFGVSQ 134

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INP 182
           F++      ALE E++RTI ++  +  ARVH+ +P   +F +     +ASV++       
Sbjct: 135 FVENARYQHALETELSRTIGTLRPVREARVHLAIPKPSAFTRQRDVASASVVLELRGGQG 194

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL--GKSLSIVQAIQHE 240
                 +AI +LVA+++P++    VTV+D +G++L+  +   +          V+  +  
Sbjct: 195 LERNQVDAIVNLVASSIPDMTPERVTVVDQSGRMLSIADPNSDAAQHAAQFEQVRRQESS 254

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
               I + L    G       V  +++    +    +Y+ +    RS +   +   +  +
Sbjct: 255 YNQRIRELLEPMTGAGRVNPEVSVDMDFSVVEEARELYNGEPAKLRSEQ--INDTSTSAT 312

Query: 301 QPESAVTVEQN-----------------MPHVSDRKVPLPRSLENTDKKEEQSNYEINTK 343
            P+       N                     +        +      K    NYE++  
Sbjct: 313 GPQGPPGATSNSPGQPPAPAANATAGAPGAPAAANGQAAAPAAPTESSKSATRNYELDRT 372

Query: 344 SIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRG 403
              T     +++R+S+AV+++        G+  +Q    + L  I  +V  A G ++ RG
Sbjct: 373 LQHTRQPAGRIKRVSVAVLLDNVPRPGAKGKIVEQPLTAAELTRIEGLVKQAVGFDAARG 432

Query: 404 DTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL 463
           DT+++ +  F+   +      +      +       +  LV  V  L + F  +    R 
Sbjct: 433 DTVSVMNAPFVREAVAGEEGPKWWEDPRVQN----GLRLLVGAVVVLALLFGVVRPTLRQ 488

Query: 464 HNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYV 523
                  K     K        +       M +D+  +    +D     ++ +  I    
Sbjct: 489 LTGVTVVKD----KQGKGGKDGTPQSADVRMVDDDDLMPRLEEDTAQLGQDKKVPIALPD 544

Query: 524 SKQSDLRL-LHMIEINEERFAKILRKWARSE 553
           + +  +R+    ++ + +R A++++ W  SE
Sbjct: 545 AYEERMRVAREAVKADSKRVAQVVKGWVASE 575


>gi|190574239|ref|YP_001972084.1| flagellar MS-ring protein [Stenotrophomonas maltophilia K279a]
 gi|190012161|emb|CAQ45784.1| putative flagellar M-ring protein [Stenotrophomonas maltophilia
           K279a]
          Length = 548

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 117/553 (21%), Positives = 224/553 (40%), Gaps = 21/553 (3%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           ++  Q+F    SL  TR L L ++I V +   ++  F+   P    LY  L+       +
Sbjct: 13  EKAGQWFDRLQSLQITRRLGLMAMIAVAVAAGLSVFFWSQKPGMVPLYTGLDQKATAEAT 72

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L  A I F +      I+VP   +  AR+ LA  GL + S   G+EL ++   FG++ 
Sbjct: 73  DLLRAAQIPFALDPATGGITVPEKNLHDARLKLAGSGL-TDSGKLGFELMERDPGFGVSQ 131

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INP 182
           F++      ALE E++RTI ++  +  +RVH+ +P   +F +     +ASV +       
Sbjct: 132 FVESARYQHALETELSRTINTLRPVRDSRVHLAIPKPSAFTRQRDVASASVTLELRGGQQ 191

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL--GKSLSIVQAIQHE 240
                 +AI H+VAA++P+L    VTV+D +G++L+  +              V+  +  
Sbjct: 192 LERSQVDAIVHMVAASIPDLAPERVTVVDQSGRMLSITDPNSEAAVNAAQFEQVRRQETS 251

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
               I + L    G       V  +++    +    +Y+ + +  RS ++S+    + T 
Sbjct: 252 FNQRIRELLEPMTGPGRVNPEVSVDMDFSVTEEARELYNGEPQKLRSEQMSE--NTTSTP 309

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
            P+       N P          ++   + K     NYE++     T     +++R+S+A
Sbjct: 310 GPQGVPGATSNSPPGQQAAPATAQTPTESSK-NATRNYELDRTLQHTRQPAGRIKRVSVA 368

Query: 361 VVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN 420
           V+V+        G+ + Q    + L  +  +V  A G N+ RGDT+++ +  F+ +    
Sbjct: 369 VLVDNVPRAGANGKMSPQPLSAAELTRVEALVKQAVGFNAERGDTVSVMNAPFVRDTTPV 428

Query: 421 SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL 480
            G                    L+  V  L + F  L    R     + K  E       
Sbjct: 429 EGPAWWEL-----PWVHDAGRMLLGAVVVLALLFGVLRPALRAITGQNKKNDE------- 476

Query: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540
            P          L+ +D + L +   D  S +      +     ++        ++ + +
Sbjct: 477 -PALEPHTADVQLVDDDGMPLPALGADRASLAGPDALALPVDSYEERLRMAREAVKTDSK 535

Query: 541 RFAKILRKWARSE 553
           R A++++ W  ++
Sbjct: 536 RVAQVVKGWVAND 548


>gi|116250467|ref|YP_766305.1| flagellar MS-ring protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255115|emb|CAK06189.1| putative flagellar M-ring protein [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 561

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 295/562 (52%), Positives = 392/562 (69%), Gaps = 8/562 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M +L+QL+Q FK+  SLGRTR++IL  V  + I + +AA  FVN P  + LYV L+  D+
Sbjct: 1   MNLLNQLVQIFKNFGSLGRTRLMILGGVGALSIAIILAAALFVNKPAQETLYVGLDSPDL 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           N+IS+AL+EANI+F++  +GSSISVP+ M GKAR+ LA +GLP +S+N+GYELFD V S 
Sbjct: 61  NQISMALAEANINFQVGTDGSSISVPAGMTGKARLMLAERGLP-NSANAGYELFDNVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQSISGI AARVHIVMP++G+FRK   +PTASVMIRA 
Sbjct: 120 GLTSFMQEVTRVRALEGEIARTIQSISGITAARVHIVMPEVGNFRKAEQKPTASVMIRAS 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL-GKSLSIVQAIQH 239
             +   +A +IRHLVA+AVP LD+ DVT+LDS G+LL + +   N    +SL+IVQ +Q 
Sbjct: 180 ATTGRSAATSIRHLVASAVPGLDVDDVTILDSAGQLLASGDEASNSSLNRSLNIVQNVQQ 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           E+E NI+KALA FLG+DNFRS+V A+LN D QQI+E  YDP+SKVERS+R +K+AQ+S+ 
Sbjct: 240 EVESNIDKALAPFLGMDNFRSSVTADLNTDAQQIQETTYDPESKVERSVRSTKEAQQSQQ 299

Query: 300 SQPESAVTVEQNMPHVSDRKVP--LPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
            Q +SA TVEQN+P  +        P S + +DK+EEQ+NYEIN+K+ ATT  +YK+E+L
Sbjct: 300 KQSDSATTVEQNIPQAAPEAGGSAGPESQDKSDKREEQTNYEINSKTTATTRSSYKVEKL 359

Query: 358 SIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           SIAVVVNKGR+ +++G  ADQ K+D+YLAE+ KIV++A GI+++RGD +T+T+MDFLENQ
Sbjct: 360 SIAVVVNKGRIAKMVGEPADQAKVDAYLAEMQKIVASAAGIDAKRGDVVTVTAMDFLENQ 419

Query: 418 LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA----KKGE 473
           L    T  V  MD+LSR+ A +IN+L F+    +V ++GL  L R  N   A       E
Sbjct: 420 LLEDATGGVRVMDMLSRNLAGIINSLAFVAVAFVVVWMGLRPLVRSINGTSAAFGDATPE 479

Query: 474 VGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLH 533
             G  +    P S A    LM          + +      +     N  V +  + +L  
Sbjct: 480 AAGLELPDFAPASGAPGGALMDGFGSDFGFDSTEDLLSLGDDDGNFNRRVKEGPERKLSR 539

Query: 534 MIEINEERFAKILRKWARSEIE 555
           M+EINEER AKILRKWA  E  
Sbjct: 540 MVEINEERAAKILRKWAIDEAA 561


>gi|323940403|gb|EGB36594.1| flagellar M-ring protein FliF [Escherichia coli E482]
          Length = 552

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 130/577 (22%), Positives = 235/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT      R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQFNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                    A ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIAQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|261855054|ref|YP_003262337.1| flagellar M-ring protein FliF [Halothiobacillus neapolitanus c2]
 gi|261835523|gb|ACX95290.1| flagellar M-ring protein FliF [Halothiobacillus neapolitanus c2]
          Length = 590

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 117/572 (20%), Positives = 229/572 (40%), Gaps = 35/572 (6%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
               T     R L++   +   +   +    +   P    LY  L   +   +  AL  A
Sbjct: 26  IDGFTQSSSFRQLLILVALAATLSFMVGFFLWGQKPSLVPLYTNLGPKESAAVVEALRAA 85

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
             ++++S +G +I V  + +   R+ LA +GLP S +  G E+ DK  S G + F+++  
Sbjct: 86  KKNYQLSADG-AILVDPAQLPAVRMLLAGEGLP-SGNGVGLEMLDKDQSLGTSQFVEQAR 143

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVM--IRAINPSVYKSA 188
              A+E E+AR+I++I G+ AARVH+  P    F +   +PTASV+  +           
Sbjct: 144 YQHAIEIELARSIETIQGVSAARVHLATPKQSVFVREQQKPTASVVVELSPGQSLTADQV 203

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN---ILGKSLSIVQAIQHEIEMNI 245
            AI HLVA++V  +   +V+V+D  G+LL+ N  + +   +  K  +  Q ++      I
Sbjct: 204 RAIVHLVASSVAGMKPENVSVIDQRGELLSQNSDDASGMGLTDKQFAYRQRVERAYARQI 263

Query: 246 NKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQR-SETSQPES 304
              L   +G +  R+ V A+++   Q+     Y P + V  S + +   +   +      
Sbjct: 264 EALLTPIVGANQVRAQVSADIDFSRQEGTSETYGPKTGVVLSEQTNDTTRALGDQGINGG 323

Query: 305 AVTVEQNMPHVSDRKVPLPRSLEN------------------TDKKEEQSNYEINTKSIA 346
                 N P       P                         + +K E  NY ++     
Sbjct: 324 VPGALSNQPPGGGTVTPQTSGGLQPPANLDVQQYQQIIQTPISTQKNETRNYNVDKDIRH 383

Query: 347 TTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTI 406
           T + +  +++L++AV++++  +T+  G++  +   D+ LA I  +VS A G++ +RGD +
Sbjct: 384 TQYASGAVDKLNVAVLLDEKTVTDKDGKTKTEPMSDAELARIKDLVSQAVGLDEQRGDKL 443

Query: 407 TITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNI 466
           T+ S+ F+E ++                 F  ++  L   V  LL+  + +  L ++   
Sbjct: 444 TLASIPFVEQKIEKVSVPLW-----QQEWFMPLLKNLGLGVAMLLIFLMVVRPLLKMLAD 498

Query: 467 DDAKKGEVGGKSILSPPPISS----AVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSY 522
               +          P                   +        D   +   +   + + 
Sbjct: 499 KSRPEALPHQPGAALPNGTEDNGMNEEGVSFTRQASEGGQIPGPDDEDNLEGVPQLVGAA 558

Query: 523 VSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                  +L   I  + +  A ++++W  SE 
Sbjct: 559 SYADKLRQLKQSINHDPKAVAAVIKQWTHSEN 590


>gi|170019729|ref|YP_001724683.1| flagellar MS-ring protein [Escherichia coli ATCC 8739]
 gi|188492347|ref|ZP_02999617.1| flagellar M-ring protein FliF [Escherichia coli 53638]
 gi|300951563|ref|ZP_07165396.1| flagellar M-ring protein FliF [Escherichia coli MS 116-1]
 gi|300956546|ref|ZP_07168828.1| flagellar M-ring protein FliF [Escherichia coli MS 175-1]
 gi|169754657|gb|ACA77356.1| flagellar M-ring protein FliF [Escherichia coli ATCC 8739]
 gi|188487546|gb|EDU62649.1| flagellar M-ring protein FliF [Escherichia coli 53638]
 gi|300316646|gb|EFJ66430.1| flagellar M-ring protein FliF [Escherichia coli MS 175-1]
 gi|300449190|gb|EFK12810.1| flagellar M-ring protein FliF [Escherichia coli MS 116-1]
 gi|332093105|gb|EGI98169.1| flagellar M-ring protein FliF [Shigella boydii 5216-82]
          Length = 552

 Score =  371 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 234/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT      R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQFNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|193222343|emb|CAL62027.2| Flagellar M-ring protein [Herminiimonas arsenicoxydans]
          Length = 562

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 123/573 (21%), Positives = 221/573 (38%), Gaps = 59/573 (10%)

Query: 13  SGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANI 72
           +       R  +L   +   I + +    +   P Y  L+      D   I  +L  AN+
Sbjct: 17  NMAKSPNGRKFLLMVGVAAVIAVMIGLVLWGQKPEYRVLFSNFSDRDGGAIMTSLQAANV 76

Query: 73  DFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRV 132
            ++ ++ G +I VP+  V + R+ LAA+GLP   S  G+EL  +    G++ F++++   
Sbjct: 77  PYKFAEGGGAILVPADKVHEIRLKLAAEGLPKGGS-VGFELM-ENQKLGVSQFLEQVNFQ 134

Query: 133 RALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPSVYKSAEA 190
           RALEGE+AR+IQS+  + AARVH+ +P    F +   +PTASV++          +   A
Sbjct: 135 RALEGELARSIQSVGAVQAARVHLALPKASVFVRDQQKPTASVLLNLHAGRFLDQQQVSA 194

Query: 191 IRHLVAAAVPNLDMGDVTVLDSTGKLLTANE---MERNILGKSLSIVQAIQHEIEMNINK 247
           I HLVA++VP L   +VT++D  G LL+ N        +    L  VQ +Q  I   I  
Sbjct: 195 IVHLVASSVPELSPKNVTIVDQAGNLLSENNKPAGTNTLDPSQLKYVQELQQNIAKRIES 254

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS--QPESA 305
            +   +G++N R+   A+++  T +    +Y P+     +   S+    S          
Sbjct: 255 IITPIVGLNNVRAEATADVDFSTSEQAAEIYKPNQVPSSATVRSQQTSESTNGSNNATGV 314

Query: 306 VTVEQNMPHVSDRKVPLPRSLENTD-------------------------KKEEQSNYEI 340
                N P  +                                       +++  +NYE+
Sbjct: 315 PGALTNQPAPAATAPLNTTPQTTAAPGTPGAPGTPGAPAATATAPQATPIQRDTTTNYEV 374

Query: 341 NTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINS 400
           +            L+RLS+AVVVN  R+    G+ +     +    +I  +V  A G N 
Sbjct: 375 DKTIRYVQQPMGGLKRLSVAVVVNYKRVVGKDGKVSFLPLTEIEKTQITDLVREAMGYNK 434

Query: 401 RRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHAL 460
            RGDT+ + +  F  +    +  + +                L+  +  L++ F  L  L
Sbjct: 435 DRGDTLNVVNSPFAGSNKEEAPKLPLWERPEAIDMGMQGAKYLLLGIVLLILYFKVLKPL 494

Query: 461 RRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRIN 520
               N       +  G+ +     +   V                             I+
Sbjct: 495 LNKLNPPPLALTDESGQPVGMAQELEEEVG-------------------------PMGIH 529

Query: 521 SYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
            +  +Q+      +   + +  A I++ W  +E
Sbjct: 530 MHSYQQNLEAAKELARQDPKVVANIVKAWVGNE 562


>gi|187926897|ref|YP_001893242.1| flagellar M-ring protein FliF [Ralstonia pickettii 12J]
 gi|241665226|ref|YP_002983585.1| flagellar M-ring protein FliF [Ralstonia pickettii 12D]
 gi|187728651|gb|ACD29815.1| flagellar M-ring protein FliF [Ralstonia pickettii 12J]
 gi|240867253|gb|ACS64913.1| flagellar M-ring protein FliF [Ralstonia pickettii 12D]
          Length = 611

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 129/580 (22%), Positives = 242/580 (41%), Gaps = 49/580 (8%)

Query: 14  GTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANID 73
              L    ++++    LV   +  A   +  +P Y  L+  +  +D   I  AL + N+ 
Sbjct: 41  LGRLSPRLLMMIGGAALV--AVLAAVMLWSRAPDYRVLFSNVSDADGGAIIAALQQMNVP 98

Query: 74  FRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVR 133
           +R +D G++I VP + V + R+ LA+QGLP     +G+EL  +   FG + F +++   R
Sbjct: 99  YRFADGGTAIMVPEANVHETRLKLASQGLPKGGL-AGFELM-ENQKFGTSQFAEQVNYQR 156

Query: 134 ALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP--SVYKSAEAI 191
           ALEGE+ARTIQ++  + +ARVH+ +     F +  A+P+ASV++             +AI
Sbjct: 157 ALEGELARTIQAMQEVQSARVHLALSKPSVFVREQAKPSASVLLTLYPGRMLDRSQVQAI 216

Query: 192 RHLVAAAVPNLDMGDVTVLDSTGKLLTA--NEMERNILGKSLSIVQAIQHEIEMNINKAL 249
            HLV+++VPNL + +VTV+D  G+LL++   +    +    L+ V+ I+      I   L
Sbjct: 217 GHLVSSSVPNLPLANVTVVDQAGRLLSSSFQDNASGLDPTQLNYVREIEQGYIKRIEAIL 276

Query: 250 AAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQP---ESAV 306
              +G DN R+ V A++++D  +     Y P+     +   S     S  ++        
Sbjct: 277 GPVVGDDNVRAQVTADVDLDNTEQMAETYRPNQDPSTAAVRSTHTAESTQNKADAQGGVP 336

Query: 307 TVEQNMPHVSDRK-------------------------------VPLPRSLENTDKKEEQ 335
               N P  + R                                     +   +  ++  
Sbjct: 337 GALSNQPPTAPRMLPTAPAPASQPAAAGPNGANGQAQQPAAANTNATTTNGATSSTRDTT 396

Query: 336 SNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAA 395
           +NYE++     T      + RLS+AVVVN             +   D+ +A++N +V  A
Sbjct: 397 TNYEVDKTVRRTRAAVGTVRRLSVAVVVNYRA-----DGKTWKPLSDAEMAKLNALVKDA 451

Query: 396 TGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFL 455
            G +++RGD++ + +  F          + +     + ++       L   +G L++ F 
Sbjct: 452 VGFDAKRGDSVNVVNSQFSGTLPVPKDDLPLWKQPEMIQYAIQAAKYLALAIGFLILVFA 511

Query: 456 GLHALRRLHNIDDAKKGE--VGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSR 513
            +  L R  N  DA      VG +      PI +       P       S+         
Sbjct: 512 VIRPLIRSLNKKDAPATPTFVGREGEDPNAPIITGAAASAGPELEGPSSSAIGAGGEDVP 571

Query: 514 NLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
           +   ++ +   +     +  + + N    A ++++W  +E
Sbjct: 572 DSLPQLKNADFEHKLETMRRVAQQNPRAVAAVIKQWVSNE 611


>gi|237799234|ref|ZP_04587695.1| flagellar MS-ring protein [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331022089|gb|EGI02146.1| flagellar MS-ring protein [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 595

 Score =  370 bits (950), Expect = e-100,   Method: Composition-based stats.
 Identities = 124/587 (21%), Positives = 231/587 (39%), Gaps = 55/587 (9%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  +I   L
Sbjct: 24  LSFLENLSEMTMLRQVGLMVGLAASVAIGFAVVLWSQQPDYRPLYGSLAGLDSKQIMETL 83

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + ANI++ +  N  ++ V S  V +ARI LA  G+  + +N G+E+ DK    G + FM+
Sbjct: 84  TAANINYTVEPNSGALLVKSDDVQRARIQLAQAGVVQNDANIGFEILDKDQGLGTSQFME 143

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPSVY 185
                R LEGE+ARTI +++ + AARVH+ +P    F +   +P+ASV++          
Sbjct: 144 ATRYRRGLEGELARTISALNNVKAARVHLAIPKSSVFVRDDRKPSASVLVELYAGRSLEP 203

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN--ILGKSLSIVQAIQHEIEM 243
               AI +LVA +VP L    +TV+D  G LL+         + GK     + ++  +  
Sbjct: 204 SQVLAIINLVATSVPELSKSQITVVDQKGTLLSDQAENSELTMAGKQFDYSRRMEGMLTQ 263

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            +   L   LG D +++ V A ++    +     ++PD    RS +   + QRS +S   
Sbjct: 264 RVQNILQPILGNDRYKAEVSAVVDFSAVESTAESFNPDQPALRSEQSV-NEQRSSSSGSG 322

Query: 304 SAVTVEQNMPHVSDRKVPLPRSL-----------------------------------EN 328
                  N P           +                                      
Sbjct: 323 GVPGALSNQPPGPATAPQTAGAGGAGAAGPIAPGQPLLDANGQQIMDPATGQPALAPFPA 382

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEV-LGRSADQGKIDSYLAE 387
             + +   N+E++     T     +L RLS+AVVV+    T    G  +      + LA 
Sbjct: 383 DKRVQSTKNFELDRSISHTKQQQGRLTRLSVAVVVDDMVKTNAANGEVSRAPWSAADLAR 442

Query: 388 INKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLV 447
             ++V  A G ++ RGD++++ ++ F   +                  F  ++   V ++
Sbjct: 443 FTRLVQDAVGFDASRGDSVSVINVPFSSERAEVLPEASF----YSQPWFWDLVKQAVGVI 498

Query: 448 GTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQD 507
             L++ F  L  +  L+NI + K  ++                 G + ND ++L      
Sbjct: 499 FILILVFGVLRPV--LNNITNGKSKQLAAFGGGDAELGGMGGLDGELSNDRVSLGGPQSI 556

Query: 508 IFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
           +            +         +  ++  +  R A+++++W  ++ 
Sbjct: 557 LLPSP--------TEGYDAQLNAIKSLVAEDPGRVAQVVKEWINTDE 595


>gi|260466610|ref|ZP_05812798.1| flagellar M-ring protein FliF [Mesorhizobium opportunistum WSM2075]
 gi|259029616|gb|EEW30904.1| flagellar M-ring protein FliF [Mesorhizobium opportunistum WSM2075]
          Length = 549

 Score =  370 bits (949), Expect = e-100,   Method: Composition-based stats.
 Identities = 225/552 (40%), Positives = 328/552 (59%), Gaps = 7/552 (1%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           +Q+     +    G  R+ +LA + ++ + +   A  ++N P YD LYV L+ SDVN+I 
Sbjct: 3   EQIQSIISNLRGFGVKRLAMLAGIAVLVMGVIGIASVYLNRPAYDTLYVGLDRSDVNQIG 62

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
           + L EA I F +  +G+S+ VP+    +AR+ LA +GLP+S +N+GYELFD V + GLTS
Sbjct: 63  LVLGEAGIGFDVGADGTSVLVPAGTTAQARMLLAEKGLPTS-ANAGYELFDNVGAMGLTS 121

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV 184
           FMQ+ITRVRALEGEIARTIQSI+GI AARVHIVM +  +FR+   +P+ASV+IR      
Sbjct: 122 FMQQITRVRALEGEIARTIQSIAGIKAARVHIVMSERANFRRDEQQPSASVVIRYAGIDA 181

Query: 185 YKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQHEIEM 243
            KSA +IRHLVAAAVP L    VTVLDS G LL A +   N    ++L + Q ++ +I  
Sbjct: 182 EKSAMSIRHLVAAAVPGLSADKVTVLDSNGNLLAAGDDPSNTSAARTLGVEQTVEAQIGD 241

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
           NI +AL  +LG DNFR++V AE+N DT+Q  E ++DP+S+VERS++  +  + S   Q  
Sbjct: 242 NIRRALTPYLGPDNFRASVKAEVNTDTRQTEETIFDPNSRVERSVQSVRANENSNQKQAS 301

Query: 304 SAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVV 363
           +  +VEQN+P         P++    D+KEE +NYEIN+K IAT  + Y + ++SIAVVV
Sbjct: 302 TPASVEQNLPETQAASTEGPQTSSANDRKEEITNYEINSKKIATVSNGYTVTKMSIAVVV 361

Query: 364 NKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGT 423
           N+ RL  +LG+ A   +I   +AEI K+VS+ATG + +RGD I +++++F++  L     
Sbjct: 362 NQDRLKTILGKDATPEQIAKRVAEIQKMVSSATGFDDKRGDVIDVSAVEFID-GLDGEAV 420

Query: 424 VQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPP 483
            Q   +D + +H  T+INA  F+V   LV F GL  +             + G +     
Sbjct: 421 PQAGMLDSIGQHAGTLINAGAFIVVVFLVAFFGLRPMAAALTAKATPTPAISGPNFDEVQ 480

Query: 484 PISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFA 543
                       N  +    S +   +   +L+ +I          RL  M++INEER A
Sbjct: 481 RSLPTPEAAASANAAVGALPSARPGATPLDDLRQKIRPA----PQERLARMVDINEERTA 536

Query: 544 KILRKWARSEIE 555
           +ILRKWA  E+ 
Sbjct: 537 QILRKWAAQEVA 548


>gi|325291912|ref|YP_004277776.1| flagellar MS-ring protein [Agrobacterium sp. H13-3]
 gi|325059765|gb|ADY63456.1| flagellar MS-ring protein [Agrobacterium sp. H13-3]
          Length = 560

 Score =  370 bits (949), Expect = e-100,   Method: Composition-based stats.
 Identities = 270/555 (48%), Positives = 384/555 (69%), Gaps = 7/555 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M +L+Q+ Q  K+  +LG+TR+L+L  V ++ + + +AA  +VN P Y+ LYV LE SD+
Sbjct: 1   MNLLNQIPQVLKNFAALGQTRLLMLGGVGILSMAIILAAALYVNRPAYETLYVGLEKSDL 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           N+IS+AL+EA +DF++  +G+S+ VP  +  KAR+ LA +GLP  S+N+GYELFD V S 
Sbjct: 61  NKISIALAEAGLDFQVGTDGASLQVPVGLTSKARLLLAERGLP-DSANAGYELFDNVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEI+R+IQ I GI AARVHIVMPD+G+FR+   +PTASVMIRA 
Sbjct: 120 GLTSFMQEVTRVRALEGEISRSIQQIDGIAAARVHIVMPDVGNFRRGEQKPTASVMIRAN 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL-GKSLSIVQAIQH 239
             +  K++ +IRHLVA+AVP L++ DVT+LDSTG+LL + +   N    +SL++ Q +Q 
Sbjct: 180 ATAGRKASASIRHLVASAVPGLEVDDVTLLDSTGQLLASGDDVTNAAMNRSLTLAQNVQQ 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           EI  NI+KALA FLG+DNFRS+V A+LN D++QI+E VYDP+S+VERS+R  K+ Q+S+ 
Sbjct: 240 EITTNIDKALAPFLGMDNFRSSVTAQLNTDSRQIQETVYDPESRVERSVRTVKEDQKSQE 299

Query: 300 SQPESAVTVEQNMPHVSDRKV-PLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLS 358
           +QP++A TVEQN+P  + +     P+S + + KKEEQ+NYEIN+K++AT  + Y +E++S
Sbjct: 300 TQPDTAATVEQNVPQAAPQGGAGGPQSSDQSAKKEEQTNYEINSKTVATVKNGYTVEKIS 359

Query: 359 IAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQL 418
           +AVVVNKGR+ +++G   DQ KID+YLAE+ KIV++A G++S RGD +T+T+MDFLE QL
Sbjct: 360 VAVVVNKGRIAKMVGEPVDQAKIDAYLAEMQKIVTSAAGVSSDRGDIVTLTAMDFLETQL 419

Query: 419 FNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKG----EV 474
            +        M++LSR+ A +IN+L F+    LV +LG+  L R    + A  G    E 
Sbjct: 420 LDEAASGPGIMEVLSRNSAGIINSLAFVAVAFLVVWLGVRPLVRTVTGNGAAAGQISQET 479

Query: 475 GGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHM 534
            G  +    P   A   GLM          + D      + +   N  V +  + RL  M
Sbjct: 480 AGLELPDFSPGMDAGAGGLMEGFGADFGFDSTDDLLAGGDSEGTFNRRVREGPERRLSRM 539

Query: 535 IEINEERFAKILRKW 549
           +EI+EER AKILRKW
Sbjct: 540 VEISEERAAKILRKW 554


>gi|197249147|ref|YP_002146054.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197212850|gb|ACH50247.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
          Length = 579

 Score =  370 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 126/572 (22%), Positives = 227/572 (39%), Gaps = 52/572 (9%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +  +P Y  L+  L   D   I   L++ 
Sbjct: 33  LEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQM 92

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +R ++   +I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 93  NIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVN 150

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--SA 188
             RALEGE+ARTI+++  + +ARVH+ MP    F +    P+ASV +             
Sbjct: 151 YQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQI 210

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEIEMNINK 247
            A+ HLV++AV  L  G+VT++D +G LLT +    R++    L     ++  I+  I  
Sbjct: 211 SAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEA 270

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PES 304
            L+  +G  N  + V A+L+   ++  E  Y P+    ++   S+    SE      P  
Sbjct: 271 ILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGG 330

Query: 305 AVTVEQNMP---------------------HVSDRKVPLPRSLENTDKKEEQSNYEINTK 343
                 N P                       +        +     ++ E SNYE++  
Sbjct: 331 VPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNNAGPRNTQRNETSNYEVDRT 390

Query: 344 SIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRG 403
              T  +   +ERLS+AVVVN   L +              + +I  +   A G + +RG
Sbjct: 391 IRHTKMNVGDIERLSVAVVVNYKTLADGK----PLPLTADQMKQIEDLTREAMGFSDKRG 446

Query: 404 DTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL 463
           DT+ + +  F                         ++ A  +L+  ++   L   A+R  
Sbjct: 447 DTLNVVNSPFSAVDNTGGELP----FWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQ 502

Query: 464 HNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYV 523
                 +      ++ +                +       ++D     R    R+ + V
Sbjct: 503 LTRRVEEAKAAQEQAQVR------------QETEEAVEVRLSKDEQLQQRRANQRLGAEV 550

Query: 524 SKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
             Q   R+  M + +    A ++R+W  ++ E
Sbjct: 551 MSQ---RIREMSDNDPRVVALVIRQWMSNDHE 579


>gi|134095076|ref|YP_001100151.1| flagellar MS-ring protein [Herminiimonas arsenicoxydans]
          Length = 545

 Score =  370 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 123/572 (21%), Positives = 220/572 (38%), Gaps = 59/572 (10%)

Query: 14  GTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANID 73
                  R  +L   +   I + +    +   P Y  L+      D   I  +L  AN+ 
Sbjct: 1   MAKSPNGRKFLLMVGVAAVIAVMIGLVLWGQKPEYRVLFSNFSDRDGGAIMTSLQAANVP 60

Query: 74  FRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVR 133
           ++ ++ G +I VP+  V + R+ LAA+GLP   S  G+EL  +    G++ F++++   R
Sbjct: 61  YKFAEGGGAILVPADKVHEIRLKLAAEGLPKGGS-VGFELM-ENQKLGVSQFLEQVNFQR 118

Query: 134 ALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPSVYKSAEAI 191
           ALEGE+AR+IQS+  + AARVH+ +P    F +   +PTASV++          +   AI
Sbjct: 119 ALEGELARSIQSVGAVQAARVHLALPKASVFVRDQQKPTASVLLNLHAGRFLDQQQVSAI 178

Query: 192 RHLVAAAVPNLDMGDVTVLDSTGKLLTANE---MERNILGKSLSIVQAIQHEIEMNINKA 248
            HLVA++VP L   +VT++D  G LL+ N        +    L  VQ +Q  I   I   
Sbjct: 179 VHLVASSVPELSPKNVTIVDQAGNLLSENNKPAGTNTLDPSQLKYVQELQQNIAKRIESI 238

Query: 249 LAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS--QPESAV 306
           +   +G++N R+   A+++  T +    +Y P+     +   S+    S           
Sbjct: 239 ITPIVGLNNVRAEATADVDFSTSEQAAEIYKPNQVPSSATVRSQQTSESTNGSNNATGVP 298

Query: 307 TVEQNMPHVSDRKVPLPRSLENTD-------------------------KKEEQSNYEIN 341
               N P  +                                       +++  +NYE++
Sbjct: 299 GALTNQPAPAATAPLNTTPQTTAAPGTPGAPGTPGAPAATATAPQATPIQRDTTTNYEVD 358

Query: 342 TKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSR 401
                       L+RLS+AVVVN  R+    G+ +     +    +I  +V  A G N  
Sbjct: 359 KTIRYVQQPMGGLKRLSVAVVVNYKRVVGKDGKVSFLPLTEIEKTQITDLVREAMGYNKD 418

Query: 402 RGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALR 461
           RGDT+ + +  F  +    +  + +                L+  +  L++ F  L  L 
Sbjct: 419 RGDTLNVVNSPFAGSNKEEAPKLPLWERPEAIDMGMQGAKYLLLGIVLLILYFKVLKPLL 478

Query: 462 RLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINS 521
              N       +  G+ +     +   V                             I+ 
Sbjct: 479 NKLNPPPLALTDESGQPVGMAQELEEEVG-------------------------PMGIHM 513

Query: 522 YVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
           +  +Q+      +   + +  A I++ W  +E
Sbjct: 514 HSYQQNLEAAKELARQDPKVVANIVKAWVGNE 545


>gi|194439576|ref|ZP_03071649.1| flagellar M-ring protein FliF [Escherichia coli 101-1]
 gi|194421485|gb|EDX37499.1| flagellar M-ring protein FliF [Escherichia coli 101-1]
 gi|323972762|gb|EGB67962.1| flagellar M-ring protein FliF [Escherichia coli TA007]
          Length = 552

 Score =  370 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 235/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLHANPKIPLIVTGSAAVAVMVALILWAKTPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|194469863|ref|ZP_03075847.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|200390157|ref|ZP_03216768.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205358799|ref|ZP_02659200.2| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194456227|gb|EDX45066.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|199602602|gb|EDZ01148.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205331875|gb|EDZ18639.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
          Length = 579

 Score =  370 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 126/572 (22%), Positives = 228/572 (39%), Gaps = 52/572 (9%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +  +P Y  L+  L   D   I   L++ 
Sbjct: 33  LEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQM 92

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +R ++   +I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 93  NIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVN 150

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--SA 188
             RALEGE+ARTI+++  + +ARVH+ MP    F +    P+ASV +             
Sbjct: 151 YQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQI 210

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEIEMNINK 247
            A+ HLV++AV  L  G+VT++D +G LLT +    R++    L     ++  I+  I  
Sbjct: 211 SAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEA 270

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PES 304
            L+  +G  N  + V A+L+   ++  E  Y P+    ++   S+    SE      P  
Sbjct: 271 ILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGG 330

Query: 305 AVTVEQNMP---------------------HVSDRKVPLPRSLENTDKKEEQSNYEINTK 343
                 N P                       +        +   + ++ E SNYE++  
Sbjct: 331 VPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNSAGPRSTQRNETSNYEVDRT 390

Query: 344 SIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRG 403
              T  +   +ERLS+AVVVN   L +              + +I  +   A G + +RG
Sbjct: 391 IRHTKMNVGDIERLSVAVVVNYKTLADGK----PLPLTADQMKQIEDLTREAMGFSDKRG 446

Query: 404 DTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL 463
           DT+ + +  F                         ++ A  +L+  ++   L   A+R  
Sbjct: 447 DTLNVVNSPFSAVDDTGGELP----FWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQ 502

Query: 464 HNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYV 523
                 +      ++ +                +       ++D     R    R+ + V
Sbjct: 503 LTRRVEEAKAAQEQAQVR------------QETEEAVEVRLSKDEQLQQRRANQRLGAEV 550

Query: 524 SKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
             Q   R+  M + +    A ++R+W  ++ E
Sbjct: 551 MSQ---RIREMSDNDPRVVALVIRQWMSNDHE 579


>gi|198243509|ref|YP_002215117.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|197938025|gb|ACH75358.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
          Length = 576

 Score =  370 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 126/572 (22%), Positives = 227/572 (39%), Gaps = 52/572 (9%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +  +P Y  L+  L   D   I   L++ 
Sbjct: 30  LEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQM 89

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +R ++   +I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 90  NIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVN 147

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--SA 188
             RALEGE+ARTI+++  + +ARVH+ MP    F +    P+ASV +             
Sbjct: 148 YQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQI 207

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEIEMNINK 247
            A+ HLV++AV  L  G+VT++D +G LLT +    R++    L     ++  I+  I  
Sbjct: 208 SAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEA 267

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PES 304
            L+  +G  N  + V A+L+   ++  E  Y P+    ++   S+    SE      P  
Sbjct: 268 ILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGG 327

Query: 305 AVTVEQNMP---------------------HVSDRKVPLPRSLENTDKKEEQSNYEINTK 343
                 N P                       +        +     ++ E SNYE++  
Sbjct: 328 VPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNSAGPRNTQRNETSNYEVDRT 387

Query: 344 SIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRG 403
              T  +   +ERLS+AVVVN   L +              + +I  +   A G + +RG
Sbjct: 388 IRHTKMNVGDIERLSVAVVVNYKTLADGK----PLPLTADQMKQIEDLTREAMGFSDKRG 443

Query: 404 DTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL 463
           DT+ + +  F                         ++ A  +L+  ++   L   A+R  
Sbjct: 444 DTLNVVNSPFSAVDNTGGELP----FWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQ 499

Query: 464 HNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYV 523
                 +      ++ +                +       ++D     R    R+ + V
Sbjct: 500 LTRRVEEAKAAQEQAQVR------------QETEEAVEVRLSKDEQLQQRRANQRLGAEV 547

Query: 524 SKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
             Q   R+  M + +    A ++R+W  ++ E
Sbjct: 548 MSQ---RIREMSDNDPRVVALVIRQWMSNDHE 576


>gi|325981191|ref|YP_004293593.1| flagellar M-ring protein FliF [Nitrosomonas sp. AL212]
 gi|325530710|gb|ADZ25431.1| flagellar M-ring protein FliF [Nitrosomonas sp. AL212]
          Length = 571

 Score =  370 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 131/572 (22%), Positives = 218/572 (38%), Gaps = 49/572 (8%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +  +SL   + L L +     I L + A  +  +P Y  LY  L   D   I  AL + 
Sbjct: 19  LEHLSSLSNQKKLGLITSAAAVIALLVGALMWSQAPEYRALYNNLSDHDGAAIISALQQM 78

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           N+ +  S++G +I +P   V + R+ LA QGLP      G+EL  +   FG + F++++ 
Sbjct: 79  NVPYTFSESGGTILIPEKQVHEVRLKLAGQGLPKGGL-VGFELM-ENQKFGSSQFLEQVN 136

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP--SVYKSA 188
             RALEGE+AR++QS+S + +ARVH+ +     F +   +P+ SV++          +  
Sbjct: 137 YQRALEGELARSVQSLSAVQSARVHLAIAKPSVFSREKQQPSVSVLLNLYPGRVLSIEQV 196

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM---ERNILGKSLSIVQAIQHEIEMNI 245
            AI HL+A++VPNL + +VTV+D  G LL++      +     K L+ +Q ++      I
Sbjct: 197 SAIVHLMASSVPNLPVKNVTVVDQNGNLLSSQNDKKEDSRFDAKQLAYIQELEENYIRRI 256

Query: 246 NKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVE-RSIRLSKDAQRSETSQP-- 302
              L    G  N R+ V A+++    +  E  Y P++    R+   S+    S +     
Sbjct: 257 ETILTPITGATNVRAQVTADVDFSRIERAEETYRPNNTEADRASIRSQQTHESMSIGSKF 316

Query: 303 -ESAVTVEQNMPHVSDRKVPLPRSL--------------------ENTDKKEEQSNYEIN 341
                    N P                                     KKE   NYE++
Sbjct: 317 DGGIPGALTNRPPEPAIAPIEAGGKKPAGDKAEGDEEETDSTPPLPTDKKKESTINYEVD 376

Query: 342 TKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSR 401
                T      ++RLS AVVVN  +  +  G    +      + EIN +V  A G N R
Sbjct: 377 KTVQHTQQSTGNIKRLSAAVVVNYRKKVDESGAITYEPLSAEEIKEINNLVREAMGYNER 436

Query: 402 RGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALR 461
           RGD++T+T+  F                           +    L+   +V F  L  LR
Sbjct: 437 RGDSLTVTNGLFTGETETVLEVP----FWKDPDVIMLAKDFAKQLLIIGVVLFFLLKILR 492

Query: 462 RLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINS 521
                                        T  +  D  AL+         +     +   
Sbjct: 493 PFLKSLAPPPPLPALT-----------DNTTQVAADGTALEQLPGQTDGTAMQAIQK--- 538

Query: 522 YVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
            +  ++  R   +        A +++ W    
Sbjct: 539 SMFDENLKRAKQLAMDEPAIVANVVKDWIVKN 570


>gi|295098292|emb|CBK87382.1| flagellar basal-body M-ring protein/flagellar hook-basal body
           protein (fliF) [Enterobacter cloacae subsp. cloacae NCTC
           9394]
          Length = 543

 Score =  370 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 129/568 (22%), Positives = 227/568 (39%), Gaps = 51/568 (8%)

Query: 14  GTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANID 73
              L     + L       I + +A   +  SP Y  LY  L   D   I   L++ NI 
Sbjct: 1   MNRLRANPKIPLIVAGAAAIAIVVAMVLWAKSPDYRTLYSNLSDQDGGAIVTQLTQMNIP 60

Query: 74  FRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVR 133
           +R +DNG ++ VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   R
Sbjct: 61  YRFADNGGALEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVNYQR 118

Query: 134 ALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVM--IRAINPSVYKSAEAI 191
           ALEGE+ARTI+++  + +ARVH+ MP    F +    P+ASV   +            A+
Sbjct: 119 ALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVNLEPGRALDEGQISAV 178

Query: 192 RHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEIEMNINKALA 250
            HLV++AV  L  G+VT++D +G LLT +    R++    L     ++  ++  I   L 
Sbjct: 179 THLVSSAVAGLPPGNVTLVDQSGHLLTQSNTAGRDLNDAQLKYAADVEGRLQRRIEAILG 238

Query: 251 AFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVT 307
             +G  N  + V A+++   ++  E  Y P+    R++  S+    +E      P     
Sbjct: 239 PVVGSSNVHAQVTAQIDFSNKEQTEEQYAPNGDASRAVLRSRQINETEQVGGQYPGGVPG 298

Query: 308 VEQNMPHVSDRKV--------------------PLPRSLENTDKKEEQSNYEINTKSIAT 347
              N P  ++                           +      + E +NYE++     T
Sbjct: 299 ALSNQPAPANAAPISTPPANPQNGQQTNQQTTSTANSTGPRNSSRNETTNYEVDRTIRHT 358

Query: 348 THDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTIT 407
             +   ++RLS+AVVVN   L +              + +I  +   A G + +RGDT+ 
Sbjct: 359 KLNTGDIQRLSVAVVVNYKTLPDGK----PLPLTAEQMKQIEDLTREAMGFSEKRGDTLN 414

Query: 408 ITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNID 467
           + +  F                      F  +++A  +L+  ++   L    +R      
Sbjct: 415 VVNSPFNPVDETGGELP----FWQQQAFFDQLMSAGRWLLVLIVAWLLWRKGVRPQLQRR 470

Query: 468 DAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQS 527
              +     +    P              +       ++D     R    R+ + V  Q 
Sbjct: 471 AEAEKAALEQKNARP------------DEEEAVEVRLSKDEQMQQRRANQRMGAEVMSQ- 517

Query: 528 DLRLLHMIEINEERFAKILRKWARSEIE 555
             R+  M + +    A ++R W  +E E
Sbjct: 518 --RIREMSDNDPRVVALVIRGWMGNEHE 543


>gi|82702474|ref|YP_412040.1| flagellar MS-ring protein [Nitrosospira multiformis ATCC 25196]
 gi|82410539|gb|ABB74648.1| flagellar M-ring protein FliF [Nitrosospira multiformis ATCC 25196]
          Length = 567

 Score =  370 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 119/561 (21%), Positives = 220/561 (39%), Gaps = 48/561 (8%)

Query: 10  FFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSE 69
                T L   + + L   +   + L  A   +   P Y  L+  +   D   I  +L +
Sbjct: 33  LQSFLTRLSSQQKIGLMLTVSSLVALLAAGWMWTQGPDYKVLFSNVSDGDGGAIIASLQQ 92

Query: 70  ANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEI 129
            N+ ++ ++ G +I VPSS V   R+ LA+QGLP      G+EL  +   FG + F++++
Sbjct: 93  MNVPYKFAEGGGAILVPSSQVHDTRLKLASQGLPRGGL-VGFELM-ENQKFGTSQFLEQV 150

Query: 130 TRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN--PSVYKS 187
              RALEGE+AR++Q+++ + +ARVH+ +P    F +   +P+ASV++          + 
Sbjct: 151 NFQRALEGELARSVQALAAVDSARVHLAIPKQSVFMREQQKPSASVLVNLYPGRTLDPQQ 210

Query: 188 AEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG---KSLSIVQAIQHEIEMN 244
             AI HLV+++VPNL + +VTV+D  G LLT  +      G     L  + A++      
Sbjct: 211 VNAIVHLVSSSVPNLHVKNVTVVDQQGDLLTRIDESNPNTGLDPAQLKYLHALEQSYIKR 270

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQP-- 302
           I   L   +G +N R+ V AE++    +     Y P+     S   S+ +  S       
Sbjct: 271 IEAILIPIVGQENVRAQVAAEVDFAHSEQTSETYRPNQDPAGSTIRSQQSSESTNVGTQN 330

Query: 303 -ESAVTVEQNMPHVSDRK-----------VPLPRSLENTDKKEEQSNYEINTKSIATTHD 350
                    N P V                  P    ++ +K+   NYE++         
Sbjct: 331 EGGVPGALSNQPPVPATAPVTTPPAPPGATASPSRAPSSTRKDATINYEVDKTIQHVRKP 390

Query: 351 NYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITS 410
              ++RLS+AVVVN  R+ +  G  + +   +   ++I  +V  A G +  RGDT+ + +
Sbjct: 391 VGGIKRLSVAVVVNHRRVVDENGVVSAKPLSEVEKSQITDLVKEAVGFSRERGDTLNVVN 450

Query: 411 MDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAK 470
             F   +   +  + +     +      +   L+     L +    L    +  +  +  
Sbjct: 451 SHFTGVEREAAPELPLWKQPEVVELAQQIGKTLLIGGLILYLVLGVLRPSLKRISQPEPP 510

Query: 471 KGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLR 530
                        P+                             L+        +Q    
Sbjct: 511 LLAEPRNDDQDVQPV---------------------------PALKPAAQPSEYEQRLTL 543

Query: 531 LLHMIEINEERFAKILRKWAR 551
              + +   +  A ++++W  
Sbjct: 544 ARQLAKKEPKLVANVVKQWVA 564


>gi|293410294|ref|ZP_06653870.1| flagellar M-ring protein FliF [Escherichia coli B354]
 gi|291470762|gb|EFF13246.1| flagellar M-ring protein FliF [Escherichia coli B354]
          Length = 552

 Score =  370 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 130/577 (22%), Positives = 236/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIIAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +S P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSSYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRHAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|1772459|dbj|BAA14029.1| FliF [Escherichia coli W3110]
          Length = 552

 Score =  370 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 130/577 (22%), Positives = 235/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N R+ V A L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIRAQVTAHLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|194451642|ref|YP_002046020.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|195873172|ref|ZP_02696421.2| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|205357978|ref|ZP_03223896.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205359405|ref|ZP_02669752.2| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|194409946|gb|ACF70165.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|195633848|gb|EDX52200.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|205328375|gb|EDZ15139.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205336392|gb|EDZ23156.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|323130248|gb|ADX17678.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
          Length = 579

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 126/572 (22%), Positives = 228/572 (39%), Gaps = 52/572 (9%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +  +P Y  L+  L   D   I   L++ 
Sbjct: 33  LEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQM 92

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +R ++   +I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 93  NIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVN 150

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--SA 188
             RALEGE+ARTI+++  + +ARVH+ MP    F +    P+ASV +             
Sbjct: 151 YQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQI 210

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEIEMNINK 247
            A+ HLV++AV  L  G+VT++D +G LLT +    R++    L     ++  I+  I  
Sbjct: 211 SAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEA 270

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PES 304
            L+  +G  N  + V A+L+   ++  E  Y P+    ++   S+    SE      P  
Sbjct: 271 ILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGG 330

Query: 305 AVTVEQNMP---------------------HVSDRKVPLPRSLENTDKKEEQSNYEINTK 343
                 N P                       +        +   + ++ E SNYE++  
Sbjct: 331 VPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNSAGPRSTQRNETSNYEVDRT 390

Query: 344 SIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRG 403
              T  +   +ERLS+AVVVN   L +              + +I  +   A G + +RG
Sbjct: 391 IRHTKMNVGDIERLSVAVVVNYKTLADGK----PLPLTADQMKQIEDLTREAMGFSDKRG 446

Query: 404 DTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL 463
           DT+ + +  F                         ++ A  +L+  ++   L   A+R  
Sbjct: 447 DTLNVVNSPFSAVDNTGGELP----FWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQ 502

Query: 464 HNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYV 523
                 +      ++ +                +       ++D     R    R+ + V
Sbjct: 503 LTRRVEEAKAAQEQAQVR------------QETEEAVEVRLSKDEQLQQRRANQRLGAEV 550

Query: 524 SKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
             Q   R+  M + +    A ++R+W  ++ E
Sbjct: 551 MSQ---RIREMSDNDPRVVALVIRQWMSNDHE 579


>gi|300920157|ref|ZP_07136607.1| flagellar M-ring protein FliF [Escherichia coli MS 115-1]
 gi|300412814|gb|EFJ96124.1| flagellar M-ring protein FliF [Escherichia coli MS 115-1]
          Length = 552

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 235/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLHANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTSRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|16129885|ref|NP_416448.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           str. K-12 substr. MG1655]
 gi|89108770|ref|AP_002550.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           str. K-12 substr. W3110]
 gi|157161409|ref|YP_001458727.1| flagellar MS-ring protein [Escherichia coli HS]
 gi|170081582|ref|YP_001730902.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           str. K-12 substr. DH10B]
 gi|170682432|ref|YP_001743307.1| flagellar MS-ring protein [Escherichia coli SMS-3-5]
 gi|193071157|ref|ZP_03052081.1| flagellar M-ring protein FliF [Escherichia coli E110019]
 gi|218554518|ref|YP_002387431.1| flagellar MS-ring protein [Escherichia coli IAI1]
 gi|238901143|ref|YP_002926939.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           BW2952]
 gi|253773113|ref|YP_003035944.1| flagellar MS-ring protein [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|260855913|ref|YP_003229804.1| flagellar basal-body MS-ring and collar protein FliF [Escherichia
           coli O26:H11 str. 11368]
 gi|300822292|ref|ZP_07102433.1| flagellar M-ring protein FliF [Escherichia coli MS 119-7]
 gi|301018212|ref|ZP_07182727.1| flagellar M-ring protein FliF [Escherichia coli MS 69-1]
 gi|331663434|ref|ZP_08364344.1| flagellar M-ring protein FliF [Escherichia coli TA143]
 gi|331668629|ref|ZP_08369477.1| flagellar M-ring protein FliF [Escherichia coli TA271]
 gi|2506421|sp|P25798|FLIF_ECOLI RecName: Full=Flagellar M-ring protein
 gi|1736604|dbj|BAA15763.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           str. K12 substr. W3110]
 gi|1788248|gb|AAC75005.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           str. K-12 substr. MG1655]
 gi|157067089|gb|ABV06344.1| flagellar M-ring protein FliF [Escherichia coli HS]
 gi|169889417|gb|ACB03124.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           str. K-12 substr. DH10B]
 gi|170520150|gb|ACB18328.1| flagellar M-ring protein FliF [Escherichia coli SMS-3-5]
 gi|192955552|gb|EDV86031.1| flagellar M-ring protein FliF [Escherichia coli E110019]
 gi|218361286|emb|CAQ98870.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           IAI1]
 gi|238861094|gb|ACR63092.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           BW2952]
 gi|253324157|gb|ACT28759.1| flagellar M-ring protein FliF [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|257754562|dbj|BAI26064.1| flagellar basal-body MS-ring and collar protein FliF [Escherichia
           coli O26:H11 str. 11368]
 gi|260448949|gb|ACX39371.1| flagellar M-ring protein FliF [Escherichia coli DH1]
 gi|284921846|emb|CBG34921.1| flagellar M-ring protein [Escherichia coli 042]
 gi|300399799|gb|EFJ83337.1| flagellar M-ring protein FliF [Escherichia coli MS 69-1]
 gi|300525175|gb|EFK46244.1| flagellar M-ring protein FliF [Escherichia coli MS 119-7]
 gi|309702227|emb|CBJ01544.1| flagellar M-ring protein [Escherichia coli ETEC H10407]
 gi|315136575|dbj|BAJ43734.1| flagellar MS-ring protein [Escherichia coli DH1]
 gi|323152731|gb|EFZ39003.1| flagellar M-ring protein FliF [Escherichia coli EPECa14]
 gi|323937208|gb|EGB33488.1| flagellar M-ring protein FliF [Escherichia coli E1520]
 gi|324118987|gb|EGC12876.1| flagellar M-ring protein FliF [Escherichia coli E1167]
 gi|331059233|gb|EGI31210.1| flagellar M-ring protein FliF [Escherichia coli TA143]
 gi|331063823|gb|EGI35734.1| flagellar M-ring protein FliF [Escherichia coli TA271]
          Length = 552

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 235/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|197264219|ref|ZP_03164293.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197242474|gb|EDY25094.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
          Length = 579

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 126/572 (22%), Positives = 228/572 (39%), Gaps = 52/572 (9%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +  +P Y  L+  L   D   I   L++ 
Sbjct: 33  LEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKAPDYRTLFSNLSDQDGGAIVAQLTQM 92

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +R ++   +I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 93  NIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVN 150

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--SA 188
             RALEGE+ARTI+++  + +ARVH+ MP    F +    P+ASV +             
Sbjct: 151 YQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQI 210

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEIEMNINK 247
            A+ HLV++AV  L  G+VT++D +G LLT +    R++    L     ++  I+  I  
Sbjct: 211 SAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEA 270

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PES 304
            L+  +G  N  + V A+L+   ++  E  Y P+    ++   S+    SE      P  
Sbjct: 271 ILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGG 330

Query: 305 AVTVEQNMP---------------------HVSDRKVPLPRSLENTDKKEEQSNYEINTK 343
                 N P                       +        +   + ++ E SNYE++  
Sbjct: 331 VPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNSAGPRSTQRNETSNYEVDRT 390

Query: 344 SIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRG 403
              T  +   +ERLS+AVVVN   L +              + +I  +   A G + +RG
Sbjct: 391 IRHTKMNVGDIERLSVAVVVNYKTLADGK----PLPLTADQMKQIEDLTREAMGFSDKRG 446

Query: 404 DTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL 463
           DT+ + +  F                         ++ A  +L+  ++   L   A+R  
Sbjct: 447 DTLNVVNSPFSAVDDTGGELP----FWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQ 502

Query: 464 HNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYV 523
                 +      ++ +                +       ++D     R    R+ + V
Sbjct: 503 LTRRVEEAKAAQEQAQVR------------QETEEAVEVRLSKDEQLQQRRANQRLGAEV 550

Query: 524 SKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
             Q   R+  M + +    A ++R+W  ++ E
Sbjct: 551 MSQ---RIREMSDNDPRVVALVIRQWMSNDHE 579


>gi|281179000|dbj|BAI55330.1| flagellar hook-basal body MS ring protein FliF [Escherichia coli
           SE15]
          Length = 552

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 236/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEALTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGALP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  +++                 ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAVKTVQQQALARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|157158866|ref|YP_001463240.1| flagellar MS-ring protein [Escherichia coli E24377A]
 gi|157080896|gb|ABV20604.1| flagellar M-ring protein FliF [Escherichia coli E24377A]
          Length = 552

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 130/577 (22%), Positives = 234/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI +I  +  ARVH+ MP    F +    P+ASV I   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIATIGPVKGARVHLAMPKPSLFVREQKSPSASVTINLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|194445262|ref|YP_002041234.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194736346|ref|YP_002115003.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197301177|ref|ZP_02664267.2| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|204931028|ref|ZP_03221854.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|194403925|gb|ACF64147.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194711848|gb|ACF91069.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197288091|gb|EDY27478.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|204320072|gb|EDZ05277.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
          Length = 579

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 126/572 (22%), Positives = 227/572 (39%), Gaps = 52/572 (9%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +  +P Y  L+  L   D   I   L++ 
Sbjct: 33  LEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQM 92

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +R ++   +I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 93  NIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVN 150

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--SA 188
             RALEGE+ARTI+++  + +ARVH+ MP    F +    P+ASV +             
Sbjct: 151 YQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQI 210

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEIEMNINK 247
            A+ HLV++AV  L  G+VT++D +G LLT +    R++    L     ++  I+  I  
Sbjct: 211 SAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEA 270

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PES 304
            L+  +G  N  + V A+L+   ++  E  Y P+    ++   S+    SE      P  
Sbjct: 271 ILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGG 330

Query: 305 AVTVEQNMP---------------------HVSDRKVPLPRSLENTDKKEEQSNYEINTK 343
                 N P                       +        +     ++ E SNYE++  
Sbjct: 331 VPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNSAGPRNTQRNETSNYEVDRT 390

Query: 344 SIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRG 403
              T  +   +ERLS+AVVVN   L +              + +I  +   A G + +RG
Sbjct: 391 IRHTKMNVGDIERLSVAVVVNYKTLADGK----PLPLTADQMKQIEDLTREAMGFSDKRG 446

Query: 404 DTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL 463
           DT+ + +  F                         ++ A  +L+  ++   L   A+R  
Sbjct: 447 DTLNVVNSPFSAVDNTGGELP----FWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQ 502

Query: 464 HNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYV 523
                 +      ++ +                +       ++D     R    R+ + V
Sbjct: 503 LTRRVEEAKAAQEQAQVR------------QETEEAVEVRLSKDEQLQQRRANQRLGAEV 550

Query: 524 SKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
             Q   R+  M + +    A ++R+W  ++ E
Sbjct: 551 MSQ---RIREMSDNDPRVVALVIRQWMSNDHE 579


>gi|90021833|ref|YP_527660.1| flagellar MS-ring protein [Saccharophagus degradans 2-40]
 gi|89951433|gb|ABD81448.1| flagellar M-ring protein FliF [Saccharophagus degradans 2-40]
          Length = 556

 Score =  369 bits (947), Expect = e-100,   Method: Composition-based stats.
 Identities = 115/559 (20%), Positives = 224/559 (40%), Gaps = 26/559 (4%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
                   +L   R   L   +   + +  A   +     Y  LY  L+  D + +   L
Sbjct: 11  NDLIDGFNNLNIIRQAGLMVGLAASVAIGFAVVLWSQGEDYKPLYGSLDRLDSSEVGAIL 70

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
               I ++I  +  ++ V    V +AR+ LA  G+    +++GYEL D+    G + FM+
Sbjct: 71  DFNEIPYKIDGSTGALLVAVDEVHRARLVLAENGI-QGDNSTGYELLDQEQPLGTSQFME 129

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS--VY 185
                R +EGE+ARTI SI+ +  ARVH+ +P    F   G +P+ASV +          
Sbjct: 130 ATRYKRGIEGELARTIASINSVRGARVHLAIPKRSVFVGDGRKPSASVFLDLYPGRPIKP 189

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT---ANEMERNILGKSLSIVQAIQHEIE 242
           K  + I +LVA+++P L + +VTV+D  G LLT   A + +  I G+ L   Q ++  + 
Sbjct: 190 KQIQGIANLVASSIPELQVENVTVVDQKGNLLTTGIAEDKDLLIAGQHLEYTQKVEDGMI 249

Query: 243 MNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQP 302
           M + + L+  LG  NF++ V A+++    +  E V++PD    RS +  ++ +    + P
Sbjct: 250 MRVRRLLSPILGDQNFKTEVAADIDFTEIEQAEEVFNPDLPAVRSEQTVEEQRIGSGA-P 308

Query: 303 ESAVTVEQNMPHVSDRKV-------PLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLE 355
                   N P    +                +  + +   NYE++     T  +  +L 
Sbjct: 309 GGIPGALTNQPPADGQAPEQAGQGGEGAGGQPSNTRSQAVRNYELDRTVSYTKREKGRLR 368

Query: 356 RLSIA-VVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFL 414
           RL++A V+ +K  +    G           L     +V  A G ++ RGD++ I +  FL
Sbjct: 369 RLTVAVVIDDKKTINPETGAVERTQWTQQELERFAILVRDAVGYSAVRGDSVNILNEAFL 428

Query: 415 ENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEV 474
                        + +        +I  +   +  + +    +  + +   +   K  E 
Sbjct: 429 PEPAIEVLDDLPFWQNES---ILKLIKPIAGALIIVALLVGLVRPVLKSLAVAGVKTREQ 485

Query: 475 GGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHM 534
                ++    +       + ++ + L   +                   +Q    +  +
Sbjct: 486 DEAKEMAALQAAGMDGFDSLSDETVTLTGGDALALPSPE--------EGYEQQLNAVKGL 537

Query: 535 IEINEERFAKILRKWARSE 553
           +  +  R A+++++W   E
Sbjct: 538 VAEDAGRVAQVIKRWINEE 556


>gi|193066388|ref|ZP_03047436.1| flagellar M-ring protein FliF [Escherichia coli E22]
 gi|194429948|ref|ZP_03062458.1| flagellar M-ring protein FliF [Escherichia coli B171]
 gi|301327725|ref|ZP_07220930.1| flagellar M-ring protein FliF [Escherichia coli MS 78-1]
 gi|192925973|gb|EDV80619.1| flagellar M-ring protein FliF [Escherichia coli E22]
 gi|194412037|gb|EDX28349.1| flagellar M-ring protein FliF [Escherichia coli B171]
 gi|300845725|gb|EFK73485.1| flagellar M-ring protein FliF [Escherichia coli MS 78-1]
 gi|320198628|gb|EFW73228.1| Flagellar M-ring protein FliF [Escherichia coli EC4100B]
 gi|323158583|gb|EFZ44597.1| flagellar M-ring protein FliF [Escherichia coli E128010]
 gi|323183922|gb|EFZ69309.1| flagellar M-ring protein FliF [Escherichia coli 1357]
          Length = 552

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 234/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI +I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIATIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|322655518|gb|EFY51826.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322683020|gb|EFY79036.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|323204454|gb|EFZ89460.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
          Length = 531

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 124/556 (22%), Positives = 223/556 (40%), Gaps = 52/556 (9%)

Query: 27  SVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVP 86
                 + + +A   +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP
Sbjct: 1   MAGSATVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVP 60

Query: 87  SSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSI 146
           +  V + R+ LA QGLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++
Sbjct: 61  ADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVNYQRALEGELARTIETL 118

Query: 147 SGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--SAEAIRHLVAAAVPNLDM 204
             + +ARVH+ MP    F +    P+ASV +              A+ HLV++AV  L  
Sbjct: 119 GPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQISAVVHLVSSAVAGLPP 178

Query: 205 GDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVV 263
           G+VT++D +G LLT +    R++    L     ++  I+  I   L+  +G  N  + V 
Sbjct: 179 GNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVT 238

Query: 264 AELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMP------- 313
           A+L+   ++  E  Y P+    ++   S+    SE      P        N P       
Sbjct: 239 AQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAP 298

Query: 314 --------------HVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
                           +        +     ++ E SNYE++     T  +   +ERLS+
Sbjct: 299 IATPPTNQQNAQNTPQTSTSTNSNSAGPRNTQRNETSNYEVDRTIRHTKMNVGDIERLSV 358

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AVVVN   L +              + +I  +   A G + +RGDT+ + +  F      
Sbjct: 359 AVVVNYKTLADGK----PLPLTADQMKQIEDLTREAMGFSDKRGDTLNVVNSPFSAVDNT 414

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
                              ++ A  +L+  ++   L   A+R        +      ++ 
Sbjct: 415 GGELP----FWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQLTRRVEETKAAQEQAQ 470

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
           +                +       ++D     R    R+ + V  Q   R+  M + + 
Sbjct: 471 VR------------QETEEAVEVRLSKDEQLQQRRANQRLGAEVMSQ---RIREMSDNDP 515

Query: 540 ERFAKILRKWARSEIE 555
              A ++R+W  ++ E
Sbjct: 516 RVVALVIRQWMSNDHE 531


>gi|332343664|gb|AEE56998.1| flagellar M-ring protein FliF [Escherichia coli UMNK88]
          Length = 552

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 235/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVTGSAAVAVMVALILWAKTPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|205360218|ref|ZP_02681717.2| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|205350665|gb|EDZ37296.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
          Length = 579

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 126/572 (22%), Positives = 229/572 (40%), Gaps = 52/572 (9%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +  +P Y  L+  L   D   I   L++ 
Sbjct: 33  LEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQM 92

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +R ++   +I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 93  NIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVN 150

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--SA 188
             RALEGE+ARTI+++  + +ARVH+ MP    F +    P+ASV +             
Sbjct: 151 YQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQI 210

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEIEMNINK 247
            A+ HLV++AV +L  G+VT++D +G LLT +    R++    L     ++  I+  I  
Sbjct: 211 SAVVHLVSSAVASLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEA 270

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PES 304
            L+  +G  N  + V A+L+   ++  E  Y P+    ++   S+    SE      P  
Sbjct: 271 ILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGG 330

Query: 305 AVTVEQNMP---------------------HVSDRKVPLPRSLENTDKKEEQSNYEINTK 343
                 N P                       +        +   + ++ E SNYE++  
Sbjct: 331 VPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNSAGPRSTQRNETSNYEVDRT 390

Query: 344 SIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRG 403
              T  +   +ERLS+AVVVN   L +              + +I  +   A G + +RG
Sbjct: 391 IRHTKMNVGDIERLSVAVVVNYKTLADGK----PLPLTADQMKQIEDLTREAMGFSDKRG 446

Query: 404 DTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL 463
           DT+ + +  F                         ++ A  +L+  ++   L   A+R  
Sbjct: 447 DTLNVVNSPFSAVDNTGGELP----FWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQ 502

Query: 464 HNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYV 523
                 +      ++ +                +       ++D     R    R+ + V
Sbjct: 503 LTRRVEEAKAAQEQAQVR------------QETEEAVEVRLSKDEQLQQRRANQRLGAEV 550

Query: 524 SKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
             Q   R+  M + +    A ++R+W  ++ E
Sbjct: 551 MSQ---RIREMSDNDPRVVALVIRQWMSNDHE 579


>gi|218705431|ref|YP_002412950.1| flagellar MS-ring protein [Escherichia coli UMN026]
 gi|293405421|ref|ZP_06649413.1| fliF [Escherichia coli FVEC1412]
 gi|298381064|ref|ZP_06990663.1| flagellar M-ring protein [Escherichia coli FVEC1302]
 gi|218432528|emb|CAR13421.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           UMN026]
 gi|291427629|gb|EFF00656.1| fliF [Escherichia coli FVEC1412]
 gi|298278506|gb|EFI20020.1| flagellar M-ring protein [Escherichia coli FVEC1302]
          Length = 552

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 235/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLMAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|312973845|ref|ZP_07788017.1| flagellar M-ring protein FliF [Escherichia coli 1827-70]
 gi|310332440|gb|EFP99675.1| flagellar M-ring protein FliF [Escherichia coli 1827-70]
          Length = 552

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 235/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT      R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQFNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+    ++   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGKGNIHAQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|327193018|gb|EGE59930.1| flagellar M-ring protein [Rhizobium etli CNPAF512]
          Length = 563

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 289/564 (51%), Positives = 392/564 (69%), Gaps = 10/564 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M +L+QL+Q FK+  +LGRTR++IL  V  + I + +AA  FVN P  + LYV L+  D+
Sbjct: 1   MNLLNQLVQIFKNFGALGRTRLMILGGVGALSIAIILAAALFVNKPAQETLYVGLDAPDL 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           N+IS+AL+EANI+F++  +G+SISVP+ M GKAR+ LA +GLP +S+N+GYELFD V S 
Sbjct: 61  NQISMALAEANINFQVGTDGASISVPAGMTGKARLMLAERGLP-NSANAGYELFDNVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQSISGI AARVHIVMP++G+FRK   +PTASVMIRA 
Sbjct: 120 GLTSFMQEVTRVRALEGEIARTIQSISGITAARVHIVMPEVGNFRKAEQKPTASVMIRAS 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL-GKSLSIVQAIQH 239
             +   +A +IRHLVA+AVP LD+ DVT+LDS G+LL + +   N    +SL+IVQ +Q 
Sbjct: 180 AATGRSAATSIRHLVASAVPGLDVDDVTILDSAGQLLASGDEASNSSLNRSLNIVQNVQQ 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           E+E NI+KALA FLG+DNFRS+V A+LN D QQI+E  YDP+SKVERS+R +K+AQ+S+ 
Sbjct: 240 EVESNIDKALAPFLGMDNFRSSVTADLNTDAQQIQETTYDPESKVERSVRSTKEAQQSQQ 299

Query: 300 SQPESAVTVEQNMPHVSDRKVP--LPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
            Q ++A TVEQN+P  +        P S + +DK+EEQ+NYEIN+K+ ATT ++YK+E+L
Sbjct: 300 KQSDNATTVEQNIPQAAPDAGGASGPESQDKSDKREEQTNYEINSKTTATTRNSYKVEKL 359

Query: 358 SIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           SIAVVVNKGR+ +++G  ADQ K+D+YLAE+ KIV++A GI+++RGD +T+T+MDFLENQ
Sbjct: 360 SIAVVVNKGRIAKMVGEPADQAKVDAYLAEMQKIVASAAGIDAKRGDVVTVTAMDFLENQ 419

Query: 418 LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA------KK 471
           L    T  V  MD+LSR+ A +IN+L F+    +V ++GL  L R    + A        
Sbjct: 420 LLEDATGGVRVMDMLSRNLAGIINSLAFVAVAFVVVWMGLRPLVRSVTGNGASAVLGDAT 479

Query: 472 GEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRL 531
            E  G  +    P   A    LM          + +      +     N  V +  + +L
Sbjct: 480 PEAAGLELPDFAPAVGAPGGALMDGFGSDFGFDSTEDLLSLGDDDGNFNRRVKEGPERKL 539

Query: 532 LHMIEINEERFAKILRKWARSEIE 555
             M+EINEER AKILRKWA  +  
Sbjct: 540 ARMVEINEERAAKILRKWAIDDAA 563


>gi|307312476|ref|ZP_07592110.1| flagellar M-ring protein FliF [Escherichia coli W]
 gi|306907647|gb|EFN38150.1| flagellar M-ring protein FliF [Escherichia coli W]
 gi|315061238|gb|ADT75565.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           W]
 gi|323378185|gb|ADX50453.1| flagellar M-ring protein FliF [Escherichia coli KO11]
          Length = 552

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 236/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R+S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRVSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|124265758|ref|YP_001019762.1| flagellar biosynthesis lipoprotein [Methylibium petroleiphilum PM1]
 gi|124258533|gb|ABM93527.1| flagellar biosynthesis lipoprotein [Methylibium petroleiphilum PM1]
          Length = 567

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 123/571 (21%), Positives = 222/571 (38%), Gaps = 49/571 (8%)

Query: 10  FFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSE 69
           F     +L   R   L   +   + +  A   + +  +Y  LY  L   D   I   LS 
Sbjct: 21  FGSRLAALPAGRKFTLGIGLAALVGIAFAMSMWSSQGNYKVLYAGLSDKDGGAILAQLST 80

Query: 70  ANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEI 129
            N+ ++ +D G++I VP+  V   R+ LA+ GLP   S  G+EL D    FG T F + +
Sbjct: 81  MNVPYKHADGGAAILVPADKVHDVRLKLASAGLPK-GSIVGFELMDNA-KFGQTQFQERL 138

Query: 130 TRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--S 187
           T  R LEGE+ R+I +++ + +ARVH+ +P+   F +   +P+ASV++            
Sbjct: 139 TFQRGLEGELTRSIGALAAVQSARVHLALPNQNGFFREQQKPSASVLLTLHPGRTLDRTQ 198

Query: 188 AEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN---ILGKSLSIVQAIQHEIEMN 244
              I HLV+++VP +D   VTVLD+TG L++      +   +  + L  V  I+      
Sbjct: 199 IAGIVHLVSSSVPEMDPKAVTVLDATGALISGAGDAGSAGGLDAQQLQYVGQIEGNYTKR 258

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSK---------VERSIRLSKDAQ 295
           +   L   LG DN R+ V AE++    +     Y P+                    +A 
Sbjct: 259 VFDILEPVLGRDNLRAQVTAEVDFSQTESTSEAYAPNQGLGADGKPAAATLRSHQVSEAS 318

Query: 296 RSETSQPESAVTVEQNMPHVSDRKVPLPRSLE-----------NTDKKEEQSNYEINTKS 344
              ++QP        N P V         +                ++E  +NYE++   
Sbjct: 319 GGGSAQPAGVPGAASNQPPVPATAPVNGSAQPLQTAQSGGGSGGNSRREATTNYEVDKTV 378

Query: 345 IATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGD 404
             T +    ++RL+ AVV+N   +T+  G+++        + ++  +V    G N+ RGD
Sbjct: 379 RVTRNATGTIKRLNAAVVLNHRSVTDAKGKTSTTPISAEEMEKLTALVKETIGFNADRGD 438

Query: 405 TITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLH 464
           ++ + +  F   +      + +           T+       +  +++ F  +    +  
Sbjct: 439 SVKLINAPFKVEKPPVEEALPLWKQPETQDLLRTLAVPGALTLLAMIIVFGAVRPALK-- 496

Query: 465 NIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVS 524
                           +  P         + +D  AL S      S        + + V 
Sbjct: 497 ----------------AAQPAQPQRQLDAVVDDVPALPSP----SSAQAAALPALEAPVV 536

Query: 525 KQSDLRLLHMIEINEERFAKILRKWARSEIE 555
                +   + + N    A I+R W+  E  
Sbjct: 537 DTRLNQARALAKENPAAMANIVRGWSAKEAA 567


>gi|190890348|ref|YP_001976890.1| flagellar M-ring protein [Rhizobium etli CIAT 652]
 gi|190695627|gb|ACE89712.1| flagellar M-ring protein [Rhizobium etli CIAT 652]
          Length = 563

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 289/564 (51%), Positives = 393/564 (69%), Gaps = 10/564 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M +L+QL+Q FK+  +LGRTR++IL  V  + I + +AA  FVN P  + LYV L+  D+
Sbjct: 1   MNLLNQLVQIFKNFGALGRTRLMILGGVGALSIAIILAAALFVNKPAQETLYVGLDAPDL 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           N+IS+AL+EANI+F++  +G+SISVP+ M GKAR+ LA +GLP +S+N+GYELFD V S 
Sbjct: 61  NQISMALAEANINFQVGTDGASISVPAGMTGKARLMLAERGLP-NSANAGYELFDNVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQSISGI AARVHIVMP++G+FRK   +PTASVMIRA 
Sbjct: 120 GLTSFMQEVTRVRALEGEIARTIQSISGITAARVHIVMPEVGNFRKAEQKPTASVMIRAS 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL-GKSLSIVQAIQH 239
             +   +A +IRHLVA+AVP LD+ DVT+LDS G+LL + +   N    +SL+IVQ +Q 
Sbjct: 180 AATGRSAATSIRHLVASAVPGLDVDDVTILDSAGQLLASGDEASNSSLNRSLNIVQNVQQ 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           E+E NI+KALA FLG+DNFRS+V A+LN D QQI+E  YDP+SKVERS+R +K+AQ+S+ 
Sbjct: 240 EVESNIDKALAPFLGMDNFRSSVTADLNTDAQQIQETTYDPESKVERSVRSTKEAQQSQQ 299

Query: 300 SQPESAVTVEQNMPHVSDRKVP--LPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
            Q ++A TVEQN+P  +        P S + +DK+EEQ+NYEIN+++ ATT ++YK+E+L
Sbjct: 300 KQSDNATTVEQNIPQAAPDAGGASGPESQDKSDKREEQTNYEINSRTTATTRNSYKVEKL 359

Query: 358 SIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           SIAVVVNKGR+ +++G  ADQ KID+YLAE+ KIV++A GI+++RGD +T+T+MDFLENQ
Sbjct: 360 SIAVVVNKGRIAKMVGEPADQAKIDAYLAEMQKIVASAAGIDAKRGDVVTVTAMDFLENQ 419

Query: 418 LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA------KK 471
           L    T  V  MD+LSR+ A +IN+L F+    +V ++GL  L R  + + A        
Sbjct: 420 LLEDATGGVRVMDMLSRNLAGIINSLAFVAVAFVVVWMGLRPLVRSVSGNGASAVLGDAT 479

Query: 472 GEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRL 531
            E  G  +    P   A    LM          + +      +     N  V +  + +L
Sbjct: 480 PEAAGLELPDFAPAVGAPGGALMDGFGSDFGFDSTEDLLSLGDDDGNFNRRVKEGPERKL 539

Query: 532 LHMIEINEERFAKILRKWARSEIE 555
             M+EINEER AKILRKWA  +  
Sbjct: 540 ARMVEINEERAAKILRKWAIDDAA 563


>gi|13472585|ref|NP_104152.1| flagellar MS-ring protein [Mesorhizobium loti MAFF303099]
 gi|14023331|dbj|BAB49938.1| flagellar basal-body MS-ring protein; FliF [Mesorhizobium loti
           MAFF303099]
          Length = 549

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 221/552 (40%), Positives = 328/552 (59%), Gaps = 7/552 (1%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           +Q+     +    G  R+ +LA + ++ + +   A  ++N P YD LYV L+ +DVN+I 
Sbjct: 3   EQIQSIISNLRGFGVKRLAMLAGIAVLVMGVIGIASVYLNRPAYDTLYVGLDRADVNQIG 62

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
           + L EA I F +  +G+S+ VP+    +AR+ LA +GLP+S +N+GYELFD V + GLTS
Sbjct: 63  LVLGEAGIGFDVGSDGTSVLVPAGTTAQARMLLAEKGLPTS-ANAGYELFDNVGAMGLTS 121

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV 184
           FMQ+ITRVRALEGEIARTIQSISGI AARVHIVM +  +FR+   +P+ASV+IR      
Sbjct: 122 FMQQITRVRALEGEIARTIQSISGIKAARVHIVMSERANFRRDEQQPSASVVIRYAGIDA 181

Query: 185 YKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQHEIEM 243
            KSA++IRHLVAAAVP L    VTVLDS G LL A +   N    ++L + Q ++ +I  
Sbjct: 182 EKSAQSIRHLVAAAVPGLSADKVTVLDSNGNLLAAGDDPSNTSAARTLGVEQTVEAQIGD 241

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
           NI +AL  +LG DNFR++V AE+N DT+Q  E ++DP+S+VERS++  +  + S   Q  
Sbjct: 242 NIRRALTPYLGPDNFRASVKAEVNTDTRQTEETIFDPNSRVERSVQSVRANENSNQKQAS 301

Query: 304 SAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVV 363
           +  +VEQN+P         P++    D+KEE +NYEIN+K IAT  + Y + ++SIAVVV
Sbjct: 302 TPASVEQNLPETQATSTEGPQTTSANDRKEEITNYEINSKKIATVSNGYTVTKMSIAVVV 361

Query: 364 NKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGT 423
           N+ RL  +LG+ A   +I   +AEI K+V++ATG++ +RGD I +++++F++  L     
Sbjct: 362 NQDRLKTILGKDATPEQIAKRVAEIQKMVTSATGLDDKRGDVIDVSAVEFID-GLDGEAI 420

Query: 424 VQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPP 483
            Q   +D + +H  T+INA  F+V   LV F GL  +                   +   
Sbjct: 421 PQAGMLDSIGQHAGTLINAGAFIVVVFLVAFFGLRPMAAALTARATPALSGPNFDEVQRS 480

Query: 484 PISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFA 543
             +            I     ++   +   +L+ +I          RL  M+++NEER A
Sbjct: 481 LPTPEAAASADAGAAIGALPGSRPGTNPLDDLRQKIRPA----PQERLARMVDLNEERTA 536

Query: 544 KILRKWARSEIE 555
           +ILRKWA  E+ 
Sbjct: 537 QILRKWAAQEVA 548


>gi|324114219|gb|EGC08192.1| flagellar M-ring protein FliF [Escherichia fergusonii B253]
          Length = 552

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 128/577 (22%), Positives = 238/577 (41%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPRIPLIVAGSAAVAVIVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D +G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+    ++   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNVHAQVTAQLDFASKEQTEEQYRPNGDQSQATLRSRQVNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANSAPISTPPANQNNRQQQTSTSSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN     +              + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKATPDGK----PLPLSAEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      +++A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNTSDESGGELP----FWQQQVFIDQLLSAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++      +  AV   L  ++ +    +NQ + +   +    
Sbjct: 471 AVRPQLTRRVEAVKAVQQQAQAR-QEVEDAVEVRLSKDEQLQQRRANQRMSAEMMS---- 525

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
                      R+  M + +    A ++R+W  ++ E
Sbjct: 526 ----------QRIREMSDNDPRVVALVIRQWINNDHE 552


>gi|110642044|ref|YP_669774.1| flagellar MS-ring protein [Escherichia coli 536]
 gi|191173305|ref|ZP_03034835.1| flagellar M-ring protein FliF [Escherichia coli F11]
 gi|110343636|gb|ABG69873.1| flagellar M-ring protein [Escherichia coli 536]
 gi|190906422|gb|EDV66031.1| flagellar M-ring protein FliF [Escherichia coli F11]
          Length = 552

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 235/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVSAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPTNQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEALTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGALP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAVKTVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|118593642|ref|ZP_01551018.1| flagellar M-ring protein [Stappia aggregata IAM 12614]
 gi|118433753|gb|EAV40414.1| flagellar M-ring protein [Stappia aggregata IAM 12614]
          Length = 537

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 137/552 (24%), Positives = 244/552 (44%), Gaps = 18/552 (3%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           +    +   +LG  RI  + +V  + + +F    F V +P    LY +L + D   I   
Sbjct: 1   MNGLVEFIKTLGAARIAAMGAVAAILVGVFAFIIFRVTAPQMTTLYNELTLEDSAAIVSQ 60

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L    + F I+  G+SI VP+  V + R+ LAA+GLP+  S  GYE+FD+ ++ G TSF+
Sbjct: 61  LESQGVQFEIARQGASILVPNEQVARLRMQLAAEGLPTGGS-IGYEIFDRSDTLGATSFV 119

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           Q I  +RA+EGE++RTI S+  I AARVH+V+P+   F+K    P+AS+++         
Sbjct: 120 QNINHLRAMEGELSRTIGSLDRIRAARVHLVIPERQLFQKDRRPPSASIVLNVRGALGPG 179

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA---NEMERNILGKSLSIVQAIQHEIEM 243
              A++HLVA AV  L+   V+++D +G+LL +   N+ +  +          ++  +  
Sbjct: 180 EIRAVQHLVATAVDGLEPDRVSIVDESGRLLASGVGNDEDGLLTNSLQERTVEVEGRLRN 239

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            I + L + +G    R  V AE++ +        +DPD +V RS +  ++A  + +    
Sbjct: 240 QIEEILNSVVGPGRARVRVNAEVDYNRLTETTETFDPDGQVVRSTQSKEEASSAVSRN-- 297

Query: 304 SAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVV 363
             VTV   +P+            + +   EE  NYEI+  +     +  K++RLS+AV+V
Sbjct: 298 GQVTVANQLPNADA--GQGGAERDTSSVTEEIVNYEISHSTRTEVVEAGKIKRLSVAVLV 355

Query: 364 NKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGT 423
           +     +  G S    +    L  I  +V +A G +S RGD + + ++ F      +   
Sbjct: 356 DGTYQPDGNGGSTYTPRSQETLDRIAVLVRSAVGFDSERGDVVEVVNLQFALPPQDDLLA 415

Query: 424 VQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPP 483
              S  D             V  +  +++    +  L R     + K+ +          
Sbjct: 416 ESDSLFDFTRNDIIRFAELGVLFLIAVMLLLFVVRPLLRRIVTPEEKQPQELMIGPDGTL 475

Query: 484 PISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFA 543
            I + V       D   ++   Q          ++    +   S  ++  MI+ +     
Sbjct: 476 VIETEVPQEEAVEDEFVIEWLEQ----------AKQEGAMQASSIAKVGDMIKDHPTEAV 525

Query: 544 KILRKWARSEIE 555
            I+R W   +  
Sbjct: 526 TIVRGWLDEQAA 537


>gi|317048599|ref|YP_004116247.1| flagellar M-ring protein FliF [Pantoea sp. At-9b]
 gi|316950216|gb|ADU69691.1| flagellar M-ring protein FliF [Pantoea sp. At-9b]
          Length = 571

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 126/546 (23%), Positives = 228/546 (41%), Gaps = 55/546 (10%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I   L++ NI ++ ++NG ++ VP+  V + R+ LA QG
Sbjct: 48  WAKAPDYRVLYSNLSDEDGGAIVTQLTQMNIPYQFAENGGALMVPADKVHELRLRLAQQG 107

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL DK   FG++ F +++   RALEGE+ARTI+++  + +AR+H+ MP  
Sbjct: 108 LPKGGS-VGFELMDKE-KFGISQFSEQVNYQRALEGELARTIETLGPVKSARIHLAMPKP 165

Query: 162 GSFRKIGARPTASVM--IRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV   ++          +A+ H+V+++VP L  G+VTV+D  G+LLT 
Sbjct: 166 TLFVREQKAPSASVTLNLQPGRALDEGQIQAVVHMVSSSVPGLPPGNVTVVDQAGRLLTR 225

Query: 220 NEMERN-ILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
           ++ E   +    L     ++   +  I   L   +G  N  + V A+LN D  +  +  Y
Sbjct: 226 SDSEGRDLNDAQLKYTAEVEGRYQQRIEAILNPIVGQGNVHAQVTAQLNFDRSEQTDEKY 285

Query: 279 DPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVSDRKV--------------- 320
            P+   + S   S+    SE +    P        N P  ++                  
Sbjct: 286 QPNGSPDNSAIRSRQTSTSEQNGSPYPGGVPGALSNQPAPANTAPVTNPPANNANGQNAN 345

Query: 321 ------------PLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRL 368
                           S  +  ++++  NYE++     T  +   ++RLS+AVVVN    
Sbjct: 346 GQNNAANGTNTSTTQNSGPSNSRRDDTVNYELDRTIRHTKLNVGDVQRLSVAVVVNYR-- 403

Query: 369 TEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSF 428
                +  +    D  + +I  +   A G +  RGD+I + +  F   +           
Sbjct: 404 --ADDKGKEVALNDQQIKQIEDLTREAMGYSQTRGDSINVVNSPFNMTEPAGGDLP---- 457

Query: 429 MDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSA 488
                  F  +++A  +L+  L+   L    +R        ++      +          
Sbjct: 458 FWQQQSFFDQLMSAGRWLLVALVAFILYRKLVRPQIMRKREQEQAAAEAAAARATAQEEE 517

Query: 489 VTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRK 548
               +           ++D     R   +R+++ V  Q   R+  M E +    A ++R+
Sbjct: 518 QAYSVQ---------LSKDELDQERKSTNRMSAEVMSQ---RIRDMSENDPRVVALVIRE 565

Query: 549 WARSEI 554
           W  +E+
Sbjct: 566 WMSNEL 571


>gi|289208337|ref|YP_003460403.1| flagellar M-ring protein FliF [Thioalkalivibrio sp. K90mix]
 gi|288943968|gb|ADC71667.1| flagellar M-ring protein FliF [Thioalkalivibrio sp. K90mix]
          Length = 552

 Score =  369 bits (946), Expect = e-100,   Method: Composition-based stats.
 Identities = 113/552 (20%), Positives = 213/552 (38%), Gaps = 26/552 (4%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    +   R L L  ++   I++ +A  ++   P Y  L+ ++E  +   +  ALS+A
Sbjct: 16  IREFNGMPAGRQLALLGMLAGAIVVIVAVLYWAFRPTYVPLFPRMESEEAAEVVQALSQA 75

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
            I +++      + VP   V +AR+ LA++GLP S  + G+EL  +    G +  ++   
Sbjct: 76  GISYQVDATTGQVKVPQGDVAEARLQLASEGLPRSG-DVGFELLQEDTGLGTSRMVEGAR 134

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVY--KSA 188
             RA+EGE+ART+ S+  +  ARVHI   +   F +     +ASV++             
Sbjct: 135 FHRAMEGELARTVASLDAVERARVHIAQAEQSVFVRDRRPASASVVVHLRGSRSLSDSQV 194

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTAN--EMERNILGKSLSIVQAIQHEIEMNIN 246
            AI HLVA++   L+   VTV+D  G+LLT +  +         LS  + ++      I+
Sbjct: 195 AAIVHLVASSTSELEAERVTVVDQRGRLLTQDGADRGGMASSDRLSFSREVEQRYAERIH 254

Query: 247 KALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAV 306
             LA  +G D  R  V A+++    +  E +YDP++   RS +  +D +      P    
Sbjct: 255 DLLAPIVGSDKVRVQVNADIDFSQVERTEELYDPETIALRSEQTREDERTGMDGGPAGVP 314

Query: 307 TVEQNMPH-----VSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAV 361
               N P              P  L  +       NYE++ +          + R+S AV
Sbjct: 315 GALTNQPPEGGAVEDPEGEMAPAPLPTSRSANVTRNYEVDRRINHIREAPGGIRRVSTAV 374

Query: 362 VVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNS 421
           VV+        G +    +    L  I  +V  A G +  RGDT+ + +  F        
Sbjct: 375 VVDFREQVGEDGATESVARDAEELERIEALVREAVGFSEARGDTLNVVTAPFEAPAEEMI 434

Query: 422 GTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILS 481
                 +       F  ++     L+  L++    +    +       +      +  L+
Sbjct: 435 EDEVPFWSQS---WFLEMVKIGAGLLLALILLLTVVRPALKQLMASPPRDRRADQQRALT 491

Query: 482 PPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEER 541
                 +          +A  +  +       +                +  M+  + +R
Sbjct: 492 DESDDDSAGAPAGSQSAVAALTGPKGPDQQEMD-------------LEAVREMVREDPKR 538

Query: 542 FAKILRKWARSE 553
            A++++ W   +
Sbjct: 539 VAQVMKTWLGDD 550


>gi|82543597|ref|YP_407544.1| flagellar MS-ring protein [Shigella boydii Sb227]
 gi|81245008|gb|ABB65716.1| FliF [Shigella boydii Sb227]
 gi|320186947|gb|EFW61661.1| Flagellar M-ring protein FliF [Shigella flexneri CDC 796-83]
 gi|332096898|gb|EGJ01887.1| flagellar M-ring protein FliF [Shigella boydii 3594-74]
          Length = 552

 Score =  368 bits (945), Expect = e-100,   Method: Composition-based stats.
 Identities = 130/577 (22%), Positives = 236/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT-ANEMERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +N   R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTLSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTSRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|331653350|ref|ZP_08354355.1| flagellar M-ring protein FliF [Escherichia coli M718]
 gi|331049448|gb|EGI21520.1| flagellar M-ring protein FliF [Escherichia coli M718]
          Length = 552

 Score =  368 bits (945), Expect = e-99,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 235/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT      R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQFNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+    ++   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGKGNIHAQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFVDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|74312478|ref|YP_310897.1| flagellar MS-ring protein [Shigella sonnei Ss046]
 gi|73855955|gb|AAZ88662.1| flagellar basal-body MS(membrane and supramembrane)-ring and collar
           protein [Shigella sonnei Ss046]
 gi|323168943|gb|EFZ54623.1| flagellar M-ring protein FliF [Shigella sonnei 53G]
          Length = 552

 Score =  368 bits (945), Expect = e-99,   Method: Composition-based stats.
 Identities = 128/577 (22%), Positives = 234/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +  S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYCFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|320175473|gb|EFW50572.1| Flagellar M-ring protein FliF [Shigella dysenteriae CDC 74-1112]
          Length = 552

 Score =  368 bits (945), Expect = e-99,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 237/577 (41%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++      +  AV   L  ++ +    +NQ + +   +    
Sbjct: 471 AVRPQLTSRAEAMKAVQQQAQAR-EEVEDAVEVRLSKDEQLQQRRANQRLGAEIMS---- 525

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
                      R+  M + +    A ++R+W  ++ E
Sbjct: 526 ----------QRIREMSDNDPRVVALVIRQWINNDHE 552


>gi|256017869|ref|ZP_05431734.1| flagellar MS-ring protein [Shigella sp. D9]
 gi|332278895|ref|ZP_08391308.1| flagellar basal-body MS-ring and collar protein [Shigella sp. D9]
 gi|332101247|gb|EGJ04593.1| flagellar basal-body MS-ring and collar protein [Shigella sp. D9]
          Length = 552

 Score =  368 bits (945), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 236/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R+S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRVSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSSTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|300904828|ref|ZP_07122654.1| flagellar M-ring protein FliF [Escherichia coli MS 84-1]
 gi|301305281|ref|ZP_07211378.1| flagellar M-ring protein FliF [Escherichia coli MS 124-1]
 gi|300403255|gb|EFJ86793.1| flagellar M-ring protein FliF [Escherichia coli MS 84-1]
 gi|300839487|gb|EFK67247.1| flagellar M-ring protein FliF [Escherichia coli MS 124-1]
 gi|315257230|gb|EFU37198.1| flagellar M-ring protein FliF [Escherichia coli MS 85-1]
          Length = 552

 Score =  368 bits (945), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 236/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNPAAAQTKSLEWLNRLRANPKIPLIVTGSAAVAVMVALILWAKTPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEALTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGALP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  +++                 ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAVKTVQQQALARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|26248206|ref|NP_754246.1| flagellar MS-ring protein [Escherichia coli CFT073]
 gi|227885633|ref|ZP_04003438.1| flagellar MS-ring protein [Escherichia coli 83972]
 gi|300975548|ref|ZP_07173059.1| flagellar M-ring protein FliF [Escherichia coli MS 45-1]
 gi|301050702|ref|ZP_07197563.1| flagellar M-ring protein FliF [Escherichia coli MS 185-1]
 gi|306814239|ref|ZP_07448405.1| flagellar MS-ring protein [Escherichia coli NC101]
 gi|26108610|gb|AAN80813.1|AE016762_66 Flagellar M-ring protein [Escherichia coli CFT073]
 gi|227837206|gb|EEJ47672.1| flagellar MS-ring protein [Escherichia coli 83972]
 gi|300297625|gb|EFJ54010.1| flagellar M-ring protein FliF [Escherichia coli MS 185-1]
 gi|300410317|gb|EFJ93855.1| flagellar M-ring protein FliF [Escherichia coli MS 45-1]
 gi|305852398|gb|EFM52849.1| flagellar MS-ring protein [Escherichia coli NC101]
 gi|307553951|gb|ADN46726.1| flagellar M-ring protein FliF [Escherichia coli ABU 83972]
 gi|315290255|gb|EFU49633.1| flagellar M-ring protein FliF [Escherichia coli MS 153-1]
          Length = 552

 Score =  368 bits (945), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 235/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEALTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGALP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAVKTVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|302185562|ref|ZP_07262235.1| flagellar MS-ring protein [Pseudomonas syringae pv. syringae 642]
          Length = 594

 Score =  368 bits (945), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 120/586 (20%), Positives = 221/586 (37%), Gaps = 56/586 (9%)

Query: 9   QFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALS 68
            F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  +I   L+
Sbjct: 25  SFLENLSEMTMLRQIGLMVGLAASVAIGFAVVLWSQQPDYRPLYGSLAGMDSKQIMDTLT 84

Query: 69  EANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQE 128
            ANI++ +  N  ++ V S  V +ARI LA  G+  + +N G+E+ DK    G + FM+ 
Sbjct: 85  AANINYTVEPNSGALLVKSDDVQRARIQLAQAGVVQNDANIGFEILDKDQGLGTSQFMEA 144

Query: 129 ITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPSVYK 186
               R LEGE+ARTI +++ +  ARVH+ +P    F +   +P+ASV++           
Sbjct: 145 TRYRRGLEGELARTISALNNVKGARVHLAIPKSSVFVRDDRKPSASVLVELYAGRSLEPS 204

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN--ILGKSLSIVQAIQHEIEMN 244
              AI +LVA +VP L    +TV+D  G LL+         + GK     + ++  +   
Sbjct: 205 QVMAIINLVATSVPELSKSQITVVDQKGALLSDQAENSELTMAGKQFDYSRRMESMLTQR 264

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPES 304
           +   L   LG D +++ V A ++    +     ++PD    RS +   + QRS  S    
Sbjct: 265 VQNILQPILGNDRYKAEVSAVVDFSAVESTAESFNPDQPALRSEQSV-NEQRSSGSSSGG 323

Query: 305 AVTVEQNMPHVSDRKVPLPRSL-----------------------------------ENT 329
                 N P                                                   
Sbjct: 324 VPGALSNQPPGPATAPQTAGGGAAGAAGPIAPGQPLLDANGQQIMDPATGQPALAPYPAD 383

Query: 330 DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEV-LGRSADQGKIDSYLAEI 388
            + +   N+E++     T     +L RLS+AVVV+    T    G         + LA  
Sbjct: 384 KRVQSTKNFELDRSISHTKQQQGRLTRLSVAVVVDDMVKTNAANGEVTRAPWSAADLARF 443

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  A G ++ RGD++++ ++ F   +                  F  ++   V ++ 
Sbjct: 444 TRLVQDAVGFDASRGDSVSVINVPFSSERAEVLPEASF----YSQPWFWDIVKQAVGVIF 499

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
            L++ F  L  +         K+    G               G + ND ++L      +
Sbjct: 500 ILILVFGVLRPVLNNITNGKRKELAGFGG---DAELGGMGGLDGELSNDRVSLGGPQSIL 556

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                       +         +  ++  +  R A+++++W  ++ 
Sbjct: 557 LPSP--------TEGYDAQLNAIKSLVAEDPGRVAQVVKEWINTDE 594


>gi|331683490|ref|ZP_08384091.1| flagellar M-ring protein FliF [Escherichia coli H299]
 gi|331079705|gb|EGI50902.1| flagellar M-ring protein FliF [Escherichia coli H299]
          Length = 552

 Score =  368 bits (945), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 128/577 (22%), Positives = 235/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVTGSAAVAVMVALILWAKTPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDKGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEALTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  + + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREISDNDPRVVALVIRQWINNDHE 552


>gi|158422251|ref|YP_001523543.1| flagellar MS-ring protein [Azorhizobium caulinodans ORS 571]
 gi|158329140|dbj|BAF86625.1| flagellar M-ring protein [Azorhizobium caulinodans ORS 571]
          Length = 559

 Score =  368 bits (945), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 202/561 (36%), Positives = 301/561 (53%), Gaps = 13/561 (2%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M   +QL +   +   LG  R++ L  +    + +      +++ P  + LY  L   DV
Sbjct: 1   MNAREQLERLLSNLRQLGARRLVALGLIAFTVMAVIGLGAMYLSQPERETLYANLSRDDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
            RI  AL +A I F +S +G+++ V  S   +AR+ LA +GLP SSS SGYELF+ V SF
Sbjct: 61  TRIGGALKDAGIPFDVSSDGATVLVAHSDTARARMLLAVKGLPQSSS-SGYELFNDVRSF 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+T+VRALEGEIARTIQ++ GI AARVHIV+PD GSFR+     TASV+IR  
Sbjct: 120 GLTSFMQEVTKVRALEGEIARTIQTMKGIKAARVHIVLPDRGSFRRDQQLATASVVIRTE 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEME-RNILGKSLSIVQAIQH 239
           N +   +A+AIRHLVAAA+P + + +VTVL++ G +LT+ E        +  ++ Q +  
Sbjct: 180 NSADSSTAQAIRHLVAAAIPGMKLDNVTVLNTEGTILTSTEDGVTAAATRKSALQQQVNR 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           E E  I + L  FLG+ NF  +V + LN D   I E  YDP SK ERS R+ K+  +++ 
Sbjct: 240 ETEEKIRRTLTPFLGLGNFEVSVSSRLNTDRSTINETTYDPASKAERSTRVVKEQGQTQN 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
              +   TV+QN+P           + EN  ++EE +N+EI+T+   T  D Y +E LSI
Sbjct: 300 RSQQPNTTVQQNIPPPPGTPGTGTENNENNQRREELTNFEISTRQSQTVRDAYSVENLSI 359

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AV+VNK RLT     +  + +       I ++VS+A G +  RGD + + ++ F +    
Sbjct: 360 AVLVNKERLTGTKDGTPLETQTYE----IEQLVSSAAGFDKERGDKLKVVAVPFADGGNN 415

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
                 +++ ++L R   T++NA+  LV  +L+ + GL    R              ++ 
Sbjct: 416 MEPIPPLTWSELLFRQAGTIVNAVTILVVAILLIWFGLRPALRAILARPEPDEAEAIEAA 475

Query: 480 LSPPPISSAVTTGLMPN-------DNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLL 532
           +   P      T L          D +   +      S   NL   + S V++    RL 
Sbjct: 476 MLAAPTELPPDTVLPSTAQNPNTLDGVTTLAGFTGGDSGPVNLIGDVTSKVNRSPQRRLE 535

Query: 533 HMIEINEERFAKILRKWARSE 553
            MIE +EE+ A ILR+W   E
Sbjct: 536 QMIEYDEEQAAAILRQWLHQE 556


>gi|331647532|ref|ZP_08348624.1| flagellar M-ring protein FliF [Escherichia coli M605]
 gi|330911744|gb|EGH40254.1| flagellar M-ring protein FliF [Escherichia coli AA86]
 gi|331043256|gb|EGI15394.1| flagellar M-ring protein FliF [Escherichia coli M605]
          Length = 552

 Score =  368 bits (945), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 236/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRILFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEALTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGALP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  +++                 ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAVKTVQQQALARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|91211156|ref|YP_541142.1| flagellar MS-ring protein [Escherichia coli UTI89]
 gi|215487138|ref|YP_002329569.1| flagellar MS-ring protein [Escherichia coli O127:H6 str. E2348/69]
 gi|218558795|ref|YP_002391708.1| flagellar MS-ring protein [Escherichia coli S88]
 gi|237705897|ref|ZP_04536378.1| flagellar MS-ring protein [Escherichia sp. 3_2_53FAA]
 gi|300940393|ref|ZP_07154978.1| flagellar M-ring protein FliF [Escherichia coli MS 21-1]
 gi|312967135|ref|ZP_07781353.1| flagellar M-ring protein FliF [Escherichia coli 2362-75]
 gi|91072730|gb|ABE07611.1| flagellar M-ring protein [Escherichia coli UTI89]
 gi|215265210|emb|CAS09600.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           O127:H6 str. E2348/69]
 gi|218365564|emb|CAR03291.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           S88]
 gi|226900654|gb|EEH86913.1| flagellar MS-ring protein [Escherichia sp. 3_2_53FAA]
 gi|294491623|gb|ADE90379.1| flagellar M-ring protein FliF [Escherichia coli IHE3034]
 gi|300454787|gb|EFK18280.1| flagellar M-ring protein FliF [Escherichia coli MS 21-1]
 gi|307626586|gb|ADN70890.1| flagellar MS-ring protein [Escherichia coli UM146]
 gi|312288599|gb|EFR16501.1| flagellar M-ring protein FliF [Escherichia coli 2362-75]
 gi|323952431|gb|EGB48304.1| flagellar M-ring protein FliF [Escherichia coli H252]
 gi|323956334|gb|EGB52077.1| flagellar M-ring protein FliF [Escherichia coli H263]
          Length = 552

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 235/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEALTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGALP----FWQQQVFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAVKTVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|218549263|ref|YP_002383054.1| flagellar MS-ring protein [Escherichia fergusonii ATCC 35469]
 gi|218356804|emb|CAQ89432.1| flagellar basal-body MS-ring and collar protein [Escherichia
           fergusonii ATCC 35469]
 gi|325497680|gb|EGC95539.1| flagellar MS-ring protein [Escherichia fergusonii ECD227]
          Length = 552

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 128/577 (22%), Positives = 238/577 (41%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPRIPLIVAGSAAVAVIVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEVSGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D +G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+    ++   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNVHAQVTAQLDFASKEQTEEQYRPNGDQSQATLRSRQVNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANSAPISTPPANQNNRQQQTSTSSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN     +              + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKATPDGK----PLPLSAEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      +++A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNTSDESGGELP----FWQQQVFIDQLLSAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++      +  AV   L  ++ +    +NQ + +   +    
Sbjct: 471 AVRPQLTRRVEAVKAVQQQAQAR-QEVEDAVEVRLSKDEQLQQRRANQRMSAEMMS---- 525

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
                      R+  M + +    A ++R+W  ++ E
Sbjct: 526 ----------QRIREMSDNDPRVVALVIRQWINNDHE 552


>gi|222084850|ref|YP_002543379.1| flagellar M-ring protein [Agrobacterium radiobacter K84]
 gi|221722298|gb|ACM25454.1| flagellar M-ring protein [Agrobacterium radiobacter K84]
          Length = 559

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 269/554 (48%), Positives = 381/554 (68%), Gaps = 6/554 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M +L+QL+  F++  +LGRTR+L LA V ++ + L + A  +VN P  + LYV L+ +D+
Sbjct: 1   MNLLNQLVPLFRNLQNLGRTRLLTLAGVGILSVALVLFAALYVNKPAQETLYVGLDATDL 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           N+IS+AL+EA I+F++  +G+S++VP+ M GKAR  LA +GLP +S+N+GYELFD V S 
Sbjct: 61  NQISIALAEAKINFQVGADGTSLTVPTGMTGKARALLAERGLP-NSTNAGYELFDNVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEI RTI SISGI AARVHIVM D+G+FRK   +PTASVMIRA 
Sbjct: 120 GLTSFMQEVTRVRALEGEIGRTITSISGISAARVHIVMQDVGNFRKADQKPTASVMIRAN 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL-GKSLSIVQAIQH 239
             +  K+A+AIRHLVA+AVP L++ DVT+LDSTG+LL + + + N    ++L IVQ +Q 
Sbjct: 180 AEAARKAAQAIRHLVASAVPGLEVDDVTILDSTGQLLASGDDQSNGALNRNLGIVQNVQG 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           EI  NI+KALA FLG+DNFRS+V A+LN D+QQ++E  YDP+SKVERS+R +K+AQ+S+ 
Sbjct: 240 EIASNIDKALAPFLGMDNFRSSVTAQLNTDSQQVQETTYDPESKVERSVRTTKEAQKSQQ 299

Query: 300 SQPESAVTVEQNMPHVSDRKVP-LPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLS 358
            Q ++A TVEQN+P  + +     P S + TDK+EEQ+NYEIN+K+ AT  ++Y++E+LS
Sbjct: 300 RQSDTAATVEQNIPQAAPQAGGNGPTSNDQTDKREEQTNYEINSKTTATVRNSYRIEKLS 359

Query: 359 IAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQL 418
           +AVVVN+GR+ +++G+ AD  K+D+Y+AE+ KIV+ A G++  RGD +T+ +MDFL+ QL
Sbjct: 360 VAVVVNRGRIAQMVGQPADPAKVDAYIAEMQKIVATAAGLDPSRGDVVTVNAMDFLDTQL 419

Query: 419 FNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDD---AKKGEVG 475
            +     ++ MD+LSR+ A +IN+L F+   +L+ +LG   L R         A     G
Sbjct: 420 LDDNASGLNIMDVLSRNIAGIINSLAFVAVAVLIIWLGFRPLIRSLGGGANGTALPDAAG 479

Query: 476 GKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMI 535
            +     P         LM          + D         S  N  V +  + RL  M+
Sbjct: 480 LELPDFAPGAVGGPGAALMDGFGSDFGFDSTDDLLTMGEDNSTFNRRVKEGPERRLSRMV 539

Query: 536 EINEERFAKILRKW 549
           EI+EER AKILRKW
Sbjct: 540 EISEERAAKILRKW 553


>gi|86748397|ref|YP_484893.1| flagellar MS-ring protein [Rhodopseudomonas palustris HaA2]
 gi|86571425|gb|ABD05982.1| flagellar M-ring protein FliF [Rhodopseudomonas palustris HaA2]
          Length = 532

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 133/551 (24%), Positives = 230/551 (41%), Gaps = 26/551 (4%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           +         LG  R++ + +V +  +  F      V+ P    LY  L V D + I   
Sbjct: 1   MQSLLGFLKGLGAARVMAMIAVTMALLGFFAFVIMRVSQPQMTTLYTDLSVEDSSSIIKE 60

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L    I F + ++G+ + VP   V + R+ LA           GYE+FDK ++ G TSF+
Sbjct: 61  LERQAIPFEMRNDGAILMVPKDKVTRLRMKLAEG-GLPKGGGVGYEIFDKSDALGTTSFV 119

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           Q I  +RALEGE++RTI++I  + AARVH+V+P+   F +    P+AS+++R       +
Sbjct: 120 QNINHLRALEGELSRTIRAIDRVQAARVHLVLPERPLFSRETPEPSASIVLRVRGALEPQ 179

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA--NEMERNILGKSLSIVQAIQHEIEMN 244
              AIRHLVA+AV  L    V+++D  G+LL                    + +  +   
Sbjct: 180 QVRAIRHLVASAVNGLKPQRVSIVDEGGQLLADGSASANAADGAAGDERRTSFEKRMRNE 239

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPES 304
           I   +++ +G    R  V A+ + +        +DP+ +V RS +  ++  +++TS  + 
Sbjct: 240 IEGIVSSVVGSGRARVQVTADFDYNKITQTSDKFDPEGRVLRSSQTREE--QAQTSAADG 297

Query: 305 AVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVN 364
            VTV   +P           + + + K EE +NYEI+  +     +  ++ RLS+AV+V+
Sbjct: 298 QVTVNNELPGNQA--PGGAGARDQSKKSEETNNYEISRVTKTEVTEAGRVNRLSVAVLVD 355

Query: 365 KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTV 424
                +  G      +    L  I  +V +A G + +RGD I + ++ F E         
Sbjct: 356 GSYTKDEKGELVYAERPKEQLDRIAALVRSAIGFDQKRGDQIEVVNLRFAEAPQVEKLPE 415

Query: 425 QV---SFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILS 481
                  +         +I   V  V  L+V F+ +  L +     D      G  ++  
Sbjct: 416 PAGLLGMLQFTKDDIMNMIQLGVMFVLGLVVLFMVIRPLVKRVLASDPASEASGLPALAD 475

Query: 482 PPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEER 541
                                         S    +++   V  QS  R+  + E N   
Sbjct: 476 GSLPQIGSDGQAGT----------------SMIDIAQVQGQVHAQSVHRVGELAERNPNE 519

Query: 542 FAKILRKWARS 552
            A I+R+W   
Sbjct: 520 TAAIVRQWLAE 530


>gi|323977881|gb|EGB72967.1| flagellar M-ring protein FliF [Escherichia coli TW10509]
          Length = 552

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 128/577 (22%), Positives = 237/577 (41%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+    ++   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDKSQAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       +   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNNGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      +++A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQVFIDQLLSAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|320194349|gb|EFW68980.1| Flagellar M-ring protein FliF [Escherichia coli WV_060327]
          Length = 552

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 234/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L             +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPGGK----PLPLSNEQMKQIEALTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGALP----FWQQQVFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAVKTVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|205360167|ref|ZP_02835012.2| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205340693|gb|EDZ27457.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
          Length = 579

 Score =  368 bits (944), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 126/572 (22%), Positives = 227/572 (39%), Gaps = 52/572 (9%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +  +P Y  L+  L   D   I   L++ 
Sbjct: 33  LEWLNRLRANPRIPLIVASSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQM 92

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +R ++   +I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 93  NIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVN 150

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--SA 188
             RALEGE+ARTI+++  + +ARVH+ MP    F +    P+ASV +             
Sbjct: 151 YQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQI 210

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEIEMNINK 247
            A+ HLV++AV  L  G+VT++D +G LLT +    R++    L     ++  I+  I  
Sbjct: 211 SAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEA 270

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PES 304
            L+  +G  N  + V A+L+   ++  E  Y P+    ++   S+    SE      P  
Sbjct: 271 ILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGG 330

Query: 305 AVTVEQNMP---------------------HVSDRKVPLPRSLENTDKKEEQSNYEINTK 343
                 N P                       +        +     ++ E SNYE++  
Sbjct: 331 VPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSNNSNNAGPRNTQRNETSNYEVDRT 390

Query: 344 SIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRG 403
              T  +   +ERLS+AVVVN   L +              + +I  +   A G + +RG
Sbjct: 391 IRHTKMNVGDIERLSVAVVVNYKTLADGK----PLPLTADQMKQIEDLTREAMGFSDKRG 446

Query: 404 DTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL 463
           DT+ + +  F                         ++ A  +L+  ++   L   A+R  
Sbjct: 447 DTLNVVNSPFSAVDDTGGELP----FWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQ 502

Query: 464 HNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYV 523
                 +      ++ +                +       ++D     R    R+ + V
Sbjct: 503 LTRRVEEAKAAQEQAQVR------------QETEEAVEVRLSKDEQLQQRRANQRLGAEV 550

Query: 524 SKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
             Q   R+  M + +    A ++R+W  ++ E
Sbjct: 551 MSQ---RIREMSDNDPRVVALVIRQWMSNDHE 579


>gi|209919360|ref|YP_002293444.1| flagellar MS-ring protein [Escherichia coli SE11]
 gi|293446318|ref|ZP_06662740.1| flagellar M-ring protein FliF [Escherichia coli B088]
 gi|209912619|dbj|BAG77693.1| flagellar hook-basal body MS ring protein FliF [Escherichia coli
           SE11]
 gi|291323148|gb|EFE62576.1| flagellar M-ring protein FliF [Escherichia coli B088]
          Length = 552

 Score =  368 bits (944), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 234/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPAEKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI +I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIATIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|218699502|ref|YP_002407131.1| flagellar MS-ring protein [Escherichia coli IAI39]
 gi|218369488|emb|CAR17255.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           IAI39]
          Length = 552

 Score =  368 bits (944), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 235/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEALTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGALP----FWQQQVFIDELLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAVKTVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|194365657|ref|YP_002028267.1| flagellar MS-ring protein [Stenotrophomonas maltophilia R551-3]
 gi|194348461|gb|ACF51584.1| flagellar M-ring protein FliF [Stenotrophomonas maltophilia R551-3]
          Length = 548

 Score =  368 bits (944), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 117/553 (21%), Positives = 224/553 (40%), Gaps = 21/553 (3%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           ++  Q+F    SL  TR L L ++I V +   +   F+   P    LY  L+       +
Sbjct: 13  EKAGQWFDRLQSLQITRRLGLMAMIAVAVAAGLFVFFWSQKPGMVPLYTGLDQKATAEAT 72

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L  A I F++      I+VP   +  AR+ LA  GL + S   G+EL ++   FG++ 
Sbjct: 73  DLLRAAQIPFQLDPATGGITVPEKNLHDARLKLAGSGL-TDSGKLGFELMERDPGFGVSQ 131

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INP 182
           F++      ALE E++RTI ++  +  +RVH+ +P   +F +     +ASV +       
Sbjct: 132 FVESARYQHALETELSRTINTLRPVRDSRVHLAIPKPSAFTRQRDVASASVTLELRGGQQ 191

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL--GKSLSIVQAIQHE 240
                 +AI H+VAA++P+L    VTV+D +G++L+ ++              V+  +  
Sbjct: 192 LERSQVDAIVHMVAASIPDLAPERVTVVDQSGRMLSVSDPNSEAAVNAAQFEQVRRQETS 251

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
               I + L    G       V  +++    +    +Y+ + +  RS ++S+    + T 
Sbjct: 252 FNQRIRELLEPMTGPGRVNPEVSVDMDFSVTEEARELYNGEPQKLRSEQMSE--NSTTTP 309

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
            P+       N P          ++   + K     NYE++     T     +++R+S+A
Sbjct: 310 GPQGVPGATSNSPPGQAAAPATAQTPTESSK-NATRNYELDRTLQHTRQPAGRIKRVSVA 368

Query: 361 VVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN 420
           V+V+        G+ A Q    + L  +  +V  A G N+ RGDT+++ +  F+ +    
Sbjct: 369 VLVDNVPRAGANGKVAPQPLSAAELTRVEALVKQAVGFNAERGDTVSVMNAPFVRDTTPV 428

Query: 421 SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL 480
            G                    L+  V  L + F  L    R     + K  E   +   
Sbjct: 429 EGPAWWEL-----PWVHDAGRMLLGAVVVLALLFGVLRPALRAITGQNKKNDEQALEPHT 483

Query: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540
                       L+ +D + L +   D  S        +     ++        ++ + +
Sbjct: 484 --------ADVQLVDDDGMPLPALGADRASLGGPDALALPVDSYEERLRMAREAVKTDSK 535

Query: 541 RFAKILRKWARSE 553
           R A++++ W  ++
Sbjct: 536 RVAQVVKGWVAND 548


>gi|323961982|gb|EGB57581.1| flagellar M-ring protein FliF [Escherichia coli H489]
          Length = 552

 Score =  368 bits (943), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 237/577 (41%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKTPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+    ++   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  ++                     ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSEESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|260868531|ref|YP_003234933.1| flagellar basal-body MS-ring and collar protein FliF [Escherichia
           coli O111:H- str. 11128]
 gi|257764887|dbj|BAI36382.1| flagellar basal-body MS-ring and collar protein FliF [Escherichia
           coli O111:H- str. 11128]
 gi|323180809|gb|EFZ66349.1| flagellar M-ring protein FliF [Escherichia coli 1180]
          Length = 552

 Score =  368 bits (943), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 239/577 (41%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R+S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRVSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFREQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+    ++   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PVPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  +   +   +  AV   L  ++ +    +NQ + +   +    
Sbjct: 471 AVRPQLTRRAEAMKAVQ-QQAQAHEEVEDAVEVRLSKDEQLQQRRANQRLGAEVMS---- 525

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
                      R+  M + +    A ++R+W  ++ E
Sbjct: 526 ----------QRIREMSDNDPRVVALVIRQWINNDHE 552


>gi|146307847|ref|YP_001188312.1| flagellar MS-ring protein [Pseudomonas mendocina ymp]
 gi|145576048|gb|ABP85580.1| flagellar M-ring protein FliF [Pseudomonas mendocina ymp]
          Length = 594

 Score =  368 bits (943), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 118/586 (20%), Positives = 229/586 (39%), Gaps = 55/586 (9%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F ++   +   R L L   +   + +  A   +   P Y  LY  L   D  ++   L
Sbjct: 25  LSFLENLAEMSVLRQLGLLVGLAASVAIGFAVVLWSQQPDYRPLYGSLNGLDATQVVETL 84

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + A I++ +  N  ++ V +  + +AR+ LAA G+  + ++ G+E+ D+    G + FM+
Sbjct: 85  NAAGINYTVEPNSGALLVKADDLSRARLRLAAAGVAPTDNSVGFEILDREQGLGTSQFME 144

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN--PSVY 185
                R LEGE+ART+ S++ + AARVH+ MP    F +   +P+ASV++          
Sbjct: 145 ATRYRRGLEGELARTVSSLNNVKAARVHLAMPKASVFVRDERKPSASVLVELYPGRALEP 204

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM--ERNILGKSLSIVQAIQHEIEM 243
               AI +LVA +VP LD G VTV+D  G LL+  +   E  + GK     + ++     
Sbjct: 205 SQVMAIVNLVATSVPELDKGQVTVVDQKGNLLSDQQELSELTMAGKQFDYTRRMETLFTQ 264

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            ++  L   LG   +++ V A+++  + +    +++PD    RS +   + ++S +  P+
Sbjct: 265 RVHNILQPVLGTGRYKAEVSADVDFSSVESTSEMFNPDQPALRSEQQVNEQRQS-SLPPQ 323

Query: 304 SAVTVEQNMP----------------------------------HVSDRKVPLPRSLENT 329
                  N P                                         P+       
Sbjct: 324 GVPGALSNQPPGAAAAPEQAGGAAGAAGPVAPGQPLVDANGQQITDPITGQPMLAPYPAD 383

Query: 330 DKKEEQSNYEINTKSIATTHDNYKLERLS-IAVVVNKGRLTEVLGRSADQGKIDSYLAEI 388
            +++   N+E++     T     +L RLS   VV ++ R+    G +         LA  
Sbjct: 384 KREQSTRNFELDRSISYTKQQQGRLRRLSVAVVVDDQVRVDPATGEANRVPWSADDLARF 443

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  + G ++ RGD++++ +  F  +       +                  +  ++G
Sbjct: 444 TRLVQDSVGFDASRGDSVSVINTAFTASLGEEIPDIPFYTQPWFWD-------IVKQVLG 496

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
            L +  L    LR + N         G            A   G +  D ++L      +
Sbjct: 497 VLFILVLVFGVLRPVLNNITGGGKGKGLAETGDVELGEMAGLDGELSEDRVSLGGPQSIL 556

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                       S         +  ++  +  R A+++++W  ++ 
Sbjct: 557 LPSP--------SEGYDAQLNAIKSLVAEDPGRVAQVVKEWINADE 594


>gi|15802373|ref|NP_288399.1| flagellar MS-ring protein [Escherichia coli O157:H7 EDL933]
 gi|15831931|ref|NP_310704.1| flagellar MS-ring protein [Escherichia coli O157:H7 str. Sakai]
 gi|168751866|ref|ZP_02776888.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4113]
 gi|168758251|ref|ZP_02783258.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4401]
 gi|168764438|ref|ZP_02789445.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4501]
 gi|168771544|ref|ZP_02796551.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4486]
 gi|168777364|ref|ZP_02802371.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4196]
 gi|168783334|ref|ZP_02808341.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4076]
 gi|168790304|ref|ZP_02815311.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str. EC869]
 gi|168802284|ref|ZP_02827291.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str. EC508]
 gi|195939244|ref|ZP_03084626.1| flagellar MS-ring protein [Escherichia coli O157:H7 str. EC4024]
 gi|208810543|ref|ZP_03252419.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4206]
 gi|208817037|ref|ZP_03258157.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4045]
 gi|208820542|ref|ZP_03260862.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4042]
 gi|209395809|ref|YP_002271054.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4115]
 gi|217328740|ref|ZP_03444821.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           TW14588]
 gi|254793588|ref|YP_003078425.1| flagellar MS-ring protein [Escherichia coli O157:H7 str. TW14359]
 gi|261227567|ref|ZP_05941848.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261254609|ref|ZP_05947142.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           O157:H7 str. FRIK966]
 gi|12516042|gb|AAG56953.1|AE005416_7 flagellar biosynthesis; basal-body MS(membrane and
           supramembrane)-ring and collar protein [Escherichia coli
           O157:H7 str. EDL933]
 gi|13362145|dbj|BAB36100.1| flagellar hook-basal body MS ring protein FliF [Escherichia coli
           O157:H7 str. Sakai]
 gi|187767394|gb|EDU31238.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4196]
 gi|188014158|gb|EDU52280.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4113]
 gi|188999271|gb|EDU68257.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4076]
 gi|189354893|gb|EDU73312.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4401]
 gi|189359720|gb|EDU78139.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4486]
 gi|189365550|gb|EDU83966.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4501]
 gi|189370217|gb|EDU88633.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str. EC869]
 gi|189375710|gb|EDU94126.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str. EC508]
 gi|208725059|gb|EDZ74766.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4206]
 gi|208731380|gb|EDZ80069.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4045]
 gi|208740665|gb|EDZ88347.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4042]
 gi|209157209|gb|ACI34642.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC4115]
 gi|209766878|gb|ACI81751.1| flagellar hook-basal body MS ring protein FliF [Escherichia coli]
 gi|209766880|gb|ACI81752.1| flagellar hook-basal body MS ring protein FliF [Escherichia coli]
 gi|209766882|gb|ACI81753.1| flagellar hook-basal body MS ring protein FliF [Escherichia coli]
 gi|209766886|gb|ACI81755.1| flagellar hook-basal body MS ring protein FliF [Escherichia coli]
 gi|217318087|gb|EEC26514.1| flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           TW14588]
 gi|254592988|gb|ACT72349.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           O157:H7 str. TW14359]
 gi|320191912|gb|EFW66559.1| Flagellar M-ring protein FliF [Escherichia coli O157:H7 str.
           EC1212]
 gi|326342348|gb|EGD66129.1| Flagellar M-ring protein FliF [Escherichia coli O157:H7 str. 1044]
 gi|326344853|gb|EGD68600.1| Flagellar M-ring protein FliF [Escherichia coli O157:H7 str. 1125]
          Length = 552

 Score =  368 bits (943), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 236/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEME-RNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSWRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+    ++   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|218689933|ref|YP_002398145.1| flagellar MS-ring protein [Escherichia coli ED1a]
 gi|291283115|ref|YP_003499933.1| Flagellar M-ring protein FliF precursor [Escherichia coli O55:H7
           str. CB9615]
 gi|293415248|ref|ZP_06657891.1| flagellar M-ring protein FliF [Escherichia coli B185]
 gi|301644603|ref|ZP_07244592.1| flagellar M-ring protein FliF [Escherichia coli MS 146-1]
 gi|331677820|ref|ZP_08378495.1| flagellar M-ring protein FliF [Escherichia coli H591]
 gi|209766884|gb|ACI81754.1| flagellar hook-basal body MS ring protein FliF [Escherichia coli]
 gi|218427497|emb|CAR08270.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           ED1a]
 gi|290762988|gb|ADD56949.1| Flagellar M-ring protein FliF precursor [Escherichia coli O55:H7
           str. CB9615]
 gi|291432896|gb|EFF05875.1| flagellar M-ring protein FliF [Escherichia coli B185]
 gi|301077078|gb|EFK91884.1| flagellar M-ring protein FliF [Escherichia coli MS 146-1]
 gi|320641786|gb|EFX11174.1| flagellar MS-ring protein [Escherichia coli O157:H7 str. G5101]
 gi|320647145|gb|EFX15978.1| flagellar MS-ring protein [Escherichia coli O157:H- str. 493-89]
 gi|320652429|gb|EFX20727.1| flagellar MS-ring protein [Escherichia coli O157:H- str. H 2687]
 gi|320658031|gb|EFX25793.1| flagellar MS-ring protein [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320658603|gb|EFX26297.1| flagellar MS-ring protein [Escherichia coli O55:H7 str. USDA 5905]
 gi|320668501|gb|EFX35328.1| flagellar MS-ring protein [Escherichia coli O157:H7 str. LSU-61]
 gi|331074280|gb|EGI45600.1| flagellar M-ring protein FliF [Escherichia coli H591]
          Length = 552

 Score =  368 bits (943), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 236/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+    ++   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|320182746|gb|EFW57630.1| Flagellar M-ring protein FliF [Shigella boydii ATCC 9905]
          Length = 552

 Score =  368 bits (943), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 128/577 (22%), Positives = 235/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+    ++   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
            +R            V  ++                  ++      ++D     R    R
Sbjct: 471 TVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGTEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|256022404|ref|ZP_05436269.1| flagellar MS-ring protein [Escherichia sp. 4_1_40B]
 gi|301029395|ref|ZP_07192489.1| flagellar M-ring protein FliF [Escherichia coli MS 196-1]
 gi|299877699|gb|EFI85910.1| flagellar M-ring protein FliF [Escherichia coli MS 196-1]
          Length = 552

 Score =  368 bits (943), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 128/577 (22%), Positives = 235/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVTGSAAVAVMVALILWAKTPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEALTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  + + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREISDNDPRVVALVIRQWINNDHE 552


>gi|191168288|ref|ZP_03030081.1| flagellar M-ring protein FliF [Escherichia coli B7A]
 gi|190901660|gb|EDV61416.1| flagellar M-ring protein FliF [Escherichia coli B7A]
          Length = 552

 Score =  368 bits (943), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 236/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVNQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+    ++   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|331657984|ref|ZP_08358946.1| flagellar M-ring protein FliF [Escherichia coli TA206]
 gi|331056232|gb|EGI28241.1| flagellar M-ring protein FliF [Escherichia coli TA206]
          Length = 552

 Score =  368 bits (943), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 235/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVTGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEALTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGALP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAQAVKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|323968354|gb|EGB63761.1| flagellar M-ring protein FliF [Escherichia coli M863]
 gi|327253070|gb|EGE64724.1| flagellar M-ring protein FliF [Escherichia coli STEC_7v]
          Length = 552

 Score =  368 bits (943), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 128/577 (22%), Positives = 237/577 (41%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPAEKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ +P    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLALPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+    ++   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDKSQAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      +++A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQVFIDQLLSAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|330808215|ref|YP_004352677.1| flagellar MS-ring protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376323|gb|AEA67673.1| flagellar MS-ring protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 594

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 117/586 (19%), Positives = 224/586 (38%), Gaps = 55/586 (9%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F ++ + +   R + L   +   + +  A   +   P Y  LY  L   D  ++   L
Sbjct: 25  LSFLENLSEMTMLRQVGLLVGLAASVAIGFAVVLWSQQPDYRPLYGSLAGMDAKQVMETL 84

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + A+I + +  N  ++ V +  V +AR+ LAA G+  +  N G+E+ DK    G + FM+
Sbjct: 85  ASADIPYTVEPNSGALLVKADDVARARLKLAAAGVTPTDGNIGFEILDKDQGLGTSQFME 144

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPSVY 185
                R LEGE+ARTI S++ +  ARVH+ +P    F +   +P+ASV++          
Sbjct: 145 ATRYRRGLEGELARTISSLNNVKGARVHLAIPKSSVFVRDERKPSASVLVELYSGRSLEP 204

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN--ILGKSLSIVQAIQHEIEM 243
               AI +LVA +VP L    +TV+D  G LL+         + GK     + ++  +  
Sbjct: 205 GQVLAIINLVATSVPELSKSQITVVDQKGNLLSDQAENSELTMAGKQFDYSRRMEGMLTQ 264

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            ++  L   LG D +++ V A+++    +     ++PD    RS +   + QR+ ++ P+
Sbjct: 265 RVHNILQPILGNDRYKAEVSADVDFSAVESTSEQFNPDQPALRSEQSV-NEQRTASNGPQ 323

Query: 304 SAVTVEQNMPHVSDRKVPLPRSL----------------------------------ENT 329
                  N P                                                  
Sbjct: 324 GVPGALSNQPPSPASAPQTTGGATAAAGMVQPGQPLIDANGQQIMDPATGQPMLAPYPAD 383

Query: 330 DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGR-LTEVLGRSADQGKIDSYLAEI 388
            +++   N+E++     T     +L RLS+AVVV+    +    G ++        LA  
Sbjct: 384 KRQQSTKNFELDRSISHTKQQQGRLTRLSVAVVVDDQVKVNAANGETSRAPWSADELARF 443

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  A G ++ RGD++++ ++ F   +      +                     ++G
Sbjct: 444 TRLVQDAVGFDASRGDSVSVINVPFSLERGEVVADIPFYSQPWFWDVVKQ-------VLG 496

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
            L +  L    LR + N                          G + ND ++L      +
Sbjct: 497 VLFILVLVFGVLRPVLNNITGGGKSKQLAGFGDVELGGMGGLDGELANDRVSLGGPQSIL 556

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                       S         +  ++  +  R A+++++W  ++ 
Sbjct: 557 LPSP--------SEGYDAQLNAIKSLVAEDPGRVAQVVKEWINADE 594


>gi|307138605|ref|ZP_07497961.1| flagellar MS-ring protein [Escherichia coli H736]
 gi|331642559|ref|ZP_08343694.1| flagellar M-ring protein FliF [Escherichia coli H736]
 gi|331039357|gb|EGI11577.1| flagellar M-ring protein FliF [Escherichia coli H736]
          Length = 552

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 128/577 (22%), Positives = 235/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVTGSAAVAVMVALILWAKTPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEALAREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  + + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREISDNDPRVVALVIRQWINNDHE 552


>gi|300818642|ref|ZP_07098850.1| flagellar M-ring protein FliF [Escherichia coli MS 107-1]
 gi|300528814|gb|EFK49876.1| flagellar M-ring protein FliF [Escherichia coli MS 107-1]
          Length = 552

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 237/577 (41%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R+S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRVSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+    ++   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PVPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|260844337|ref|YP_003222115.1| flagellar basal-body MS-ring and collar protein FliF [Escherichia
           coli O103:H2 str. 12009]
 gi|257759484|dbj|BAI30981.1| flagellar basal-body MS-ring and collar protein FliF [Escherichia
           coli O103:H2 str. 12009]
          Length = 552

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 234/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI +I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIATIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMMQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|254522751|ref|ZP_05134806.1| flagellar M-ring protein FliF [Stenotrophomonas sp. SKA14]
 gi|219720342|gb|EED38867.1| flagellar M-ring protein FliF [Stenotrophomonas sp. SKA14]
          Length = 547

 Score =  367 bits (942), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 115/553 (20%), Positives = 221/553 (39%), Gaps = 22/553 (3%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           ++  Q+F    SL  TR L L ++I V +   ++  F+   P    LY  L+       +
Sbjct: 13  EKAGQWFDRLQSLQITRRLGLMAMIAVAVAAGLSVFFWSQKPGMVPLYTGLDQKATAEAT 72

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L  A I F +      I+VP   +  AR+ LA  GL + S   G+EL ++   FG++ 
Sbjct: 73  DLLRAAQIPFALDPATGGITVPEKNLHDARLKLAGSGL-TDSGKLGFELMERDPGFGVSQ 131

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INP 182
           F++      ALE E++RTI ++  +  +RVH+ +P   +F +     +ASV +       
Sbjct: 132 FVESARYQHALETELSRTINTLRPVRDSRVHLAIPKPSAFTRQRDVASASVTLELRGGQQ 191

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL--GKSLSIVQAIQHE 240
                 +AI H+VAA++P+L    VTV+D +G++L+ ++              V+  +  
Sbjct: 192 LERSQVDAIVHMVAASIPDLAPERVTVVDQSGRMLSVSDPNSEAAVNAAQFEQVRRQETS 251

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
               I + L    G       V  +++    +    +Y+ + +  RS ++S+    + T 
Sbjct: 252 FNQRIRELLEPMTGPGRVNPEVSVDMDFSVTEEARELYNGEPQKLRSEQMSE--NSTTTP 309

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
            P+       N P          ++   + K     NYE++     T     +++R+S+A
Sbjct: 310 GPQGVPGATSNSPPGQQAAPATAQAPTESSK-NATRNYELDRTLQHTRQPAGRIKRVSVA 368

Query: 361 VVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN 420
           V+V+        G+ A Q    + L  +  +V  A G N+ RGDT+++ +  F+ +    
Sbjct: 369 VLVDNVPRAGANGKVAPQPLSAAELTRVEALVKQAVGFNAERGDTVSVMNAPFVRDTTPV 428

Query: 421 SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL 480
            G                    L+  V  L + F  L    R          +       
Sbjct: 429 EGPAWWEL-----PWVHDAGRMLLGAVVVLALLFGVLRPALRAITGQKKNDEQALEPHTA 483

Query: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540
                       L+ +D + L +   D  S        +     ++        ++ + +
Sbjct: 484 DVQ---------LVDDDGMPLPALGADRASLGGPDALALPVDSYEERLRMAREAVKTDSK 534

Query: 541 RFAKILRKWARSE 553
           R A++++ W  ++
Sbjct: 535 RVAQVVKGWVAND 547


>gi|148253400|ref|YP_001237985.1| flagellar MS-ring protein [Bradyrhizobium sp. BTAi1]
 gi|146405573|gb|ABQ34079.1| Flagellar basal body M-ring protein [Bradyrhizobium sp. BTAi1]
          Length = 535

 Score =  367 bits (942), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 131/549 (23%), Positives = 229/549 (41%), Gaps = 21/549 (3%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           +         LG  R+  + +V    I  F      V +P    L+  L + D + I   
Sbjct: 1   MQGLLDFLKGLGAARLTAMIAVTAALIGFFGFVIMRVTAPQMTTLFTDLGMDDSSSIIKD 60

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L    I F I + GS I VP   V + R+ LA           GYE+FDK ++ G TSF+
Sbjct: 61  LERQGIPFEIRNEGSVILVPKDKVTRLRMKLAEG-GLPKGGGVGYEIFDKSDALGTTSFV 119

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           Q I  +RALEGE+ARTI++I  I AARVH+V+P+   F +    P+AS+++R        
Sbjct: 120 QNINHLRALEGELARTIRAIDRIQAARVHLVLPERPLFSRETPEPSASIVVRVRGALDAA 179

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNIN 246
              AIRHLVA+AV  L    V+++D  G+LL                    +  +   + 
Sbjct: 180 QIRAIRHLVASAVNGLKPQRVSIVDEAGQLLADGTQTDIDQQVGDERRNTFEKRMRKQVE 239

Query: 247 KALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAV 306
             +++ +G    R  + A+ + +        YDP+ +V RS +  ++  +S +S+    V
Sbjct: 240 DIVSSVVGAGRARVQLSADFDFNRITQTSDRYDPEGRVLRSSQTREE--QSASSESNGQV 297

Query: 307 TVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG 366
           TV   +P     +       + + K EE +NYEI+  +     +  ++ R+S+AV+V+  
Sbjct: 298 TVNNELPGNQQNQQQQQPPRDQSKKTEETNNYEISRTTKTEVTEAGRVNRISVAVLVDGA 357

Query: 367 RLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQV 426
                 G    + +    L  I  +V +A G + +RGD + + ++ F +           
Sbjct: 358 YSKNEKGELVYKERSKEELDRIAALVRSAIGFDQKRGDQVEVVNLKFADAPTVPQINEPS 417

Query: 427 SFMDILS---RHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPP 483
            F+ +L         VI   V ++  ++V F+ +  L +     D     +         
Sbjct: 418 GFLGMLQFTKDDVMYVIELAVMMLLGIVVVFMVVRPLVKKIIASDEVAAALKSAVPALT- 476

Query: 484 PISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFA 543
                         +    +      + +    +++   V  QS  R+  + + N    A
Sbjct: 477 --------------DETAQAQAHAQQTATLIDVAQVQGQVHAQSVHRVGELADRNPGEAA 522

Query: 544 KILRKWARS 552
            I+R+W   
Sbjct: 523 AIIRQWLAE 531


>gi|324005863|gb|EGB75082.1| flagellar M-ring protein FliF [Escherichia coli MS 57-2]
          Length = 552

 Score =  367 bits (942), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 237/577 (41%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAVQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+    ++   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  ++                     ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSEESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|323948358|gb|EGB44345.1| flagellar M-ring protein FliF [Escherichia coli H120]
          Length = 552

 Score =  367 bits (942), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 237/577 (41%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R+S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRVSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+    ++   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|312946531|gb|ADR27358.1| flagellar MS-ring protein [Escherichia coli O83:H1 str. NRG 857C]
          Length = 552

 Score =  367 bits (941), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 236/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAVQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+    ++   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGALP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAVKTVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|148266223|ref|YP_001232929.1| flagellar M-ring protein FliF [Geobacter uraniireducens Rf4]
 gi|146399723|gb|ABQ28356.1| flagellar M-ring protein FliF [Geobacter uraniireducens Rf4]
          Length = 525

 Score =  367 bits (941), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 124/560 (22%), Positives = 244/560 (43%), Gaps = 49/560 (8%)

Query: 3   ILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNR 62
           + +   +  +   +L   + LI+A V +  ++ F A     N   Y  L+  L   D   
Sbjct: 1   MQEGFKKLLEPFLTLPPAKRLIVAGVAVASLVAFAALIVVANKTDYRPLFANLTTEDAGE 60

Query: 63  ISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGL 122
           I   L +  + ++I+ +G +I VPS  V   R+ LA++GLP      G+E+FD+ N FG+
Sbjct: 61  IVKKLKDQKVPYQIAADGKAILVPSDKVYDLRLSLASEGLPQGGG-VGFEIFDRKN-FGM 118

Query: 123 TSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP 182
           T F+Q++   RAL+GE++RTI  ++G+  ARVH+ + +   F+      TASV+++  + 
Sbjct: 119 TEFVQKLNYQRALQGELSRTIAQLAGVEQARVHLAIAEKSLFKDNEKPTTASVVLKMKSN 178

Query: 183 --SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT---ANEMERNILGKSLSIVQAI 237
                   + + HLVA+++  +D  +VTVLDS GK+L+   A+++   +        +  
Sbjct: 179 HTLRENEVQGVVHLVASSIEGMDPENVTVLDSRGKMLSKVGASDLTSKMTSTMQETQRTY 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRS 297
           +  +E  +   L   +G     + V A  +    +  E  YDP+S   RS + S++    
Sbjct: 239 EKNLEDRLQTLLDKVVGTGKSVARVSATFDFKQVEKYEERYDPESAAVRSEQRSEEK-GG 297

Query: 298 ETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
            ++       V+ NM   +   V          K +E  NYE++  +         + ++
Sbjct: 298 ASTVAAGVPGVQSNMAKAAPAGVTSGGG----SKSDETLNYEVSRSTARIIEPVGSMNKV 353

Query: 358 SIAVVVNKGRLTE------VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSM 411
           S+A++V+   +           ++  Q +    L +I  +V +A G N+ RGD +T+ ++
Sbjct: 354 SVAILVDGKYVAPASAKEGATAKAKYQPRTPDELQKIEALVKSAVGFNAERGDQVTVANI 413

Query: 412 DFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKK 471
            F E     +      +   + +    ++  L+  +G   + FL +  L +         
Sbjct: 414 PFQETDDGGASDQDKWWNAPIMQ---ALLKNLLIALGFFALLFLVIRPLLKTLK------ 464

Query: 472 GEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRL 531
                       P  +A T   +P D+ A+  +            +++           L
Sbjct: 465 ------------PHKAASTFQPLPEDDAAMQLAEVHKQQLEMQSLNQLE----------L 502

Query: 532 LHMIEINEERFAKILRKWAR 551
           +  ++ +  + A+IL+ W  
Sbjct: 503 IEKVKQDPYQVAQILQNWLS 522


>gi|323186814|gb|EFZ72134.1| flagellar M-ring protein FliF [Escherichia coli RN587/1]
          Length = 552

 Score =  367 bits (941), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 128/577 (22%), Positives = 235/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+    ++   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDETQAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPTNQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEALTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++    +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGALP----FWQQQAFIDQLLAVGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAVKTVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|315296472|gb|EFU55769.1| flagellar M-ring protein FliF [Escherichia coli MS 16-3]
          Length = 552

 Score =  367 bits (941), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 128/577 (22%), Positives = 235/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ L  QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLTQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +  +
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 181 NPSVYK--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRTLDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEALTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGALP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAVKTVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|309795955|ref|ZP_07690368.1| flagellar M-ring protein FliF [Escherichia coli MS 145-7]
 gi|308120405|gb|EFO57667.1| flagellar M-ring protein FliF [Escherichia coli MS 145-7]
          Length = 552

 Score =  367 bits (941), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 236/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L +G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPLGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|307131589|ref|YP_003883605.1| flagellar M-ring protein fliF [Dickeya dadantii 3937]
 gi|306529118|gb|ADM99048.1| Flagellar M-ring protein fliF [Dickeya dadantii 3937]
          Length = 573

 Score =  366 bits (940), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 128/587 (21%), Positives = 229/587 (39%), Gaps = 66/587 (11%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
             F +    L     + L       I + +A   +   P Y  LY  L   D   I   L
Sbjct: 13  KSFGEILNRLRANPKIPLLIASAATIAIVVALSLWARGPDYRVLYTNLNERDGGSIVSEL 72

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
            + NI +R +++G++I +PS  V + R+ LA QGLP   +  G+EL D+   FG++ F +
Sbjct: 73  GKMNIPYRFTESGAAIMIPSDKVYETRLKLAQQGLPKGGA-VGFELLDQE-KFGISQFSE 130

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN--PSVY 185
           +I   RALEGE+ART++++  I  ARVH+ +P    F +    P+A+V +          
Sbjct: 131 QINYQRALEGELARTMETLGPIQNARVHLAIPKPSLFVREQKSPSAAVTVTLQPGRALDD 190

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQHEIEMN 244
               AI +LV+++V  L    VTV+D TGKLLT N+     +    L     ++   +  
Sbjct: 191 SQISAITYLVSSSVAGLPADKVTVVDQTGKLLTQNDSSGRDLNAAQLKYANEVESNYQRR 250

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE------ 298
           I   L   +G  N  + V A+++  +++  +  Y P+    ++   S+   +S+      
Sbjct: 251 IEAILTPVVGAGNVHAQVTAQIDFASREQTDEQYQPNQTPNQAAVRSQQNSQSDQRGGPN 310

Query: 299 --------TSQPESAVTVEQNMPH-----------------------VSDRKVPLPRSLE 327
                   ++ P  A T   + P                         +        +  
Sbjct: 311 VGGVPGALSNTPTPAPTAPISTPPANNANNANNANNANNANANTAGTNTQTSAGNAANQT 370

Query: 328 NTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAE 387
              + ++  NYE++     T  +   ++RLS+AVVVN        G+ A     D  L +
Sbjct: 371 YNSRHDQTINYEVDRTIRHTKQNTGNVQRLSVAVVVNY--TQGEDGKPA--ALNDDQLKK 426

Query: 388 INKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLV 447
           I  +V  + G ++ RGDT+ + +  F                      F  +     +L+
Sbjct: 427 IEALVRESMGFSNDRGDTLNVVNTPFTITDATGGELP----FWQKQAFFDLLTEVGRWLL 482

Query: 448 GTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQD 507
             ++   L    +R         +      + L        VT   M  +          
Sbjct: 483 VLIVGWILYRKLVRPQLQRRAQVQEAAEAAASLRGQDADVTVTLSTMEEE---------- 532

Query: 508 IFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                R  + R ++ +  Q   R+  + E +    A ++R W  +E+
Sbjct: 533 ---LQRKSEQRAHAEMHSQ---RVRELAENDPRVVALVIRHWMSNEL 573


>gi|83747628|ref|ZP_00944664.1| FliF [Ralstonia solanacearum UW551]
 gi|207739709|ref|YP_002258102.1| flagellar m-ring protein [Ralstonia solanacearum IPO1609]
 gi|83725680|gb|EAP72822.1| FliF [Ralstonia solanacearum UW551]
 gi|206593091|emb|CAQ59997.1| flagellar m-ring protein [Ralstonia solanacearum IPO1609]
          Length = 611

 Score =  366 bits (940), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 130/553 (23%), Positives = 235/553 (42%), Gaps = 47/553 (8%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  +  SD   I  AL + N+ +R +D GS+I VP + V +AR+ LAAQ
Sbjct: 66  LWSRAPDYRVLYSNVADSDGGAIIAALQQMNVPYRFADGGSAIMVPEANVHEARLKLAAQ 125

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP     +G+EL  +   FG + F +++   RALEGE+ARTIQ++  + +ARVH+ +  
Sbjct: 126 GLPKGGL-AGFELM-ENQKFGTSQFAEQVNYQRALEGELARTIQAMQEVQSARVHLALSK 183

Query: 161 MGSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +  A+P+ASV+++            +AI HLV+++VPNL + +VTV+D +G+LL+
Sbjct: 184 PSVFVREQAKPSASVLLKLYPGRMLDRSQVQAIGHLVSSSVPNLPLANVTVVDQSGRLLS 243

Query: 219 A--NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI 276
           +   +    +    L+ V+ I+      I   L   +G DN R+ V A++++D  +    
Sbjct: 244 SSFQDNASGLDPTQLNYVRDIEQGYIKRIEAILGPVVGEDNVRAQVTADVDLDNTEQMAE 303

Query: 277 VYDPDSKVERSIRLSKDAQRSETSQP---ESAVTVEQNMPHVSDRKVPL----------- 322
            Y P+      +  S     S  ++            N P  + R +P            
Sbjct: 304 TYRPNQDPANGVVRSTHTSESTQNKAGAQGGVPGALSNQPPTAPRMLPTAPAPASQQAAA 363

Query: 323 --------------------PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVV 362
                                 +   +  ++   NYE++     T      + RLS+AVV
Sbjct: 364 GQNGQNAPNGQQQAAATGQAATNNVESSARDTTVNYEVDKTVRRTRAAVGIVRRLSVAVV 423

Query: 363 VNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG 422
           VN             +   D+ + ++N +V  A G +++RGD++ + +  F      +  
Sbjct: 424 VNYRA-----DGKTWKPLSDADMVKLNALVKDAVGYDAKRGDSVNVVNSQFSGTLPTSRD 478

Query: 423 TVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGE--VGGKSIL 480
            + +     +  +           +G L++ F  +  L R  N  +       VG +   
Sbjct: 479 DLPLWKQPEMIHYAIQAAKYGALAIGFLILVFAVIRPLIRSMNKKEELATATFVGREGDD 538

Query: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540
              PI +       P       +S  D  +    L     ++  +Q    +  + + N  
Sbjct: 539 PNAPIITGAAAPAGPGLEGPSSASAADGDAVPEELPQLKQNHEFEQKLETMRRIAQQNPR 598

Query: 541 RFAKILRKWARSE 553
             A ++++W   E
Sbjct: 599 AVAAVIKQWVSIE 611


>gi|324013493|gb|EGB82712.1| flagellar M-ring protein FliF [Escherichia coli MS 60-1]
          Length = 552

 Score =  366 bits (940), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 128/577 (22%), Positives = 235/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  +   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNISDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVSAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPTNQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEALTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGALP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAVKTVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|218695543|ref|YP_002403210.1| flagellar MS-ring protein [Escherichia coli 55989]
 gi|218352275|emb|CAU98032.1| flagellar basal-body MS-ring and collar protein [Escherichia coli
           55989]
          Length = 552

 Score =  366 bits (940), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 128/577 (22%), Positives = 235/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVTGSAAVAVMVALILWAKTPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+     +   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNEGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEALTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  + + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREISDNDPRVVALVIRQWINNDHE 552


>gi|300923899|ref|ZP_07139914.1| flagellar M-ring protein FliF [Escherichia coli MS 182-1]
 gi|300419862|gb|EFK03173.1| flagellar M-ring protein FliF [Escherichia coli MS 182-1]
          Length = 552

 Score =  366 bits (940), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 129/577 (22%), Positives = 237/577 (41%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R+S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRVSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKEARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+    ++   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PVPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAMKAVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|292487992|ref|YP_003530869.1| flagellar M-ring protein FliF [Erwinia amylovora CFBP1430]
 gi|292899212|ref|YP_003538581.1| flagellar M-ring protein [Erwinia amylovora ATCC 49946]
 gi|291199060|emb|CBJ46171.1| flagellar M-ring protein [Erwinia amylovora ATCC 49946]
 gi|291553416|emb|CBA20461.1| Flagellar M-ring protein FliF [Erwinia amylovora CFBP1430]
 gi|312172117|emb|CBX80374.1| Flagellar M-ring protein FliF [Erwinia amylovora ATCC BAA-2158]
          Length = 573

 Score =  366 bits (939), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 129/550 (23%), Positives = 232/550 (42%), Gaps = 58/550 (10%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +   P Y  L+  L   D   I   L++ N+ ++  D G ++ VP++ V + R+ LA+Q
Sbjct: 46  LWAKQPDYRVLFSNLSNEDGGTIVTQLTQMNVPYKFDDRGGALLVPAAQVHELRLRLASQ 105

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL DK   FG++ F +++   RALEGE+ARTI ++  +  ARVH+ MP 
Sbjct: 106 GLPKGGA-VGFELLDKE-KFGISQFSEQVNYQRALEGELARTISTLGPVKDARVHLAMPK 163

Query: 161 MGSFRKIGARPTASVM--IRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV   ++           A+ H+V+++V  +  G+VTV+D +G+LLT
Sbjct: 164 PTLFVREQKSPSASVTLALQPGRALDEGQINAVVHMVSSSVAGMPPGNVTVVDQSGRLLT 223

Query: 219 ANEMERN-ILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIV 277
            N+     +    L     ++   +  I   L   LG  N  + V A+++ + ++  +  
Sbjct: 224 QNDPGGRDLNDTQLKYANDVETRYQQRIEAILGPILGNGNVHAQVTAQIDFNKREKTDEQ 283

Query: 278 YDPDSKVERSIRLSKDAQRS---ETSQPESAVTVEQNMPHVSDRKV-------------- 320
           Y P++  +R    S+    S                N P  ++                 
Sbjct: 284 YSPNTNPDRQAIRSRQTSNSEQLGGPSAGGVPGALSNQPAPANAAPVTTANPNANNANAA 343

Query: 321 ----------------PLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVN 364
                              +++ ++ + +  +NYE+N   + T  +  +++RLS+AVVVN
Sbjct: 344 NAANANNGQPANNAASGAQKTVPSSTRSDNTTNYEVNRTILHTKMNVGEVQRLSVAVVVN 403

Query: 365 KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTV 424
                            DS + +I  +   A G + +RGD++ + +  F +N    +   
Sbjct: 404 ----FRTDAAGKPIALKDSQIKQIENLTREAMGFSEQRGDSLNVVNSQFTDNSDLAAELP 459

Query: 425 QVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPP 484
                  + + F      LV +V  +L   L    LRR      A +   G     S   
Sbjct: 460 FWKQPAFIDQLFNAGRWLLVLIVAFILYRKLVSPQLRRKAEQQKAAEEAAGNALRSSTQD 519

Query: 485 ISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAK 544
              AV             S ++D  +  R  Q R+++ V  Q   R+  M E +    A 
Sbjct: 520 EGVAV-------------SLSKDELNQERKSQHRMSAEVLSQ---RIREMSENDPRVVAL 563

Query: 545 ILRKWARSEI 554
           ++R+W + E+
Sbjct: 564 VIRQWMKDEL 573


>gi|56413118|ref|YP_150193.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197362044|ref|YP_002141681.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|56127375|gb|AAV76881.1| flagellar basal-body M-ring protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197093521|emb|CAR58982.1| flagellar basal-body M-ring protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
          Length = 563

 Score =  366 bits (939), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 126/572 (22%), Positives = 227/572 (39%), Gaps = 52/572 (9%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +  +P Y  L+  L   D   I   L++ 
Sbjct: 17  LEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQM 76

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +R ++   +I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 77  NIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVN 134

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--SA 188
             RALEGE+ARTI+++  + +ARVH+ MP    F +    P+ASV +             
Sbjct: 135 YQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQI 194

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEIEMNINK 247
            A+ HLV++AV  L  G+VT++D +G LLT +    R++    L     ++  I+  I  
Sbjct: 195 SAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEA 254

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PES 304
            L+  +G  N  + V A+L+   ++  E  Y P+    ++   S+    SE      P  
Sbjct: 255 ILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGG 314

Query: 305 AVTVEQNMP---------------------HVSDRKVPLPRSLENTDKKEEQSNYEINTK 343
                 N P                       +        +     ++ E SNYE++  
Sbjct: 315 VPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNNAGPRNTQRNETSNYEVDRT 374

Query: 344 SIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRG 403
              T  +   +ERLS+AVVVN   L +              + +I  +   A G + +RG
Sbjct: 375 IRHTKMNVGDIERLSVAVVVNYKTLADGK----PLPLTADQMKQIEDLTREAMGFSDKRG 430

Query: 404 DTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL 463
           DT+ + +  F                         ++ A  +L+  ++   L   A+R  
Sbjct: 431 DTLNVVNSPFSAVDDTGGELP----FWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQ 486

Query: 464 HNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYV 523
                 +      ++ +                +       ++D     R    R+ + V
Sbjct: 487 LTRRVEEAKAAQEQAQVR------------QETEEAVEVRLSKDEQLQQRRANQRLGAEV 534

Query: 524 SKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
             Q   R+  M + +    A ++R+W  ++ E
Sbjct: 535 MSQ---RIREMSDNDPRVVALVIRQWMSNDHE 563


>gi|205357292|ref|ZP_02346550.2| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205322643|gb|EDZ10482.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 585

 Score =  366 bits (939), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 126/578 (21%), Positives = 227/578 (39%), Gaps = 58/578 (10%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +  +P Y  L+  L   D   I   L++ 
Sbjct: 33  LEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQM 92

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +R ++   +I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 93  NIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVN 150

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--SA 188
             RALEGE+ARTI+++  + +ARVH+ MP    F +    P+ASV +             
Sbjct: 151 YQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQI 210

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEIEMNINK 247
            A+ HLV++AV  L  G+VT++D +G LLT +    R++    L     ++  I+  I  
Sbjct: 211 SAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEA 270

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PES 304
            L+  +G  N  + V A+L+   ++  E  Y P+    ++   S+    SE      P  
Sbjct: 271 ILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGG 330

Query: 305 AVTVEQNMPHVSDRKVPLPRSLEN---------------------------TDKKEEQSN 337
                 N P   +                                      + ++ E SN
Sbjct: 331 VPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTSTSTSTNSNSAGPRSTQRNETSN 390

Query: 338 YEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATG 397
           YE++     T  +   +ERLS+AVVVN   L +              + +I  +   A G
Sbjct: 391 YEVDRTIRHTKMNVGDIERLSVAVVVNYKTLADGK----PLPLTADQMKQIEDLTREAMG 446

Query: 398 INSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGL 457
            + +RGDT+ + +  F                         ++ A  +L+  ++   L  
Sbjct: 447 FSDKRGDTLNVVNSPFSAVDDTGGELP----FWQQQSFIDQLLAAGRWLLVLVVAWILWR 502

Query: 458 HALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQS 517
            A+R        +      ++ +                +       ++D     R    
Sbjct: 503 KAVRPQLTRRVEEAKAAQEQAQVR------------QETEEAVEVRLSKDEQLQQRRANQ 550

Query: 518 RINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           R+ + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 551 RLGAEVMSQ---RIREMSDNDPRVVALVIRQWMSNDHE 585


>gi|310767344|gb|ADP12294.1| flagellar MS-ring protein [Erwinia sp. Ejp617]
          Length = 569

 Score =  366 bits (939), Expect = 6e-99,   Method: Composition-based stats.
 Identities = 122/546 (22%), Positives = 231/546 (42%), Gaps = 54/546 (9%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +   P Y  L+  L   D   I   L++ N+ ++  D G ++ VP++ V + R+ LA+Q
Sbjct: 46  LWAKQPDYRVLFSNLSNEDGGTIVTQLTQMNVPYKFDDQGGALLVPAAQVHELRLRLASQ 105

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL DK   FG++ F +++   RALEGE+ARTI ++  +  ARVH+ MP 
Sbjct: 106 GLPKGGA-VGFELLDKE-KFGISQFSEQVNYQRALEGELARTISTLGPVKDARVHLAMPK 163

Query: 161 MGSFRKIGARPTASVM--IRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV   ++           A+ H+V+++V  +  G+VTV+D  G+LLT
Sbjct: 164 PTLFVREQKSPSASVTLALQPGRALDEGQINAVVHMVSSSVAGMPPGNVTVVDQAGRLLT 223

Query: 219 ANEMERN-ILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIV 277
            N+     +    L     ++   +  I   L   LG  N  + V A+++ + ++  +  
Sbjct: 224 QNDSGGRDLNDTQLKYANDVETRYQQRIEAILGPILGNGNVHAQVTAQIDFNKREKTDEQ 283

Query: 278 YDPDSKVERSIRLSKDAQRS---ETSQPESAVTVEQNMPHVSDRKVPLP----------- 323
           Y P+S+ ++    S+    S     S          N P  ++     P           
Sbjct: 284 YSPNSQPDQQAIRSRQTSNSEQLGGSSAGGVPGALSNQPAPANAAPVTPANNNANNANAN 343

Query: 324 ---------------RSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRL 368
                          +++ +  + +  +NYE+N   + T  +  +++RLS+AVVVN    
Sbjct: 344 ANNGQPANNAANAAQKTVPSNTRSDNTTNYEVNRTILHTKMNVGEVQRLSVAVVVNYR-- 401

Query: 369 TEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSF 428
                        D+ + +I  +   A G + +RGD++ + +  F +N    +       
Sbjct: 402 --ADAAGKPIALKDAQIKQIENLTREAMGFSEQRGDSLNVVNSQFTDNSDLAAELP---- 455

Query: 429 MDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSA 488
                     + NA  +L+  ++   L    +         ++      +I +    +  
Sbjct: 456 FWKQPAFIDQLFNAGRWLLVLIVAFILYRKLVSPQLRRKAEQQKAAEEAAINAARSSTR- 514

Query: 489 VTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRK 548
                   D     S ++D  +  R  Q R+++ V  Q   R+  M E +    A ++R+
Sbjct: 515 --------DEGVAVSLSKDELNQERKSQHRMSAEVLSQ---RIREMSENDPRVVALVIRQ 563

Query: 549 WARSEI 554
           W + E+
Sbjct: 564 WMKDEL 569


>gi|259908758|ref|YP_002649114.1| flagellar MS-ring protein [Erwinia pyrifoliae Ep1/96]
 gi|224964380|emb|CAX55889.1| Flagellar basal-body M-ring protein [Erwinia pyrifoliae Ep1/96]
 gi|283478734|emb|CAY74650.1| Flagellar M-ring protein FliF [Erwinia pyrifoliae DSM 12163]
          Length = 569

 Score =  366 bits (938), Expect = 6e-99,   Method: Composition-based stats.
 Identities = 122/546 (22%), Positives = 231/546 (42%), Gaps = 54/546 (9%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +   P Y  L+  L   D   I   L++ N+ ++  D G ++ VP++ V + R+ LA+Q
Sbjct: 46  LWAKQPDYRVLFSNLSNEDGGTIVTQLTQMNVPYKFDDQGGALLVPAAQVHELRLRLASQ 105

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL DK   FG++ F +++   RALEGE+ARTI ++  +  ARVH+ MP 
Sbjct: 106 GLPKGGA-VGFELLDKE-KFGISQFSEQVNYQRALEGELARTISTLGPVKDARVHLAMPK 163

Query: 161 MGSFRKIGARPTASVM--IRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV   ++           A+ H+V+++V  +  G+VTV+D  G+LLT
Sbjct: 164 PTLFVREQKSPSASVTLALQPGRALDEGQINAVVHMVSSSVAGMPPGNVTVVDQAGRLLT 223

Query: 219 ANEMERN-ILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIV 277
            N+     +    L     ++   +  I   L   LG  N  + V A+++ + ++  +  
Sbjct: 224 QNDPGGRDLNDTQLKYANDVETRYQQRIEAILGPILGNGNVHAQVTAQIDFNKREKTDEQ 283

Query: 278 YDPDSKVERSIRLSKDAQRS---ETSQPESAVTVEQNMPHVSDRKVPLP----------- 323
           Y P+S+ ++    S+    S     S          N P  ++     P           
Sbjct: 284 YSPNSQPDQQAIRSRQTSNSEQLGGSSAGGVPGALSNQPAPANAAPVTPANNNANNANAN 343

Query: 324 ---------------RSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRL 368
                          +++ +  + +  +NYE+N   + T  +  +++RLS+AVVVN    
Sbjct: 344 ANNGQPANNAANAAQKTVPSNTRSDNTTNYEVNRTILHTKMNVGEVQRLSVAVVVNYR-- 401

Query: 369 TEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSF 428
                        D+ + +I  +   A G + +RGD++ + +  F +N    +       
Sbjct: 402 --ADAAGKPIALKDAQIKQIENLTREAMGFSEQRGDSLNVVNSQFTDNSDLAAELP---- 455

Query: 429 MDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSA 488
                     + NA  +L+  ++   L    +         ++      +I +    +  
Sbjct: 456 FWKQPAFIDQLFNAGRWLLVLIVAFILYRKLVSPQLRRKAEQQKATEEAAINAARSSTR- 514

Query: 489 VTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRK 548
                   D     S ++D  +  R  Q R+++ V  Q   R+  M E +    A ++R+
Sbjct: 515 --------DEGVAVSLSKDELNQERKSQHRMSAEVLSQ---RIREMSENDPRVVALVIRQ 563

Query: 549 WARSEI 554
           W + E+
Sbjct: 564 WMKDEL 569


>gi|299068777|emb|CBJ40017.1| FliF: Flagellar biosynthesis protein, M-ring protein, Belongs to
           the fliF family [Ralstonia solanacearum CMR15]
          Length = 611

 Score =  366 bits (938), Expect = 7e-99,   Method: Composition-based stats.
 Identities = 129/553 (23%), Positives = 232/553 (41%), Gaps = 47/553 (8%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  +  SD   I  AL + N+ +R +D GS+I VP + V +AR+ LAAQ
Sbjct: 66  LWSRAPDYRVLYSNVADSDGGAIIAALQQMNVPYRFADGGSAIMVPEANVHEARLKLAAQ 125

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP     +G+EL  +   FG + F++++   RALEGE+ARTIQ++  + +ARVH+ +  
Sbjct: 126 GLPKGGL-AGFELM-ENQKFGTSQFVEQVNYQRALEGELARTIQAMQEVQSARVHLALSK 183

Query: 161 MGSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +   +P+ASV+++            +AI HL+A++VP+L + +VTV+D +G+LL+
Sbjct: 184 PSVFVREQVKPSASVLLKLYPGRMLDRSQVQAIGHLLASSVPDLPLANVTVVDQSGRLLS 243

Query: 219 A--NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI 276
           A   +    +    L+ V+ I+      I   L   LG DN R+ V A++++D  +    
Sbjct: 244 AAFQDNASGLDPTQLNYVRDIEQGYIKRIEAILGPVLGDDNVRAQVTADVDLDNTEQMAE 303

Query: 277 VYDPDSKVERSIRLSKDAQRSETSQP---ESAVTVEQNMPHVSDRKVPL----------- 322
            Y P+         S     S  ++            N P  + R +P            
Sbjct: 304 TYRPNQDPANGAVRSTHTSESTQNKAGAQGGVPGALSNQPPTAPRMLPTAPAPAAQQAAA 363

Query: 323 ---------------------PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAV 361
                                  +   +  ++  +NYE++     T      + RLS+AV
Sbjct: 364 GQNGQNGQNGQQQGAAGTGQAAANSVESSARDITTNYEVDKTVRRTRAAVGTVRRLSVAV 423

Query: 362 VVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNS 421
           VVN             +   D+ + ++N +V  A G +++RGD++ + +  F      + 
Sbjct: 424 VVNYRA-----DGKTWKPLSDAEMTKLNALVKDAVGYDAKRGDSVNVVNSQFSGTLPTSK 478

Query: 422 GTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKK-GEVGGKSIL 480
             + +     +  +           +G L++ F  +  L R  N  D        G+   
Sbjct: 479 DDLPLWKQPEMIHYAIQAAKYGALAIGFLILVFAVIRPLIRSMNKKDEPATATFVGREGE 538

Query: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540
            P              +     S++ D       L     S   +Q    +  + + N  
Sbjct: 539 DPNAPIITGAAAPAGPELEGPSSASIDGDDIPEELPQLKQSRDFEQKLETMRRVAQQNPR 598

Query: 541 RFAKILRKWARSE 553
             A ++++W  +E
Sbjct: 599 AVAAVIKQWVSNE 611


>gi|254504967|ref|ZP_05117118.1| flagellar M-ring protein FliF [Labrenzia alexandrii DFL-11]
 gi|222441038|gb|EEE47717.1| flagellar M-ring protein FliF [Labrenzia alexandrii DFL-11]
          Length = 548

 Score =  366 bits (938), Expect = 7e-99,   Method: Composition-based stats.
 Identities = 207/555 (37%), Positives = 314/555 (56%), Gaps = 10/555 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M   +   + + +   LG  R++ LA + L  I    A  F+++ P    LY  L   DV
Sbjct: 1   MPGREHAEKLWANLMELGMRRLIALALIGLATIATVGAGAFYLSRPETTPLYTGLTGEDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           +RI  AL +A I F +S  G ++ V      KAR+ LA +GLP   +NSGYELFD + S 
Sbjct: 61  SRIGSALRDAGIPFDVSSEGDAVMVSHGQTAKARMLLAEKGLPR-GANSGYELFDDLGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGE+ARTIQ + GI AARVHIV+P+ GSFR+    P+ASV+IR+ 
Sbjct: 120 GLTSFMQEVTRVRALEGELARTIQLMKGIRAARVHIVLPEKGSFRRDQQPPSASVVIRSD 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLS-IVQAIQH 239
            P   ++A+AIRHLVAA VP ++   VTVLD+TG +L A +         ++ +  A+ +
Sbjct: 180 IPDDVRTADAIRHLVAAGVPGMEAAKVTVLDTTGGILAAGKDPTKASAGQMATLETAVSN 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
            I+ N+ K L  +LG+DNF+ +V A+LN D + I E ++DPDS++ERS+R  ++ + +E 
Sbjct: 240 RIQENVRKTLTPYLGLDNFQVSVAAKLNTDRKMIAETIFDPDSRIERSVRTIRENENAEN 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
           S   + VT EQN+P  +       RSLE T+++EE  NYEI++K I T+ D Y+++RLSI
Sbjct: 300 SSAATPVTAEQNLPDENVEADGGERSLEETERREETVNYEISSKRIETSQDGYRVDRLSI 359

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AV+V++ RL   LG S  Q +I+  + EI  +V+++ G+   RGD + I+ +DF++    
Sbjct: 360 AVLVDRTRLAASLGGSPTQSQIEEQVREIEALVASSAGVTEERGDLVKISVVDFVDGGRD 419

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
                 +   + L R    +INAL  L  ++LV + GL           + +     +  
Sbjct: 420 LEPIPPIGVTEYLLRQSGNIINALAILTVSMLVIWFGLRPAVAALVPQVSSEQAEMAEIG 479

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
           L P  +  A          +        +     +L   +NS  +K +  +L  ++E NE
Sbjct: 480 LLPEGLEDAADAMDGETGFL--------MPPDHSDLLHDLNSKRNKSALKKLESLLEFNE 531

Query: 540 ERFAKILRKWARSEI 554
           E+ A ILR+W     
Sbjct: 532 EQSAAILRQWLYDTE 546


>gi|296447983|ref|ZP_06889889.1| flagellar M-ring protein FliF [Methylosinus trichosporium OB3b]
 gi|296254493|gb|EFH01614.1| flagellar M-ring protein FliF [Methylosinus trichosporium OB3b]
          Length = 551

 Score =  366 bits (938), Expect = 7e-99,   Method: Composition-based stats.
 Identities = 193/553 (34%), Positives = 312/553 (56%), Gaps = 8/553 (1%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           +D+  Q   +   LG  ++  LA +  + + +     ++V+ P ++ LY  L+  DV+RI
Sbjct: 1   MDRFNQLRDNLIGLGPRKLSALALIFTLVLAITGLGAYYVSRPDFEVLYSGLDREDVSRI 60

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
              L  + + F I+  G+++ V      +AR+ LA +GLP S +N+GYELFDKV S GLT
Sbjct: 61  GAVLKSSGVAFDINPEGNAVLVRYGQTAQARMLLAERGLPQS-ANAGYELFDKVGSLGLT 119

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS 183
           SFMQE+TRVRALEGE+ARTIQ I G+ AARVHIV+PD GSFR++   P+ASV+IR  +P 
Sbjct: 120 SFMQEVTRVRALEGELARTIQLIRGVKAARVHIVLPDEGSFRRVRQPPSASVVIRTESPD 179

Query: 184 VYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN--ILGKSLSIVQAIQHEI 241
             K+A+AIRHLVAA++P + +  VTVL++ G LL+A++ +       K+L++ + +  +I
Sbjct: 180 DSKAAQAIRHLVAASIPGMTVDQVTVLNTDGMLLSASDGDATDAAPAKTLTLEKTVSKDI 239

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
           + NI + L  +L + NF+ +V A +N D +Q  E ++DP+S+VERS+R+ K+   S+ + 
Sbjct: 240 QDNIRRTLTPYLRLANFQVSVRARINTDRKQTNETIFDPESRVERSVRVVKENSTSQNNS 299

Query: 302 PESAVTVEQNMPHVSDRKVP-LPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
              A +VE+N+P    +      +S +   K EE +N+E++TK++ T    Y LE LSIA
Sbjct: 300 TSQAASVERNVPQEKPQAGGEGKQSNDENKKSEELTNFELSTKTVTTVSGGYTLENLSIA 359

Query: 361 VVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN 420
           V+VN+G L      +     ++  L EI ++V++A G+   RGDT+ ++++DF  N+   
Sbjct: 360 VLVNRGSLAGSGKDAPKPEALERQLKEIEQLVASAAGVRKDRGDTVKVSAVDFAINENDL 419

Query: 421 SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL 480
           +      + + L+    +VINA   ++ TLL+ F GL    R    +     E      +
Sbjct: 420 APVEPAGWSEALTHQLGSVINAGALILVTLLLVFFGLRPASRALLAEAPAPMETALADDV 479

Query: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540
            PP + +  +         A     Q        L   I          +L  +IE +E 
Sbjct: 480 GPPLLGAEPSI----ELPFAPMEMPQFTGQMDTGLIEDIGGREKFNQQKKLEQLIEADEM 535

Query: 541 RFAKILRKWARSE 553
           + A IL++W  +E
Sbjct: 536 QAAAILKQWMYAE 548


>gi|300717231|ref|YP_003742034.1| flagellar basal-body M-ring protein [Erwinia billingiae Eb661]
 gi|299063067|emb|CAX60187.1| Flagellar basal-body M-ring protein [Erwinia billingiae Eb661]
          Length = 576

 Score =  366 bits (938), Expect = 7e-99,   Method: Composition-based stats.
 Identities = 121/553 (21%), Positives = 221/553 (39%), Gaps = 57/553 (10%)

Query: 39  ARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLA 98
              +   P Y  LY  L   D   I   L++ NI ++  D G ++ VP+  V + R+ LA
Sbjct: 44  MALWAKQPEYRVLYNNLSDEDGGAIITQLTQMNIPYQFDDKGGALMVPAEKVHELRLRLA 103

Query: 99  AQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVM 158
            QGLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  +   RVH+ M
Sbjct: 104 QQGLPKGGA-VGFELLDQE-KFGISQFSEQVNYQRALEGELARTIETLGPVKNVRVHLAM 161

Query: 159 PDMGSFRKIGARPTASVMIRAIN--PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKL 216
           P    F +    PTASV +              AI H+V+++V  L  G+VTV+D  G L
Sbjct: 162 PKPSLFVREQKSPTASVTLTLQPGRALDQGQISAIVHMVSSSVAGLPPGNVTVVDQAGHL 221

Query: 217 LTANE-MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           LT ++   R++    L     +++  +  I   L   +G  N  + V A+++ + ++  +
Sbjct: 222 LTQSDNAGRDLNDAQLKYATDVENRFQSRIEAILNPIVGTGNVHAQVTAQIDFNAREQTD 281

Query: 276 IVYDPDSKVERSIRLSKDAQRS---ETSQPESAVTVEQNMPHVSDRKV------------ 320
             Y P+S        S+    S       P        N P  ++               
Sbjct: 282 EKYQPNSDPSTQAVRSRQTSDSEQIGGQYPGGVPGALSNQPAPANTAPVTTPAANNQNGQ 341

Query: 321 -------------------PLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAV 361
                                 ++  +  + +  +NYE++   + T  +  +++RLS+AV
Sbjct: 342 NGQNGQNGNAAAANQGSSASTAKAGPSNTRTDNTTNYEVDRTILHTKMNVGEVQRLSVAV 401

Query: 362 VVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNS 421
           VVN                 D+ L +I  +   A G + +RGD++ + +  F   +  + 
Sbjct: 402 VVNYK----ADAAGKPIALTDAQLKQIENLTREAMGYSDKRGDSLNVVNSPFTVTEDTSD 457

Query: 422 GTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILS 481
                            ++    +L+  ++   L    +R                   +
Sbjct: 458 DVP----FWKQPAFIDQMMELGRWLLVLIVAWILYRKLVRPQLRRKAE-------LEKAA 506

Query: 482 PPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEER 541
               + A        D+    S ++D     R  Q R+++ V  Q   R+  M E +   
Sbjct: 507 VEAAAVAKQAREESGDDAVAVSLSKDEQDQERKSQHRMSAEVMSQ---RIRDMSENDPRV 563

Query: 542 FAKILRKWARSEI 554
            A ++R+W + E+
Sbjct: 564 VALVIRQWMKDEL 576


>gi|209547913|ref|YP_002279830.1| flagellar MS-ring protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209533669|gb|ACI53604.1| flagellar M-ring protein FliF [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 563

 Score =  365 bits (937), Expect = 9e-99,   Method: Composition-based stats.
 Identities = 292/564 (51%), Positives = 395/564 (70%), Gaps = 10/564 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M +L+QL+Q FK+  SLGRTR++IL  V  V I + +AA  FVN P  + LYV L+  D+
Sbjct: 1   MNLLNQLVQIFKNFGSLGRTRLMILGGVGAVSIAIVLAAALFVNKPAQETLYVGLDSPDL 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           N+IS+AL+EAN+DF++  +G+SISVP+ M GKAR+ LA +GLP +S+N+GYELFD V S 
Sbjct: 61  NQISMALAEANVDFQVGTDGTSISVPAGMTGKARLLLAERGLP-NSANAGYELFDNVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQSISGI AARVHIVMP++G+FRK   +PTASVMIRA 
Sbjct: 120 GLTSFMQEVTRVRALEGEIARTIQSISGITAARVHIVMPEVGNFRKAEQKPTASVMIRAS 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL-GKSLSIVQAIQH 239
             +   +A +IRHLVA+AVP LD+ DVT+LDS G+LL + +   N    +SL+IVQ +Q 
Sbjct: 180 ATTGRSAATSIRHLVASAVPGLDVDDVTILDSAGQLLASGDEASNSSLNRSLNIVQNVQQ 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           E+E NI+KALA FLG+DNFRS+V A+LN D QQI+E  YDP+SKVERS+R +K+AQ+S+ 
Sbjct: 240 EVESNIDKALAPFLGMDNFRSSVTADLNTDAQQIQETTYDPESKVERSVRSTKEAQQSQQ 299

Query: 300 SQPESAVTVEQNMPHVSDRKVP--LPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
            Q +SA TVEQN+P  +        P S + +DK+EEQ+NYEIN+++ ATT ++YK+E+L
Sbjct: 300 KQSDSATTVEQNIPQAAPEAGGSAGPESQDKSDKREEQTNYEINSRTTATTRNSYKVEKL 359

Query: 358 SIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           SIAVVVNKGR+ +++G  ADQ KID+YLAE+ KIV++A+GI+++RGD +T+T+MDFLENQ
Sbjct: 360 SIAVVVNKGRIAKMVGEPADQAKIDAYLAEMQKIVASASGIDAKRGDVVTVTAMDFLENQ 419

Query: 418 LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA------KK 471
           L    T  V  MD+LSR+ A +IN+L F+    +V ++GL  L R  + + +        
Sbjct: 420 LLEDATGGVRVMDMLSRNLAGIINSLAFVAVAFVVVWMGLRPLVRSVSGNGSSSVLGDAT 479

Query: 472 GEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRL 531
            E  G  +    P + A    LM          + +      +     N  V +  + +L
Sbjct: 480 PEAAGLELPDFAPAAGASGGALMDGFGSDFGFDSTEDLLSLGDDDGNFNRRVKEGPERKL 539

Query: 532 LHMIEINEERFAKILRKWARSEIE 555
             M+EINEER AKILRKWA  E  
Sbjct: 540 SRMVEINEERAAKILRKWAIDEAA 563


>gi|238912458|ref|ZP_04656295.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
          Length = 560

 Score =  365 bits (937), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 126/572 (22%), Positives = 228/572 (39%), Gaps = 52/572 (9%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +  +P Y  L+  L   D   I   L++ 
Sbjct: 14  LEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQM 73

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +R ++   +I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 74  NIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVN 131

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--SA 188
             RALEGE+ARTI+++  + +ARVH+ MP    F +    P+ASV +             
Sbjct: 132 YQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQI 191

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEIEMNINK 247
            A+ HLV++AV  L  G+VT++D +G LLT +    R++    L     ++  I+  I  
Sbjct: 192 SAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEA 251

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PES 304
            L+  +G  N  + V A+L+   ++  E  Y P+    ++   S+    SE      P  
Sbjct: 252 ILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGG 311

Query: 305 AVTVEQNMP---------------------HVSDRKVPLPRSLENTDKKEEQSNYEINTK 343
                 N P                       +        +   + ++ E SNYE++  
Sbjct: 312 VPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNNAGPRSTQRNETSNYEVDRT 371

Query: 344 SIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRG 403
              T  +   +ERLS+AVVVN   L +              + +I  +   A G + +RG
Sbjct: 372 IRHTKMNVGDIERLSVAVVVNYKTLADGK----PLPLTADQMKQIEDLTREAMGFSDKRG 427

Query: 404 DTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL 463
           DT+ + +  F                         ++ A  +L+  ++   L   A+R  
Sbjct: 428 DTLNVVNSPFSAVDDTGGELP----FWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQ 483

Query: 464 HNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYV 523
                 +      ++ +                +       ++D     R    R+ + V
Sbjct: 484 LTRRVEEAKAAQEQAQVR------------QETEEAVEVRLSKDEQLQQRRANQRLGAEV 531

Query: 524 SKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
             Q   R+  M + +    A ++R+W  ++ E
Sbjct: 532 MSQ---RIREMSDNDPRVVALVIRQWMSNDHE 560


>gi|207856518|ref|YP_002243169.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|206708321|emb|CAR32624.1| flagellar basal-body M-ring protein [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
          Length = 560

 Score =  365 bits (936), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 126/572 (22%), Positives = 227/572 (39%), Gaps = 52/572 (9%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +  +P Y  L+  L   D   I   L++ 
Sbjct: 14  LEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQM 73

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +R ++   +I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 74  NIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVN 131

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--SA 188
             RALEGE+ARTI+++  + +ARVH+ MP    F +    P+ASV +             
Sbjct: 132 YQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQI 191

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEIEMNINK 247
            A+ HLV++AV  L  G+VT++D +G LLT +    R++    L     ++  I+  I  
Sbjct: 192 SAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEA 251

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PES 304
            L+  +G  N  + V A+L+   ++  E  Y P+    ++   S+    SE      P  
Sbjct: 252 ILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGG 311

Query: 305 AVTVEQNMP---------------------HVSDRKVPLPRSLENTDKKEEQSNYEINTK 343
                 N P                       +        +     ++ E SNYE++  
Sbjct: 312 VPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNSAGPRNTQRNETSNYEVDRT 371

Query: 344 SIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRG 403
              T  +   +ERLS+AVVVN   L +              + +I  +   A G + +RG
Sbjct: 372 IRHTKMNVGDIERLSVAVVVNYKTLADGK----PLPLTADQMKQIEDLTREAMGFSDKRG 427

Query: 404 DTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL 463
           DT+ + +  F                         ++ A  +L+  ++   L   A+R  
Sbjct: 428 DTLNVVNSPFSAVDNTGGELP----FWQQQFFIDQLLAAGRWLLVLVVAWILWRKAVRPQ 483

Query: 464 HNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYV 523
                 +      ++ +                +       ++D     R    R+ + V
Sbjct: 484 LTRRVEEAKAAQEQAQVR------------QETEEAVEVRLSKDEQLQQRRANQRLGAEV 531

Query: 524 SKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
             Q   R+  M + +    A ++R+W  ++ E
Sbjct: 532 MSQ---RIREMSDNDPRVVALVIRQWMSNDHE 560


>gi|17548611|ref|NP_521951.1| flagellar M-ring transmembrane protein [Ralstonia solanacearum
           GMI1000]
 gi|17430859|emb|CAD17541.1| probable flagellar m-ring transmembrane protein [Ralstonia
           solanacearum GMI1000]
          Length = 611

 Score =  365 bits (936), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 125/554 (22%), Positives = 225/554 (40%), Gaps = 47/554 (8%)

Query: 40  RFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAA 99
             +  +P Y  LY  +  SD   I  AL + N+ +R +D GS+I VP + V +AR+ LAA
Sbjct: 65  MLWSRAPSYRVLYSNVADSDGGAIIAALQQMNVPYRFADGGSAIMVPEANVHEARLKLAA 124

Query: 100 QGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMP 159
           QGLP     +G+EL  +   FG + F++++   RALEGE+ARTIQ++  + +ARVH+ + 
Sbjct: 125 QGLPKGGL-AGFELM-ENQKFGTSQFVEQVNYQRALEGELARTIQAMQEVQSARVHLALS 182

Query: 160 DMGSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
               F +   +P+ASV+++            +AI HL+A++VP+L + +VTV+D +G+LL
Sbjct: 183 KPSVFVREQVKPSASVLLKLYPGRMLDRSQVQAIGHLLASSVPDLPLANVTVVDQSGRLL 242

Query: 218 TA--NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           +A   +    +    L+ V+ I+      I   L   +G DN R+ V A +++D  +   
Sbjct: 243 SASFQDNASGLDPTQLNYVRDIEQGYIKRIEAILGPVVGEDNVRAQVTANVDLDNTEQMA 302

Query: 276 IVYDPDSKVERSIRLSKDAQRSETSQPE---SAVTVEQNMPHVSDRK------------- 319
             Y P+         S     S  ++            N P  + R              
Sbjct: 303 ETYRPNQDPANGAVRSTHTSESTQNKAGAQGGVPGALSNQPPTAPRMLPTAPAPAAQQAA 362

Query: 320 --------------------VPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
                                    +   +  ++   NYE++     T      + RLS+
Sbjct: 363 AGQNGQNGQNGQQQGAAAGTGQAAANTAESSARDTTINYEVDKTVRRTRAAVGTVRRLSV 422

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AVVVN             +   D+ + ++N +V  A G +++RGD++ + +  F      
Sbjct: 423 AVVVNYRA-----DGKTWKPLSDAEMTKLNALVKDAVGYDAKRGDSVNVVNSQFSGTLPT 477

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
           +   + +     +  +           +G L++ F  +  L R  N  D           
Sbjct: 478 SKDDLPLWKQPEMIHYAIQAAKYGALAIGFLILVFAVIRPLIRSMNKKDEPVTATFVGRE 537

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
              P               +   S   D       L     ++  +Q    +  + + N 
Sbjct: 538 GEDPNAPIITGAAAPAGPELEGPSVVTDGDEVPDELPQLKQNHDFEQKLETMRRVAQQNP 597

Query: 540 ERFAKILRKWARSE 553
              A ++++W  +E
Sbjct: 598 RAVAAVIKQWVSNE 611


>gi|227355980|ref|ZP_03840372.1| flagellar M-ring protein [Proteus mirabilis ATCC 29906]
 gi|227163968|gb|EEI48870.1| flagellar M-ring protein [Proteus mirabilis ATCC 29906]
          Length = 573

 Score =  365 bits (936), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 131/587 (22%), Positives = 245/587 (41%), Gaps = 56/587 (9%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
            +++Q   F      +     + L       I +F+AA  ++ SP Y  LY  L   D  
Sbjct: 7   DVVNQKKGFNAIINRIKADPKIPLIIAGSAAIAIFVAAFLWLQSPDYKVLYSNLSDKDGG 66

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
            I   L++ N+ +R+S NGS+I VP + V + R+ LA  GLP   + +G+EL DK   FG
Sbjct: 67  EIVTQLTQMNVPYRLSQNGSAIMVPDNQVHELRLKLAQAGLPKGGA-AGFELLDKE-KFG 124

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA-- 179
           ++ F ++I   RALEGE+ARTI+++  +  ARVH+ +P    F +    P+ASV +    
Sbjct: 125 ISQFSEQINYQRALEGELARTIETLGPVQNARVHLALPKPSLFVREQKSPSASVTVGLLQ 184

Query: 180 INPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM-ERNILGKSLSIVQAIQ 238
                     AI H+VA++V  +   +VT++D +GKLLT  +   R++    L  VQ ++
Sbjct: 185 GRALDEGQINAIVHIVASSVAGMPDSNVTIVDQSGKLLTQPDALGRDLNSIQLKYVQELE 244

Query: 239 HEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE 298
              +  I   L   +G  N  + V A+++    +     Y P+    ++   SK   +SE
Sbjct: 245 SRYQQRIETLLGPIVGRGNVHAQVTAQVDFSHTEETAEEYKPNQPPNQAAVRSKQVSQSE 304

Query: 299 TSQ---PESAVTVEQNMPHVSDRKV--------------------PLPRSLENTDKKEEQ 335
            +             N P    +                       + R+  +  + +E 
Sbjct: 305 QNGGMLAGGVPGALSNQPVAPPQAPIEKAKDTAADEKATSTNANRSMTRNPNSNSRLDET 364

Query: 336 SNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLG---------RSADQGKIDSYLA 386
           +NYE++ +          +ERLS+AV+VN   + +             +      D  L 
Sbjct: 365 TNYEVDRRIRHVKRPVGNIERLSVAVIVNYKTVEDKKKATEGEEPIVENKQVPLTDEQLQ 424

Query: 387 EINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFL 446
           +I  +V  A G +  RGD++++ +  F + +             IL++     ++   +L
Sbjct: 425 QIESLVREAMGYSQERGDSLSVVNSQFNDTEEPVISVPMWENPQILAK----ALDLGRWL 480

Query: 447 VGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQ 506
           +  ++   L    ++         +       + +   ++  V    +  +         
Sbjct: 481 LLVIIAWILWRKLVKPQLEKRREAEVAAQKAILKTKLEVTDDVNEAELDEE--------- 531

Query: 507 DIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
              S  +  + R+++ +  Q   R+  M E +    A ++R+W   E
Sbjct: 532 ---SRRKQARQRVSAELQSQ---RIREMAEKDPRVVAMVIRQWMSKE 572


>gi|197285489|ref|YP_002151361.1| flagellar MS-ring protein [Proteus mirabilis HI4320]
 gi|194682976|emb|CAR43401.1| flagellar M-ring protein [Proteus mirabilis HI4320]
          Length = 573

 Score =  365 bits (935), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 131/587 (22%), Positives = 245/587 (41%), Gaps = 56/587 (9%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
            +++Q   F      +     + L       I +F+AA  ++ SP Y  LY  L   D  
Sbjct: 7   DVVNQKKGFNAIINRIKADPKIPLIIAGSAAIAIFVAAFLWLQSPDYKVLYSNLSDKDGG 66

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
            I   L++ N+ +R+S NGS+I VP + V + R+ LA  GLP   + +G+EL DK   FG
Sbjct: 67  EIVTQLTQMNVPYRLSQNGSAIMVPDNQVHELRLKLAQAGLPKGGA-AGFELLDKE-KFG 124

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA-- 179
           ++ F ++I   RALEGE+ARTI+++  +  ARVH+ +P    F +    P+ASV +    
Sbjct: 125 ISQFSEQINYQRALEGELARTIETLGPVQNARVHLALPKPSLFVREQKSPSASVTVGLLQ 184

Query: 180 INPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM-ERNILGKSLSIVQAIQ 238
                     AI H+VA++V  +   +VT++D +GKLLT  +   R++    L  VQ ++
Sbjct: 185 GRALDEGQINAIVHIVASSVAGMPDSNVTIVDQSGKLLTQPDALGRDLNSIQLKYVQELE 244

Query: 239 HEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE 298
              +  I   L   +G  N  + V A+++    +     Y P+    ++   SK   +SE
Sbjct: 245 SRYQQRIETLLGPIVGRGNVHAQVTAQVDFSHTEETAEEYKPNQPPNQAAVRSKQVSQSE 304

Query: 299 TSQ---PESAVTVEQNMPHVSDRKV--------------------PLPRSLENTDKKEEQ 335
            +             N P    +                       + R+  +  + +E 
Sbjct: 305 QNGGMLAGGVPGALSNQPVAPPQAPIEKAKDTTADEKTTSTNANRSMTRNPNSNSRLDET 364

Query: 336 SNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLG---------RSADQGKIDSYLA 386
           +NYE++ +          +ERLS+AV+VN   + +             +      D  L 
Sbjct: 365 TNYEVDRRIRHVKRPVGNIERLSVAVIVNYKTVEDKKKATEGEEPIVENKQVPLTDEQLQ 424

Query: 387 EINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFL 446
           +I  +V  A G +  RGD++++ +  F + +             IL++     ++   +L
Sbjct: 425 QIESLVREAMGYSQERGDSLSVVNSQFNDTEEPVISVPVWENPQILAK----ALDLGRWL 480

Query: 447 VGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQ 506
           +  ++   L    ++         +       + +   ++  V    +  +         
Sbjct: 481 LLVIIAWILWRKLVKPQLEKRREAEVAAQKAILKTKLEVTDDVNEAELDEE--------- 531

Query: 507 DIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
              S  +  + R+++ +  Q   R+  M E +    A ++R+W   E
Sbjct: 532 ---SRRKQARQRVSAELQSQ---RIREMAEKDPRVVAMVIRQWMSKE 572


>gi|299131954|ref|ZP_07025149.1| flagellar M-ring protein FliF [Afipia sp. 1NLS2]
 gi|298592091|gb|EFI52291.1| flagellar M-ring protein FliF [Afipia sp. 1NLS2]
          Length = 517

 Score =  365 bits (935), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 119/533 (22%), Positives = 217/533 (40%), Gaps = 24/533 (4%)

Query: 25  LASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSIS 84
           + +V +  +  F      V +P    LY  L   D + +   L    I + + ++G+ I 
Sbjct: 1   MLAVTMALLGFFGFVILRVTAPQMVTLYTDLSYDDASGVMKELDRQGIPYELKNDGAIIM 60

Query: 85  VPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQ 144
           VP   V + R+ LA           GYE+FDK ++ G TSF+Q +  +RALEGE+ARTI+
Sbjct: 61  VPKDKVTRLRMKLAEG-GLPKGGGVGYEIFDKSDTLGSTSFVQNVNHLRALEGELARTIK 119

Query: 145 SISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDM 204
           SI  I A RVH+V+PD   F +    P+A++++R       +   AIRHLVA++V  L  
Sbjct: 120 SIDRIQAVRVHLVLPDRPLFSREKPEPSAAIVVRVRGALEPQQVRAIRHLVASSVNGLKP 179

Query: 205 GDVTVLDSTGKLLTA--NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAV 262
             V+++D  G+LL     +        +     A ++ +   I   + + +G    R  +
Sbjct: 180 QRVSIVDENGQLLADGSGDANGMGDVGADERRIAYENRLRKQIESIVTSVVGAGRARVQL 239

Query: 263 VAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPL 322
            A+ + +        +DP+ +V RS +  +++  +   Q         N    + ++   
Sbjct: 240 SADFDYNKVTETSDKFDPEGRVLRSSQTREESSATSNGQNGQV--TVNNEMPGNQQQNAA 297

Query: 323 PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKID 382
               + + K EE +NYEI+  +     +  +++R+S+AV+V+        G      +  
Sbjct: 298 NAGKDQSKKSEEINNYEISRTTKTEVTEAGRVQRVSVAVLVDGTYSKNEKGDMVYAPRSK 357

Query: 383 SYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSF---MDILSRHFATV 439
             L  I  +V +A G    RGD + + ++ F E            +              
Sbjct: 358 EDLERIATLVRSAIGFEKNRGDQVDVVNLRFAEAPAAVPLPEPTGWLSVFQFTKDDVMYF 417

Query: 440 INALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNI 499
           I   V  +  ++V F+ +  L +    +D     V       P                 
Sbjct: 418 IELGVMSLLAIVVVFMVVRPLVKRVLAEDPPPASVPALPEAEPA---------------- 461

Query: 500 ALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARS 552
           A+        +      +++   V  QS  R+  + + N      I+R+W   
Sbjct: 462 AVAGPVHTAATAQMIDVAQVQGQVHAQSVHRVGELADRNPNETVSIIRQWLTE 514


>gi|78047554|ref|YP_363729.1| flagellar MS-ring protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|78035984|emb|CAJ23675.1| flagellar biosynthesis lipoprotein FliF [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 574

 Score =  365 bits (935), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 116/568 (20%), Positives = 232/568 (40%), Gaps = 28/568 (4%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           ++  Q+F    SL  TR L + ++I + +   +A  F+   P Y +LY  L+       +
Sbjct: 15  EKAGQWFDRVRSLQITRKLTMMAMIALAVAAGLAVFFWSQKPGYQSLYTGLDEKGNAEAA 74

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L  A I ++I     +ISVP   +  AR+ LA  GL    +  G+EL +K   FG++ 
Sbjct: 75  DLLRTAQIPYKIDQATGAISVPQDRLYDARLKLAGSGLTGKETGGGFELMEKDPGFGVSQ 134

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INP 182
           F++      ALE E++RTI ++  +  ARVH+ +P   +F +     +ASV++       
Sbjct: 135 FVENARYQHALETELSRTIGTLRPVREARVHLAIPKPSAFTRQRDVASASVVLELRGGQG 194

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL--GKSLSIVQAIQHE 240
                 +AI +LVA+++P++    VTV+D +G++L+  +   +          V+  +  
Sbjct: 195 LERNQVDAIVNLVASSIPDMTPERVTVVDQSGRMLSIADPNSDAAQHAAQFEQVRRQESS 254

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
               I + L    G          +++    +    +Y+ +    RS ++S     +  +
Sbjct: 255 YNQRIRELLEPMTGPGRVNPETSVDMDFSVVEEARELYNGEPAKLRSEQVS--DTSTSAT 312

Query: 301 QPESAVTVEQNMPHV--------------SDRKVPLPRSLENTDKKEEQSNYEINTKSIA 346
            P+       N P                +        +      K    NYE++     
Sbjct: 313 GPQGPPGATSNSPGQPPAPAVAGAPGTPAAANGQAAAPATPTESSKSATRNYELDRTLQH 372

Query: 347 TTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTI 406
           T     +++R+S+AV+++        G+  +Q    + L  I  +V  A G ++ RGDT+
Sbjct: 373 TRQPAGRIKRVSVAVLLDNVPRPGAKGKMVEQPLTAAELTRIEGLVKQAVGFDAARGDTV 432

Query: 407 TITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNI 466
           ++ +  F+   +      +      +       +  LV  V  L + F  +    R    
Sbjct: 433 SVMNAPFVREAVAGEEGPKWWEDPRVQN----GLRLLVGAVVVLALLFGVVRPTLRQLTG 488

Query: 467 DDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQ 526
             A K + G       P         ++  D+  +    +D     ++ ++ I    + +
Sbjct: 489 VTAVKDKQGKAGKDGTPQS---ADVRMVDEDDDLMPRLEEDTAQIGQDKKTPIALPDAYE 545

Query: 527 SDLRL-LHMIEINEERFAKILRKWARSE 553
             +RL    ++ + +R A++++ W  SE
Sbjct: 546 ERMRLAREAVKADSKRVAQVVKGWVASE 573


>gi|90104474|gb|ABD86511.1| flagellar M-ring protein FliF [Rhodopseudomonas palustris BisB18]
          Length = 547

 Score =  365 bits (935), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 130/551 (23%), Positives = 230/551 (41%), Gaps = 19/551 (3%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           +         LG  R++ + +V    I  F      V +P    L+  L V D + I   
Sbjct: 9   VQGLVSFLKGLGAARLMAMIAVTAALIGFFAFVIMRVTTPQMTTLFTDLSVEDSSGIIKD 68

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L    I F I + GS I VP   V + R+ LA           GYE+FDK ++ G TSF+
Sbjct: 69  LERQAIPFEIRNEGSVIMVPKDKVTRLRMKLAEG-GLPKGGGVGYEIFDKSDALGSTSFV 127

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           Q I  +RALEGE+ARTI++I  I AARVH+V+P+   F +    P+AS+++R       +
Sbjct: 128 QNINHLRALEGELARTIRAIDRIQAARVHLVLPERPLFSRETPEPSASIVLRVRGALEPQ 187

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKS--LSIVQAIQHEIEMN 244
              AIRH+VA+AV  L    V+++D  G+LL            +         +  +   
Sbjct: 188 QVRAIRHVVASAVNGLKPQRVSIVDEAGQLLADGAAGDPASDGATGDERRAGFEKRMRNQ 247

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPES 304
           +   +++ +G    R  + A+ + +        +DP+ +V RS +  +++ ++  +    
Sbjct: 248 VEAIVSSVVGSGRARVQLTADFDYNKVTQTSDKFDPEGRVLRSSQSREESSQTAAANDGQ 307

Query: 305 AVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVN 364
                 N    +        + + + K EE +NYEI+  +     +  ++ R+S+AV+V+
Sbjct: 308 V--TVNNELPGAQAGAGAAVARDQSKKSEETNNYEISRVTKTEITEAGRVNRISVAVLVD 365

Query: 365 KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTV 424
                   G    Q +    L  I  +V +A G + +RGD + + ++ F E         
Sbjct: 366 GIYGKNDKGEMVYQERSKDQLDRIAALVRSAIGFDQKRGDQVEVVNLRFAEAPSVPPVAE 425

Query: 425 Q---VSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILS 481
               +  +         VI   V ++  L+V F+ +  L R     +       G   L+
Sbjct: 426 PGGLLGMVQFTKDDVMYVIELAVMMLLGLVVMFMVIRPLVRRILAAEPGAAGANGVPALT 485

Query: 482 PPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEER 541
               ++           I  D         +    +++   V  QS  R+  + + N   
Sbjct: 486 DASGTA-----------IGPDGLPLVAPGPNMIDIAQVQGQVHAQSVHRVGELADRNPNE 534

Query: 542 FAKILRKWARS 552
            A I+R+W + 
Sbjct: 535 TAAIVRQWLQE 545


>gi|289666081|ref|ZP_06487662.1| flagellar MS-ring protein [Xanthomonas campestris pv. vasculorum
           NCPPB702]
          Length = 574

 Score =  365 bits (935), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 115/568 (20%), Positives = 232/568 (40%), Gaps = 28/568 (4%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           ++  Q+F    SL  TR L + ++I + +   +A  F+   P Y +LY  L+       +
Sbjct: 15  EKAGQWFDRVRSLQITRKLTMMAMIALAVAAGLAVFFWSQKPGYQSLYTGLDEKGNAEAA 74

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L  A I ++I     +ISVP   +  AR+ LA  GL    +  G+EL +K   FG++ 
Sbjct: 75  DLLRTAQIPYKIDQGTGAISVPQDRLYDARLKLAGSGLTGKETGGGFELMEKDPGFGVSQ 134

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INP 182
           F++      ALE E++RTI ++  +  ARVH+ +P   +F +     +ASV++       
Sbjct: 135 FVENARYQHALETELSRTISTLRPVREARVHLAIPKPSAFTRQRDVASASVVLELRGGQG 194

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL--GKSLSIVQAIQHE 240
                 +AI +LVA+++P++    VTV+D +G++L+  +   +          V+  +  
Sbjct: 195 LERNQVDAIVNLVASSIPDMTPERVTVVDQSGRMLSIADPNSDAAQHAAQFEQVRRQESS 254

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
               I + L    G          +++    +    +Y+ +    RS ++  +   +  +
Sbjct: 255 YNQRIRELLEPMTGPGRVNPETSVDMDFSVVEEARELYNGEPAKLRSEQV--NDTSTTAT 312

Query: 301 QPESAVTVEQN--------------MPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIA 346
            P+       N                  +        +      K    NYE++     
Sbjct: 313 GPQGPPGATSNSPGQPPAPAAAGAPGTPAAANGQATAAAAPTESSKSATRNYELDRTLQH 372

Query: 347 TTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTI 406
           T     +++R+S+AV+++        G+  +Q    + L  I  +V  A G ++ RGDT+
Sbjct: 373 TRQPAGRIKRVSVAVLLDNVPRPGAKGKMVEQPLTAAELTRIEGLVKQAVGFDAARGDTV 432

Query: 407 TITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNI 466
           ++ +  F+   +      +      +       +  LV  V  L + F  +    R    
Sbjct: 433 SVMNAPFVREAVAGEEGPKWWEDPRVQN----GLRLLVGAVVVLALLFGVVRPTLRQLTG 488

Query: 467 DDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQ 526
             A K + G       P         ++  D+  L    +D  S  ++ ++ I    + +
Sbjct: 489 VTAVKDKQGKAGKDGTPQS---ADVRMVDEDDELLPHMGEDTASIGQDRKTPIALPDAYE 545

Query: 527 SDLRL-LHMIEINEERFAKILRKWARSE 553
             +R+    ++ + +R A++++ W  SE
Sbjct: 546 ERMRVAREAVKADSKRVAQVVKGWVASE 573


>gi|16765307|ref|NP_460922.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|120326|sp|P15928|FLIF_SALTY RecName: Full=Flagellar M-ring protein
 gi|154023|gb|AAA27096.1| fliF flagellar M-protein precursor [Salmonella enterica subsp.
           enterica serovar Typhimurium]
 gi|16420504|gb|AAL20881.1| basal-body MS (membrane and supramembrane)-ring and collar protein
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|261247135|emb|CBG24958.1| flagellar basal-body M-ring protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267993958|gb|ACY88843.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301158483|emb|CBW17993.1| flagellar basal-body M-ring protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312912959|dbj|BAJ36933.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|332988858|gb|AEF07841.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 560

 Score =  365 bits (935), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 126/572 (22%), Positives = 228/572 (39%), Gaps = 52/572 (9%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +  +P Y  L+  L   D   I   L++ 
Sbjct: 14  LEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQM 73

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +R ++   +I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 74  NIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVN 131

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--SA 188
             RALEGE+ARTI+++  + +ARVH+ MP    F +    P+ASV +             
Sbjct: 132 YQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQI 191

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEIEMNINK 247
            A+ HLV++AV  L  G+VT++D +G LLT +    R++    L     ++  I+  I  
Sbjct: 192 SAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEA 251

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PES 304
            L+  +G  N  + V A+L+   ++  E  Y P+    ++   S+    SE      P  
Sbjct: 252 ILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGG 311

Query: 305 AVTVEQNMP---------------------HVSDRKVPLPRSLENTDKKEEQSNYEINTK 343
                 N P                       +        +   + ++ E SNYE++  
Sbjct: 312 VPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNSAGPRSTQRNETSNYEVDRT 371

Query: 344 SIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRG 403
              T  +   +ERLS+AVVVN   L +              + +I  +   A G + +RG
Sbjct: 372 IRHTKMNVGDIERLSVAVVVNYKTLADGK----PLPLTADQMKQIEDLTREAMGFSDKRG 427

Query: 404 DTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL 463
           DT+ + +  F                         ++ A  +L+  ++   L   A+R  
Sbjct: 428 DTLNVVNSPFSAVDNTGGELP----FWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQ 483

Query: 464 HNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYV 523
                 +      ++ +                +       ++D     R    R+ + V
Sbjct: 484 LTRRVEEAKAAQEQAQVR------------QETEEAVEVRLSKDEQLQQRRANQRLGAEV 531

Query: 524 SKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
             Q   R+  M + +    A ++R+W  ++ E
Sbjct: 532 MSQ---RIREMSDNDPRVVALVIRQWMSNDHE 560


>gi|21242698|ref|NP_642280.1| flagellar MS-ring protein [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21108171|gb|AAM36816.1| flagellar protein [Xanthomonas axonopodis pv. citri str. 306]
          Length = 574

 Score =  365 bits (935), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 116/568 (20%), Positives = 233/568 (41%), Gaps = 28/568 (4%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           ++  Q+F    SL  TR L + ++I + +   +A  F+   P Y +LY  L+       +
Sbjct: 15  EKAGQWFDRVRSLQITRKLTMMAMIALAVAAGLAVFFWSQKPGYQSLYTGLDEKGNAEAA 74

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L  A I ++I     +ISVP   +  AR+ LA  GL    +  G+EL +K   FG++ 
Sbjct: 75  DLLRTAQIPYKIDQGTGAISVPQDRLYDARLKLAGSGLTGKETGGGFELMEKDPGFGVSQ 134

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INP 182
           F++      ALE E++RTI ++  +  ARVH+ +P   +F +     +ASV++       
Sbjct: 135 FVENARYQHALETELSRTIGTLRPVREARVHLAIPKPSAFTRQRDVASASVVLELRGGQG 194

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL--GKSLSIVQAIQHE 240
                 +AI +LVA+++P++    VTV+D +G++L+  +   +          V+  +  
Sbjct: 195 LERNQVDAIVNLVASSIPDMTPERVTVVDQSGRMLSIADPNSDAAQHAAQFEQVRRQESS 254

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
               I + L    G          +++    +    +Y+ +    RS ++S     +  +
Sbjct: 255 YNQRIRELLEPMTGPGRVNPETSVDMDFSVVEEARELYNGEPAKLRSEQVS--DTSTSAT 312

Query: 301 QPESAVTVEQNMPHV--------------SDRKVPLPRSLENTDKKEEQSNYEINTKSIA 346
            P+       N P                +        +      K    NYE++     
Sbjct: 313 GPQGPPGATSNSPGQPPAPAVAGAPGTPAAANGQAAAPATPTESSKSATRNYELDRTLQH 372

Query: 347 TTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTI 406
           T     +++R+S+AV+++        G+  +Q    + L  I  +V  A G ++ RGDT+
Sbjct: 373 TRQPAGRIKRVSVAVLLDNVPRPGAKGKMVEQPLTAAELTRIEGLVKQAVGFDAARGDTV 432

Query: 407 TITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNI 466
           ++ +  F+   +      +      +       +  LV  V  L + F  +    R    
Sbjct: 433 SVMNAPFVREAVAGEEGPKWWEDPRVQN----GLRLLVGAVVVLALLFGVVRPTLRQLTG 488

Query: 467 DDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQ 526
             A K + G       P         ++ +D+  +    +D     ++ ++ I    + +
Sbjct: 489 VTAVKDKQGKAGKDGTPQS---ADVRMVDDDDDLMPRLEEDTAQIGQDKKTPIALPDAYE 545

Query: 527 SDLRL-LHMIEINEERFAKILRKWARSE 553
             +RL    ++ + +R A++++ W  SE
Sbjct: 546 ERMRLAREAVKADSKRVAQVVKGWVASE 573


>gi|224583532|ref|YP_002637330.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|224468059|gb|ACN45889.1| flagellar M-ring protein [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 560

 Score =  364 bits (934), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 126/572 (22%), Positives = 227/572 (39%), Gaps = 52/572 (9%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +  +P Y  L+  L   D   I   L++ 
Sbjct: 14  LEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQM 73

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +R ++   +I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 74  NIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVN 131

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--SA 188
             RALEGE+ARTI+++  + +ARVH+ MP    F +    P+ASV +             
Sbjct: 132 YQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQI 191

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEIEMNINK 247
            A+ HLV++AV  L  G+VT++D +G LLT +    R++    L     ++  I+  I  
Sbjct: 192 SAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEA 251

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PES 304
            L+  +G  N  + V A+L+   ++  E  Y P+    ++   S+    SE      P  
Sbjct: 252 ILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGG 311

Query: 305 AVTVEQNMP---------------------HVSDRKVPLPRSLENTDKKEEQSNYEINTK 343
                 N P                       +        +     ++ E SNYE++  
Sbjct: 312 VPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNSAGPRNTQRNETSNYEVDRT 371

Query: 344 SIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRG 403
              T  +   +ERLS+AVVVN   L +              + +I  +   A G + +RG
Sbjct: 372 IRHTKMNVGDIERLSVAVVVNYKTLADGK----PLPLTADQMKQIEDLTREAMGFSDKRG 427

Query: 404 DTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL 463
           DT+ + +  F                         ++ A  +L+  ++   L   A+R  
Sbjct: 428 DTLNVVNSPFSAVDNTGGELP----FWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQ 483

Query: 464 HNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYV 523
                 +      ++ +                +       ++D     R    R+ + V
Sbjct: 484 LTRRVEEAKAAQEQAQVR------------QETEEAVEVRLSKDEQLQQRRANQRLGAEV 531

Query: 524 SKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
             Q   R+  M + +    A ++R+W  ++ E
Sbjct: 532 MSQ---RIREMSDNDPRVVALVIRQWMSNDHE 560


>gi|86356297|ref|YP_468189.1| flagellar MS-ring protein [Rhizobium etli CFN 42]
 gi|86280399|gb|ABC89462.1| flagellar M-ring protein [Rhizobium etli CFN 42]
          Length = 563

 Score =  364 bits (934), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 290/564 (51%), Positives = 396/564 (70%), Gaps = 10/564 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M +L+QL+Q FK+  +LGRTR++IL  V  V I + +AA  FVN P  + LYV L+  D+
Sbjct: 1   MNLLNQLVQIFKNFGALGRTRLMILGGVGSVSIAIILAAALFVNKPAQETLYVGLDAPDL 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           N+IS+AL+EANI+F++  +GSSI+VP+ M GKAR+ LA +GLP +S+N+GYELFD V S 
Sbjct: 61  NQISMALAEANINFQVGTDGSSITVPAGMTGKARLMLAERGLP-NSANAGYELFDNVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQSISGI AARVHIVMP++G+FRK   +PTASVMIRA 
Sbjct: 120 GLTSFMQEVTRVRALEGEIARTIQSISGITAARVHIVMPEVGNFRKAEQKPTASVMIRAS 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL-GKSLSIVQAIQH 239
             +   +A +IRHLVA+AVP LD+ DVT+LDS G+LL + +   N    +SL+IVQ +Q 
Sbjct: 180 AATGRSAATSIRHLVASAVPGLDVDDVTILDSAGQLLASGDEASNSSLNRSLNIVQNVQQ 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           E+E NI+KALA FLG+DNFRS+V A+LN D QQI+E VYDP+SKVERS+R +K+AQ+S+ 
Sbjct: 240 EVESNIDKALAPFLGMDNFRSSVTADLNTDAQQIQETVYDPESKVERSVRSTKEAQQSQQ 299

Query: 300 SQPESAVTVEQNMPHVSDRKV--PLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
            Q ++A TVEQN+P  +        P S + +DK+EEQ+NYEIN+K+ ATT ++Y++E+L
Sbjct: 300 RQSDNATTVEQNIPQAAPDAGGSGGPESQDKSDKREEQTNYEINSKTTATTRNSYQVEKL 359

Query: 358 SIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           SIAVVVNKGR+ +++G  ADQ KID+YLAE++KIV++A GI+++RGD +T+T+MDFLENQ
Sbjct: 360 SIAVVVNKGRIAKMVGEPADQAKIDAYLAEMHKIVASAAGIDAKRGDVVTVTAMDFLENQ 419

Query: 418 LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA------KK 471
           L    T  V  MD+LSR+ A +IN+L F+    +V ++GL  L R  + + +        
Sbjct: 420 LLEDATGGVRVMDMLSRNLAGIINSLAFVAVAFVVVWMGLRPLVRSVSGNGSSSVLGDAT 479

Query: 472 GEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRL 531
            E  G  +    P + A    LM          + +      +     N  V +  + +L
Sbjct: 480 PEAAGLELPDFAPAAGAAGGALMDGFGSDFGFDSTEDLLSLGDDDGNFNRRVKEGPERKL 539

Query: 532 LHMIEINEERFAKILRKWARSEIE 555
             M+EINEER AKILRKWA  +  
Sbjct: 540 ARMVEINEERAAKILRKWAIDDAA 563


>gi|29141395|ref|NP_804737.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213646788|ref|ZP_03376841.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|29137022|gb|AAO68586.1| flagellar basal-body M-ring protein [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
          Length = 560

 Score =  364 bits (934), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 125/572 (21%), Positives = 226/572 (39%), Gaps = 52/572 (9%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +  +P Y  L+  L   D   I   L++ 
Sbjct: 14  LEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQM 73

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +R ++   +I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 74  NIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVN 131

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--SA 188
             RALEGE+ARTI+++  + +ARVH+ MP    F +    P+ASV +             
Sbjct: 132 YQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQI 191

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEIEMNINK 247
            A+ HLV++AV  L  G+VT++D +G LLT +    R++    L     ++  I+  I  
Sbjct: 192 SAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEA 251

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PES 304
            L+  +G  N  + V A+L+   ++  E  Y P+    ++   S+    SE      P  
Sbjct: 252 ILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGG 311

Query: 305 AVTVEQNMP---------------------HVSDRKVPLPRSLENTDKKEEQSNYEINTK 343
                 N P                       +        +     ++ E SNYE++  
Sbjct: 312 VPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNNAGPRNTQRNETSNYEVDRT 371

Query: 344 SIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRG 403
              T  +   +ERLS+AVVVN   L +              + +I  +   A G + +RG
Sbjct: 372 IRHTKMNVGDIERLSVAVVVNYKTLADGK----PLPLTADQMKQIEDLTREAMGFSDKRG 427

Query: 404 DTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL 463
           DT+ + +  F                         ++ A  +L+  ++   L   A+   
Sbjct: 428 DTLNVVNSPFSAVDNTGGELP----FWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVHPQ 483

Query: 464 HNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYV 523
                 +      ++ +                +       ++D     R    R+ + V
Sbjct: 484 LTRRVEEAKAAQEQAQVR------------QETEEAVEVRLSKDEQLQQRRANQRLGAEV 531

Query: 524 SKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
             Q   R+  M + +    A ++R+W  ++ E
Sbjct: 532 MSQ---RIREMSDNDPRVVALVIRQWMSNDHE 560


>gi|291085209|ref|ZP_06352408.2| flagellar M-ring protein FliF [Citrobacter youngae ATCC 29220]
 gi|291072341|gb|EFE10450.1| flagellar M-ring protein FliF [Citrobacter youngae ATCC 29220]
          Length = 557

 Score =  364 bits (934), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 122/569 (21%), Positives = 228/569 (40%), Gaps = 49/569 (8%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +  +P Y  L+  L   D   I   L++ 
Sbjct: 14  LEWLNRLRANPRIPLIVAGAAAVAIVVAMVLWAKAPDYRTLFSNLSDQDGGAIVTQLTQM 73

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           N+ +R ++   +I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 74  NVPYRFTEGSGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVN 131

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVM--IRAINPSVYKSA 188
             RALEGE+ARTI+++  +  ARVH+ +P    F +    P+ASV   +           
Sbjct: 132 YQRALEGELARTIETLGPVKRARVHLALPKPSLFVREQKAPSASVTVNLEPGRALDEGQI 191

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQHEIEMNINK 247
            A+ HLV++AV  L  G+VT++D  G LLT +      +    L     ++  I+  I  
Sbjct: 192 SAVTHLVSSAVAGLPPGNVTLVDQAGHLLTQSNTSSRDLNDAQLKYASDVEGRIQRRIES 251

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRS---ETSQPES 304
            L+  +G  N  + V A+L+   ++  E  Y P+    +++  S+    S    +  P  
Sbjct: 252 ILSPIVGNGNVHAQVTAQLDFANKEQTEEQYRPNGDDSQAVLRSRQLNVSEQIGSGAPGG 311

Query: 305 AVTVEQNMPHVSDRKV------------------PLPRSLENTDKKEEQSNYEINTKSIA 346
                 N P  ++                         +   + ++ E SNYE++     
Sbjct: 312 VPGALSNQPAPANTAPIATPPANQQNAQTTQTTNNSSNAGPRSTQRNETSNYEVDRTIRH 371

Query: 347 TTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTI 406
           T  +   ++RLS+AVVVN   L +              + +I  +   A G + +RGDT+
Sbjct: 372 TKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLTAEQMKQIEDLTREAMGFSDKRGDTL 427

Query: 407 TITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNI 466
            + +  F                         +++A  +L+  L+   L   A+R     
Sbjct: 428 NVVNSPFTATDDSMGELPLW----KQPFFIDQLMSAGRWLLVLLVAWILWRKAVRPQLLR 483

Query: 467 DDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQ 526
              +      ++ +                +       ++D  +  R    R+ + V  Q
Sbjct: 484 RSEEAKAAQEQTRIR------------QETEEAVEVRLSKDEQTQQRRTNQRLGAEVMSQ 531

Query: 527 SDLRLLHMIEINEERFAKILRKWARSEIE 555
              R+  M + +    A ++R+W  ++ E
Sbjct: 532 ---RIREMSDNDPRVVALVIRQWMSNDHE 557


>gi|78224304|ref|YP_386051.1| flagellar FliF M-ring protein [Geobacter metallireducens GS-15]
 gi|78195559|gb|ABB33326.1| Flagellar FliF M-ring protein [Geobacter metallireducens GS-15]
          Length = 527

 Score =  364 bits (933), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 122/562 (21%), Positives = 235/562 (41%), Gaps = 48/562 (8%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           + L +  +   +L   +  I+  V+ V I+ F       N   Y  L+  L   D   I 
Sbjct: 3   EGLKKLLEPFMALPPAKRWIVGGVVGVSIIAFALLIMVANRTDYRPLFTNLTTEDAGEIV 62

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L E  + +RI+ +G +I VPS  V   R+ +A+ GLP      G+E+FD+ N FG+T 
Sbjct: 63  TKLKEQKVPYRIAADGKAILVPSDKVYDLRLTMASAGLPQGGG-VGFEIFDRKN-FGMTE 120

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN--P 182
           F+Q++   RAL+GE++RTI  I+G+  ARVH+ +P+   F++     TASV+++      
Sbjct: 121 FVQKLNYQRALQGELSRTIGQIAGVEQARVHLAIPEKALFKEDEKPATASVVLKVKGNRQ 180

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTAN---EMERNILGKSLSIVQAIQH 239
                 + + HLVA+++  ++   VTVLD  GKLL+ N   +    +      + +  + 
Sbjct: 181 LNDSDVQGVVHLVASSIEGMNPEHVTVLDQKGKLLSKNGPTDAAGKMTASMQEVQRTYER 240

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
             E  +   L   +G     + V A  +    +  E  YDP++ V RS + S+++     
Sbjct: 241 GTEERLQSLLDKAVGSGKSVARVSAVFDFRQVERYEEKYDPET-VVRSEQRSEESMGGAN 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
           +        + N+            +  N  K +E  NYE++  +  T      L ++S+
Sbjct: 300 ATA-GVPGAQTNLGRTPA--GAGGATGPNGSKNDETLNYEVSRSTARTIEPVGALSKVSV 356

Query: 360 AVVVNKGRLTEVLGR------SADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           A++V+       +G+           +  + L +I  +V  A G N+ RGD +T+ ++ F
Sbjct: 357 AILVDGKYDAPAVGKDGKNAKPKYTPRSPAELQQIEALVKGAVGFNAVRGDQVTVANIPF 416

Query: 414 LENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGE 473
            +     +      +   +   F +++   +   G L +    +  L ++   +     E
Sbjct: 417 QDTAEAGTDEGSQWWNAPI---FLSLLKNGLIGFGFLALLLFVVRPLMKMLKPEKKTSFE 473

Query: 474 VGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLH 533
               +  +   I+                               R          + L++
Sbjct: 474 PISTAEETINQIAE----------------------------VHRAQIQNQTIRQVELMN 505

Query: 534 MIEINEERFAKILRKWARSEIE 555
            ++    + A+IL+ W R++ +
Sbjct: 506 KVKEEPYQAAQILQNWLRAKEQ 527


>gi|304398855|ref|ZP_07380725.1| flagellar M-ring protein FliF [Pantoea sp. aB]
 gi|304353559|gb|EFM17936.1| flagellar M-ring protein FliF [Pantoea sp. aB]
          Length = 575

 Score =  364 bits (933), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 137/586 (23%), Positives = 231/586 (39%), Gaps = 57/586 (9%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
            +   F      L     + L       I + +A   +   P Y  LY  L   D   I 
Sbjct: 11  QEKKGFGDLLARLRANPRIPLVIAAAAVIAIVIAMVLWAKQPSYSVLYNNLTDEDGGAIV 70

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L++ NI +R ++NG ++ VP + V + R+ LA QGLP   S  G+EL DK   FG++ 
Sbjct: 71  TQLTQMNIPYRFAENGGALMVPEANVHELRLRLAQQGLPKGGS-VGFELLDKE-KFGISQ 128

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV 184
           F +++   RALEGE+ARTI+S+  + +ARVH+ MP    F +    P+ASV +       
Sbjct: 129 FSEQVNYQRALEGELARTIESLGPVKSARVHLAMPKPTLFVREQKAPSASVTLTLQPGRA 188

Query: 185 YK--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQHEI 241
                 +AI H+V+++V  L  G+VTV+D TG+LLT ++     +    L     ++   
Sbjct: 189 LDEGQIQAIAHMVSSSVAGLPPGNVTVVDQTGRLLTRSDSAGRDLNDAQLKYSSEVEARY 248

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
           +  I   L   LG  N  + V A++N DT +  +  Y P++    S   S+    S+ S 
Sbjct: 249 QQRIEAILNPILGQGNVHAQVTAQINFDTAEQTDEKYQPNANPSNSAIRSRQTSTSDQSG 308

Query: 302 ---PESAVTVEQNMPHV------------------------------SDRKVPLPRSLEN 328
              P        N P                                         S   
Sbjct: 309 SPYPGGVPGALSNQPAPANTAPVTTPNNNAANGQAANGQNNAANNASQTTSTAPASSGPT 368

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEI 388
             ++++  NYE++     T  +   ++RLS+AVVVN         +       +  L +I
Sbjct: 369 NSRRDDTVNYELDRTIRHTKVNVGDVQRLSVAVVVN----FRADDKGKAVALNEQQLKQI 424

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
             +   A G +  RGD+I + +  F   +   +              F  +++A  +L+ 
Sbjct: 425 EDLTREAMGYSQSRGDSINVVNSQFNTTEPVTTDLP----FWQQQSFFDQLMDAGKWLLV 480

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
            L+   L    +R       A +                       P +       ++D 
Sbjct: 481 ALVAFVLYRKMVRPHLVRKQAAEKAAAEAVAARAATD--------QPQEEAFNVQLSKDE 532

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
               R   +R+++ V  Q   R+  M E +    A ++R+W   E+
Sbjct: 533 LDQERKSNNRMSAEVMSQ---RIRDMSENDPRVVALVIREWMSKEL 575


>gi|327394264|dbj|BAK11686.1| flagellar M-ring protein FliF [Pantoea ananatis AJ13355]
          Length = 572

 Score =  363 bits (932), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 129/548 (23%), Positives = 226/548 (41%), Gaps = 56/548 (10%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P+Y  L+  L   D   I   L++ N+ +R +DNG ++ VP   V + R+ LA Q
Sbjct: 47  LWAKTPNYSVLFSNLSNEDGGAIVTQLTQMNVPYRFADNGGALMVPEDKVHELRLRLAEQ 106

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP    N G+EL DK   FG++ F +++   RALEGE+ARTI+S+  +  ARVH+ MP 
Sbjct: 107 GLPK-GGNVGFELLDKE-KFGISQFSEQVNYQRALEGELARTIESLGPVKTARVHLAMPK 164

Query: 161 MGSFRKIGARPTASVMIRAINPSVYK--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV +             +AI H+V+++V  L  G+VTV+D +G LLT
Sbjct: 165 PTLFVREQKAPSASVTLTLQPGRALDEGQIQAITHMVSSSVAGLPPGNVTVVDQSGHLLT 224

Query: 219 ANEM-ERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIV 277
            ++   R++    L     ++   +  I   L   LG  N  + V A++N DT +  +  
Sbjct: 225 RSDAVGRDLNDAQLKYAAEVEARYQQRIEAILNPILGQGNVHAQVTAQINFDTSEQTDEK 284

Query: 278 YDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVSDRKVPLPRSL-------- 326
           Y P+   + +   S+    SE S    P        N P  ++       +         
Sbjct: 285 YQPNGDPKNASIRSQQTSTSEQSGSPYPGGVPGALSNQPAPANTAPVNAPNTNAANGQNA 344

Query: 327 --------------------ENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG 366
                                   ++++  NYE++     T  +   ++RLS+AVVVN  
Sbjct: 345 NGQNNAANGQRTSTASASSVPTNSRRDDTVNYELDRTIRHTKMNVGDVQRLSVAVVVNYR 404

Query: 367 RLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQV 426
                  +       +  L +I  +   A G + +RGD++ + +  F   +   S     
Sbjct: 405 ----EDDKGKALALNEQQLKQIEDLTREAMGYSQQRGDSVNVVNSQFNTTEPTVSELP-- 458

Query: 427 SFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPIS 486
                    F  +I+A  +L+  L+   L    +R         +              +
Sbjct: 459 --FWQQQSFFDQLISAGKWLLVALVAFILYRKTVRPHVLRKKEAEKAAAEAMAARAAQQN 516

Query: 487 SAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKIL 546
                    +        ++D     R   +R+++ V  Q   R+  M E +    A ++
Sbjct: 517 ---------DQEAYSVQLSKDEMEQERKTNNRMSAEVMSQ---RIRDMSENDPRVVALVI 564

Query: 547 RKWARSEI 554
           R+W  +E+
Sbjct: 565 REWMGNEL 572


>gi|309779486|ref|ZP_07674247.1| flagellar M-ring protein FliF [Ralstonia sp. 5_7_47FAA]
 gi|308921727|gb|EFP67363.1| flagellar M-ring protein FliF [Ralstonia sp. 5_7_47FAA]
          Length = 610

 Score =  363 bits (932), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 124/569 (21%), Positives = 241/569 (42%), Gaps = 45/569 (7%)

Query: 22  ILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGS 81
            L++       + +  AA  +  +P Y  LY  +  SD   I  AL + N+ +R ++ G+
Sbjct: 50  RLLMMIGGAALVAVIAAAMLWSRAPDYRVLYSNVSDSDGGAIIAALQQMNVPYRFAEGGT 109

Query: 82  SISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIAR 141
           +I VP + V +AR+ LA+QGLP     +G+EL  +   FG + F +++   RALEGE+AR
Sbjct: 110 AIMVPEASVHEARLKLASQGLPK-GGQAGFELM-ENQKFGTSQFTEQVNYQRALEGELAR 167

Query: 142 TIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAV 199
           TIQ++  + +ARVH+ M     F +  A+P+ASV+++            +AI HLV+++V
Sbjct: 168 TIQAMQEVQSARVHLAMTKPSVFVREQAKPSASVLLKLYPGRMLDRSQVQAIGHLVSSSV 227

Query: 200 PNLDMGDVTVLDSTGKLLTA--NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDN 257
           PNL + +VTV+D +G+LL++   +    +    LS V+ ++      I   L   +G DN
Sbjct: 228 PNLPLANVTVVDQSGRLLSSSFQDNASGLDPTQLSYVRDVEQGYIKRIEAILGPVVGEDN 287

Query: 258 FRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQP---ESAVTVEQNMPH 314
            R+ V A++++D  +     Y P+     +   S     +  ++            N P 
Sbjct: 288 VRAQVTADVDLDNTEQMAESYRPNQDPANAAVRSTHTAEATQNKADAQGGVPGALSNQPP 347

Query: 315 VSDRKVPL------------------------------PRSLENTDKKEEQSNYEINTKS 344
            + R +P                                 S  ++  ++  +NYE++   
Sbjct: 348 TAPRMLPTAPAPASASQPAATGPNGQPQQVAAANTGGTAASGNSSSTRDTTTNYEVDKTV 407

Query: 345 IATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGD 404
             T      + RLS+AVVVN             +   ++ + ++N +V  A G +++RGD
Sbjct: 408 RRTRAAVGTVRRLSVAVVVNYR-----GDGKTWKPLSEAEMVKLNALVKDAVGFDAKRGD 462

Query: 405 TITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLH 464
           ++ + +  F      +   + +     + ++       L   +G L++ F  +    R  
Sbjct: 463 SVNVVNSQFSGTLPMSKDDLPLWKQPDMIQYAIQAAKYLALAIGFLILVFAVIRPAIRSM 522

Query: 465 NIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVS 524
              DA             P               +   ++  D      +   ++ +   
Sbjct: 523 GEKDAPATPTFVGREGEDPNAPIITGAAASAGPELEGPAAGAD-SEELPDALPQLKNNDF 581

Query: 525 KQSDLRLLHMIEINEERFAKILRKWARSE 553
           ++    +  + + N    A ++++W  +E
Sbjct: 582 EKKLETMRRVAQSNPRAVAAVIKQWVSNE 610


>gi|322833196|ref|YP_004213223.1| flagellar M-ring protein FliF [Rahnella sp. Y9602]
 gi|321168397|gb|ADW74096.1| flagellar M-ring protein FliF [Rahnella sp. Y9602]
          Length = 569

 Score =  363 bits (932), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 118/547 (21%), Positives = 225/547 (41%), Gaps = 55/547 (10%)

Query: 39  ARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLA 98
              +   P Y  L+  L   D   I   L++ NI ++ SDNG ++ +P+  V + R+ LA
Sbjct: 44  MMLWAKQPTYKVLFSNLGDQDGGAIVTQLTQMNIPYQFSDNGGALLIPADKVYETRLKLA 103

Query: 99  AQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVM 158
           A GLP   +  G+EL D+   FG++ F ++I   RALEGE++RTI+++  + +ARVH+ +
Sbjct: 104 AAGLPKGGA-VGFELMDQE-KFGISQFSEQINYQRALEGELSRTIETLGPVSSARVHLAI 161

Query: 159 PDMGSFRKIGARPTASVM--IRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKL 216
           P    F +    P+ASV   ++           AI ++V+++V  L   +VTV+D +G L
Sbjct: 162 PKPSLFVREQKNPSASVTLNLQPGRALDDGQINAIVYMVSSSVSGLPPANVTVVDQSGHL 221

Query: 217 LTANEMERN-ILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           LT ++     +    L     ++  ++  I   L   +G  N  + + A+++  +++  +
Sbjct: 222 LTQSDNNGRDLNASQLKYANEVEGRLQRRIESILQPVVGNGNVHAQITAQIDYASREQTD 281

Query: 276 IVYDPDSKVERSIRLSKDAQRSETSQP---ESAVTVEQNMPHVSDRKVPLPRSL------ 326
             Y P+   +++   S+    S+               N P  +                
Sbjct: 282 ENYQPNGSADKAAVRSRQLSTSDQIGASSVGGVPGALSNQPAPAATAPVTNPPAANNANG 341

Query: 327 --------------------ENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG 366
                                +  +++E +NYE++     T H    ++RLS AVVVN  
Sbjct: 342 TQNQTGNNAQNAATTANANVPSNRRRDETTNYEVDRTITHTQHSAGAVQRLSAAVVVNYQ 401

Query: 367 RLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQV 426
              +   +       D  L +I+ +V  A G +  RGDT+ + +  F E    +      
Sbjct: 402 VGPDGKAK----PLTDDQLKKIDDLVREAMGFSQERGDTLNVVNTPFNEAADDSGELP-- 455

Query: 427 SFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPIS 486
                    F  ++NA  +L+  ++   L    +R +     A+K      ++ +  P  
Sbjct: 456 --FWKQQAFFDQLLNAGRWLLVLIVAWLLWRKMVRPMLRKQQAEKDAAAAAALAATMPQP 513

Query: 487 SAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKIL 546
                  + ND +     +Q   S              +    R+  + + +    A ++
Sbjct: 514 EGSKPVKLSNDELEKRKRSQQRVS-------------VEVQTQRVQELADKDPRIVALVI 560

Query: 547 RKWARSE 553
           R+W  +E
Sbjct: 561 RQWMSTE 567


>gi|222033677|emb|CAP76418.1| flagellar M-ring protein [Escherichia coli LF82]
          Length = 552

 Score =  363 bits (932), Expect = 3e-98,   Method: Composition-based stats.
 Identities = 128/577 (22%), Positives = 235/577 (40%), Gaps = 47/577 (8%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAVQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D    LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGLHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+    ++   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGD++ + +  F  +                      ++ A  +L+  L+   L   
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGALP----FWQQQAFIDQLLAAGRWLLVLLVAWLLWRK 470

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R            V  ++                  ++      ++D     R    R
Sbjct: 471 AVRPQLTRRAEAVKTVQQQAQARE------------EVEDAVEVRLSKDEQLQQRRANQR 518

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
           + + V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 519 LGAEVMSQ---RIREMSDNDPRVVALVIRQWINNDHE 552


>gi|311279120|ref|YP_003941351.1| flagellar M-ring protein FliF [Enterobacter cloacae SCF1]
 gi|308748315|gb|ADO48067.1| flagellar M-ring protein FliF [Enterobacter cloacae SCF1]
          Length = 556

 Score =  363 bits (932), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 127/537 (23%), Positives = 219/537 (40%), Gaps = 48/537 (8%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  SP Y  L+  L   D   I   L + NI +R +D+G +I VP+  V + R+ LA QG
Sbjct: 45  WAKSPDYRTLFSNLSDQDGGAIVTQLQQMNIPYRFADSGGAIEVPADKVHELRLRLAQQG 104

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  +  ARVH+ MP  
Sbjct: 105 LPKGGA-VGFELLDQE-KFGISQFSEQVNYQRALEGELARTIETLGPVKGARVHLAMPKP 162

Query: 162 GSFRKIGARPTASVMIRAINPSVYK--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV +              A+ HLV++AV  L  G+VT++D  G LLT 
Sbjct: 163 SLFVREQKLPSASVTLNLEPGRALDEGQIAAVVHLVSSAVAGLPPGNVTLVDQAGHLLTQ 222

Query: 220 NEMERN-ILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
           +      +    L     ++  I+  I   L+  +G  N  + V A+LN D ++  E  Y
Sbjct: 223 SNTGARDLNDAQLKYASDVEGRIQRRIETILSPIVGNGNVHAQVTAQLNFDNKEQTEEQY 282

Query: 279 DPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVSDRKV--------------- 320
            P+    +++  S+    SE      P        N P  +                   
Sbjct: 283 RPNGDSSQAVLRSRQVNESEQIGSPYPGGVPGALSNSPAPAPNAPISTPPANQNNGQQQT 342

Query: 321 --PLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQ 378
                 S      + E SNYE++     T  +   ++RLS+AVVVN   L +        
Sbjct: 343 TSTTNASGPRNTSRNETSNYEVDRTIRHTKTNIGDVQRLSVAVVVNYKNLPDGK----PL 398

Query: 379 GKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFAT 438
                 + +I  +   A G + +RGDT+ + +  F                         
Sbjct: 399 PLTADQMKQIEDLTREAMGYSDKRGDTLNVVNSQFSAGDETGGELP----FWKQQSFIDQ 454

Query: 439 VINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDN 498
           +++A  +L+  ++   L   A+R        +      ++ +      +           
Sbjct: 455 LMSAGRWLLVLIVAWLLWRKAIRPQLARRQEEAKVAQEEARVQREMADA----------- 503

Query: 499 IALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
                 ++D     R    R+++ V  Q   R+  M + +    A ++R+W  ++ E
Sbjct: 504 -VEVRLSKDEQHQQRRTNQRLSAEVMSQ---RIREMSDNDPRVVALVIRQWMSNDHE 556


>gi|300696960|ref|YP_003747621.1| FliF: flagellar biosynthesis protein, M-ring protein, Belongs to
           the fliF family [Ralstonia solanacearum CFBP2957]
 gi|299073684|emb|CBJ53204.1| FliF: Flagellar biosynthesis protein, M-ring protein, Belongs to
           the fliF family [Ralstonia solanacearum CFBP2957]
          Length = 616

 Score =  363 bits (932), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 125/558 (22%), Positives = 229/558 (41%), Gaps = 52/558 (9%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  +  SD   I  AL + N+ +R +D GS+I VP + V +AR+ LAAQ
Sbjct: 66  LWSRAPDYRVLYSNVADSDGGAIIAALQQMNVPYRFADGGSAIMVPEANVHEARLKLAAQ 125

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP     +G+EL  +   FG + F +++   RALEGE+ARTIQ++  + +ARVH+ +  
Sbjct: 126 GLPKGGL-AGFELM-ENQKFGTSQFAEQVNYQRALEGELARTIQAMQEVQSARVHLALSK 183

Query: 161 MGSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +   +P+ASV+++            +AI HL++++VPNL + +VTV+D +G+LL+
Sbjct: 184 PSVFVREQVKPSASVLLKLYPGRMLDRSQVQAIGHLLSSSVPNLPLANVTVVDQSGRLLS 243

Query: 219 A--NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI 276
           +   +    +    L+ V+ I+      I   L   +G DN R+ V A++++D  +    
Sbjct: 244 SSFQDNASGLDPTQLNYVRDIEQGYIKRIEAILGPVVGEDNVRAQVTADVDLDNTEQMAE 303

Query: 277 VYDPDSKVERSIRLSKDAQRSETSQP---ESAVTVEQNMPHVSDRK-------------- 319
            Y P+      +  S     S  S+            N P  + R               
Sbjct: 304 TYRPNQDPANGVVRSTHTSESTQSKAGAQGGVPGALSNQPPTAPRMLPTAPAPASQQAAA 363

Query: 320 -----------------------VPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLER 356
                                       +   +  ++   NYE++     T      + R
Sbjct: 364 GQNGQNGQNGPNAQNGQQQGAATGQAATNNVESSARDTTVNYEVDKTVRRTRAAVGTVRR 423

Query: 357 LSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLEN 416
           LS+AVVVN             +   D+ + ++N +V  A G +++RGD++ + +  F   
Sbjct: 424 LSVAVVVNYRA-----DGKTWKPLSDADMVKLNALVKDAVGYDAKRGDSVNVVNSQFSGT 478

Query: 417 QLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA-KKGEVG 475
              +   + +     +  +           +G L++ F  +  L R  N  +        
Sbjct: 479 LPTSKDDLPLWKQPEMIHYAIQAAKYGALAIGFLILVFAVIRPLIRSMNKKEELATATFV 538

Query: 476 GKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMI 535
           G+    P              +     +S  D  +    L     ++  +Q    +  + 
Sbjct: 539 GREGDDPNAPIITGAAAPAGPELEGPSASAADGNAVPEELPQLKQNHEFEQKLETMRRIA 598

Query: 536 EINEERFAKILRKWARSE 553
           + N    A ++++W   E
Sbjct: 599 QQNPRAVAAVIKQWVSIE 616


>gi|320085412|emb|CBY95193.1| Flagellar M-ring protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
          Length = 560

 Score =  363 bits (932), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 126/572 (22%), Positives = 227/572 (39%), Gaps = 52/572 (9%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +  +P Y  L+  L   D   I   L++ 
Sbjct: 14  LEWLNRLRANPRIPLIVASSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQM 73

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +R ++   +I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 74  NIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVN 131

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--SA 188
             RALEGE+ARTI+++  + +ARVH+ MP    F +    P+ASV +             
Sbjct: 132 YQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQI 191

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEIEMNINK 247
            A+ HLV++AV  L  G+VT++D +G LLT +    R++    L     ++  I+  I  
Sbjct: 192 SAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEA 251

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PES 304
            L+  +G  N  + V A+L+   ++  E  Y P+    ++   S+    SE      P  
Sbjct: 252 ILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGG 311

Query: 305 AVTVEQNMP---------------------HVSDRKVPLPRSLENTDKKEEQSNYEINTK 343
                 N P                       +        +     ++ E SNYE++  
Sbjct: 312 VPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSNNSNNAGPRNTQRNETSNYEVDRT 371

Query: 344 SIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRG 403
              T  +   +ERLS+AVVVN   L +              + +I  +   A G + +RG
Sbjct: 372 IRHTKMNVGDIERLSVAVVVNYKTLADGK----PLPLTADQMKQIEDLTREAMGFSDKRG 427

Query: 404 DTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL 463
           DT+ + +  F                         ++ A  +L+  ++   L   A+R  
Sbjct: 428 DTLNVVNSPFSAVDDTGGELP----FWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQ 483

Query: 464 HNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYV 523
                 +      ++ +                +       ++D     R    R+ + V
Sbjct: 484 LTRRVEEAKAAQEQAQVR------------QETEEAVEVRLSKDEQLQQRRANQRLGAEV 531

Query: 524 SKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
             Q   R+  M + +    A ++R+W  ++ E
Sbjct: 532 MSQ---RIREMSDNDPRVVALVIRQWMSNDHE 560


>gi|319781672|ref|YP_004141148.1| flagellar M-ring protein FliF [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167560|gb|ADV11098.1| flagellar M-ring protein FliF [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 548

 Score =  363 bits (931), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 223/552 (40%), Positives = 327/552 (59%), Gaps = 8/552 (1%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           +Q+     +    G  R+ +LA + ++ + +   A  ++N P YD LYV L+ +DVN+I 
Sbjct: 3   EQIQSIISNLRGFGVKRLAMLAGIAVLVMGVIGIASVYLNRPAYDTLYVGLDRADVNQIG 62

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
           + L EA I F +  +G+S+ VP+    +AR+ LA +GLP+S +N+GYELFD V S GLTS
Sbjct: 63  LVLGEAGIGFDVGADGTSVLVPAGTTAQARMLLAEKGLPTS-ANAGYELFDNVGSLGLTS 121

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV 184
           FMQ+ITRVRALEGEIARTIQSISGI AARVHIVM +  +FR+   +P+ASV+IR      
Sbjct: 122 FMQQITRVRALEGEIARTIQSISGIKAARVHIVMSERANFRRDEQQPSASVVIRYAGIDA 181

Query: 185 YKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQHEIEM 243
            KSA +IRHLVAAAVP L    VTVLDS+G LL A +   N    ++L + Q ++ +I  
Sbjct: 182 EKSAMSIRHLVAAAVPGLSADKVTVLDSSGNLLAAGDDPSNTSAARTLGVEQTVEAQIGD 241

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
           NI +AL A+LG DNFR++V AE+N DT+Q  E ++DP+S+VERS++  +  + +   Q  
Sbjct: 242 NIRRALTAYLGPDNFRASVKAEVNTDTRQTEETIFDPNSRVERSVQSVRANENNNQKQAS 301

Query: 304 SAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVV 363
           +  +VEQN+P         P+S    D++EE +NYEIN+K IAT  + Y + ++SIAVVV
Sbjct: 302 TPASVEQNLPETQATATDGPQSSSQNDRREEITNYEINSKKIATVSNGYTVTKMSIAVVV 361

Query: 364 NKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGT 423
           N+ RLT +LG+ A   +I   +AEI K+V++ATG++ +RGD I +++++F++  L     
Sbjct: 362 NQQRLTTILGKDATPEQIAKRVAEIQKMVTSATGLDEKRGDIIDVSAVEFID-GLDGEAI 420

Query: 424 VQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPP 483
            Q   +D + +H  T+INA  F+V   LV F GL  +        A          +   
Sbjct: 421 PQAGMLDSIGQHAGTMINAGAFIVVVFLVAFFGLRPMAAALTAKAAPALAGPSFDDVQRS 480

Query: 484 PISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFA 543
             +             AL  +              +   +      RL  M+++NEER A
Sbjct: 481 LPTPEAMAATDNAAVGALPGTR-----PGPTPLDDLRQKIRPAPQDRLARMVDLNEERTA 535

Query: 544 KILRKWARSEIE 555
           +ILRKWA  E+ 
Sbjct: 536 QILRKWASQEVA 547


>gi|39995518|ref|NP_951469.1| flagellar M-ring protein FliF [Geobacter sulfurreducens PCA]
 gi|39982281|gb|AAR33742.1| flagellar M-ring protein FliF [Geobacter sulfurreducens PCA]
 gi|298504518|gb|ADI83241.1| flagellar M-ring mounting plate protein FliF [Geobacter
           sulfurreducens KN400]
          Length = 527

 Score =  363 bits (931), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 125/563 (22%), Positives = 235/563 (41%), Gaps = 49/563 (8%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           + L +  +   +L   +  ++  V+ + ++ F       N   Y  L+  L   D   I 
Sbjct: 3   EALNKLIQPFMALPPAKRWVVGGVVGLSVIAFTILILVANRTDYRPLFTNLTSEDAGEIV 62

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L E  + +RI+ +G +I VPS  V   R+ LA+ GLP      G+E+FD+ N FG+T 
Sbjct: 63  TKLKEQKVPYRIAADGKAILVPSDKVYDLRLSLASDGLPQGGG-VGFEIFDRKN-FGMTD 120

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV 184
           F+Q++   RAL+GE++RTI  ISG+  ARVH+V+P+   F++     TASV+++      
Sbjct: 121 FVQKLNYQRALQGELSRTISQISGVEQARVHLVIPEKSLFKEDEKPATASVVLKVKGQRQ 180

Query: 185 Y--KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTAN---EMERNILGKSLSIVQAIQH 239
                 + I HLVA+A+  ++   VTVLD  GKLL+ N   +    +      + +A + 
Sbjct: 181 LRENDVQGIVHLVASAIEGMNPEHVTVLDQKGKLLSKNTPGDAAGKMTASMQEVQRAYER 240

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
             E  +   L   +G     + V A  +    +  E  YDP++ V    R  +    S  
Sbjct: 241 STEERLQSLLDKAVGAGKSVARVSAVFDFRQVERYEEKYDPETVVRSEQRSEEKQDGSTV 300

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
           +       V+ N+   + +            K +E  NYE++  +  T      L ++S+
Sbjct: 301 T--GGVPGVQTNLGRTAGQPAGTSGGG---SKNDETLNYEVSRATARTIEPVGTLSKVSV 355

Query: 360 AVVVNKGRLTEVLGR------SADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           A++V+        G+           +    L +I+ +V ++ G N  RGD +T+ ++ F
Sbjct: 356 AILVDGKYDAAAAGKDGKEAKPKYTPRSPDELQKIDALVKSSVGFNVERGDQVTVVNIPF 415

Query: 414 LENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGE 473
            +     +G     +   +   F +++   +   G L +    +  L +    + +   E
Sbjct: 416 QDTGDVGAGEADKWWNAPI---FLSLLKNGLIGFGFLALLLFVVRPLLKTLKPEKSTSFE 472

Query: 474 VGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLH 533
                                          + +   +      R+       S + L++
Sbjct: 473 ----------------------------PIPSAEDALNQIAEIHRLQIGNQTVSQMELIN 504

Query: 534 MIEINEERFAKILRKWARSEIED 556
            I+    + A+I++ W R + E+
Sbjct: 505 KIKQEPYQAAQIIQNWLRDKGEE 527


>gi|118589973|ref|ZP_01547377.1| flagellar M-ring protein [Stappia aggregata IAM 12614]
 gi|118437470|gb|EAV44107.1| flagellar M-ring protein [Stappia aggregata IAM 12614]
          Length = 548

 Score =  363 bits (931), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 207/553 (37%), Positives = 310/553 (56%), Gaps = 10/553 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M   +   + + +   LG  R++ LA + L  I    A  ++++ P    LY  L+  DV
Sbjct: 1   MPGREHAEKLWANLMELGVRRLVALALIGLATIATVGAGAYYLSRPEQTVLYTGLDGEDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
            RI  AL +A I F I+  G+++ V  +   KAR+ LA +GLP   +NSGYELFD++ S 
Sbjct: 61  TRIGSALRDAGIPFDINSEGTAVMVSHAQTAKARMLLAEKGLPR-GANSGYELFDELGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGE+ARTIQ + GI AARVHIV+P+ GSFR+    P+ASV+IR+ 
Sbjct: 120 GLTSFMQEVTRVRALEGELARTIQLMKGIRAARVHIVLPEKGSFRRDQQPPSASVVIRSD 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLS-IVQAIQH 239
            P   ++A+AIRHLVAA VP +    VTVLD++G +L A +         L+ +  A+ +
Sbjct: 180 VPDDVRTADAIRHLVAAGVPGMQADKVTVLDTSGGILAAGKDPTKASAGQLASLETAVSN 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
            I+ NI K L  +LG+DNF+ +V AELN D + I E ++DPDS+ ERSIR  ++ + ++ 
Sbjct: 240 RIQENIRKTLTPYLGLDNFQVSVAAELNTDRKTIAETIFDPDSRTERSIRTIRENENAQN 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
           S   +  TVEQN+P          RS E  +++EE  NYEI++K I T+ D Y+++RLSI
Sbjct: 300 SSVSAPTTVEQNLPEEDVSADNGERSSEENERREETVNYEISSKRIETSQDGYRVDRLSI 359

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AV+V+K RL + LG    Q ++   L EI  +V+++ GI   RGD + +  +DF++    
Sbjct: 360 AVLVDKSRLAQSLGGEPTQAQMQEQLTEIEALVASSAGIEKERGDLVKVAVVDFVDGGRA 419

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
                 +S  + L R    +INAL  L  ++LV + GL           AK      +  
Sbjct: 420 MEPIPPISITEYLMRQSGNIINALAILTVSMLVIWFGLRPAVAALVPQIAKPQVEMAELG 479

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
           ++P      V                  +     ++   +NS  +K +  +L  ++E NE
Sbjct: 480 MTPETAEGTVEAVDGEQ--------TFLMPPDHSDMLQDLNSRRNKSALRKLESLLEFNE 531

Query: 540 ERFAKILRKWARS 552
           E+ A ILR+W   
Sbjct: 532 EQSAAILRQWLYE 544


>gi|238755308|ref|ZP_04616651.1| Flagellar M-ring protein [Yersinia ruckeri ATCC 29473]
 gi|238706444|gb|EEP98818.1| Flagellar M-ring protein [Yersinia ruckeri ATCC 29473]
          Length = 574

 Score =  363 bits (930), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 134/585 (22%), Positives = 246/585 (42%), Gaps = 59/585 (10%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           ++   F      L     + L       + + +A   +  SP Y  LY  L   D   I 
Sbjct: 12  NRENGFTGLLNRLRANPKIPLLVAAAAAVSIVVALMLWAKSPDYRVLYSNLSDRDGGAIV 71

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L++ NI +R ++NG ++ +P+  V + R+ LA QGLP   +  G+EL D+   FG++ 
Sbjct: 72  TQLTQLNIPYRFAENGGALLIPADKVHETRLRLAQQGLPKGGA-VGFELLDQE-KFGISQ 129

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN--P 182
           F ++I   RALEGE++RTI+++  ++  RVH+ MP    F +    P+ASV +       
Sbjct: 130 FSEQINYQRALEGELSRTIETLGPVLNVRVHLAMPKPSLFVREQKSPSASVTLTLQPGRA 189

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQHEI 241
                  AI ++V+++V  L  G+VTV+D TG+LLT ++     +    L     ++   
Sbjct: 190 LDDGQINAIVYMVSSSVAGLPPGNVTVVDQTGRLLTQSDSAGRDLNAAQLKFTNEVEVRF 249

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
           +  I   LA  +G  N  + V A+++  T++  +  Y P+ + E+    S+   +SE   
Sbjct: 250 QRRIESILAPMVGNGNVHAQVTAQVDFATREQTDEEYKPNQRPEQGAVRSQQLSQSEQVG 309

Query: 302 P---ESAVTVEQNMPHVSDRKV------------------------------PLPRSLEN 328
                       N P  +                                      ++  
Sbjct: 310 GTPIGGVPGALSNQPSATPAAPIETPAAPGATGAAANTATATPATRNTSAGTAGKNAVPG 369

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEI 388
           + +++E +NYE++     T      ++RLS+AVVVN   + +  G+          LA+I
Sbjct: 370 SSRRDETTNYEVDRTIRHTQQQAGMVQRLSVAVVVNYLGIDKKSGKPI--ALSKDQLAQI 427

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
             +   A G +++RGDT+ + +  F E +  NS              F  V+NA  +L+ 
Sbjct: 428 EALTREAMGFSTQRGDTLNVVNTPFTEAEETNSALP----FWKSQSFFDQVLNAGRYLLI 483

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
            L+   L    +R L                +   P+ +A  T     +       + D 
Sbjct: 484 LLVAWILWRKLVRPLMAKK------------MEVNPVIAAAKTVAQTAEAAESAKQSNDE 531

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
            +  +  Q R+++ V  Q   R+  + + +    A ++R+W  ++
Sbjct: 532 LAQRKKSQQRVSAEVQAQ---RIRELADKDPRVVALVIRQWMSND 573


>gi|296103558|ref|YP_003613704.1| flagellar MS-ring protein [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295058017|gb|ADF62755.1| flagellar MS-ring protein [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 559

 Score =  363 bits (930), Expect = 6e-98,   Method: Composition-based stats.
 Identities = 121/543 (22%), Positives = 221/543 (40%), Gaps = 51/543 (9%)

Query: 39  ARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLA 98
              +  SP Y  LY  L   D   I   L++ NI +R +DNG ++ VP+  V + R+ LA
Sbjct: 42  MVLWAKSPDYRTLYSNLSDQDGGAIVTQLTQMNIPYRFADNGGALEVPADKVHELRLRLA 101

Query: 99  AQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVM 158
            QGLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ M
Sbjct: 102 QQGLPKGGA-VGFELLDQE-KFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAM 159

Query: 159 PDMGSFRKIGARPTASVM--IRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKL 216
           P    F +    P+ASV   +            A+ HLV++AV  L  G+VT++D +G L
Sbjct: 160 PKPSLFVREQKSPSASVTVNLEPGRALDEGQISAVTHLVSSAVAGLPPGNVTLVDQSGHL 219

Query: 217 LTANE-MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           LT +    R++    L     ++  ++  I   L   +G  N  + V A+++   ++  E
Sbjct: 220 LTQSNTAGRDLNDAQLKYAADVEARLQRRIEAILGPVVGNSNVHAQVTAQIDFSNKEQTE 279

Query: 276 IVYDPDSKVERSIRLSK---DAQRSETSQPESAVTVEQNMPHVSDRKV------------ 320
             Y P+    +++  S+   + ++   + P        N P  ++               
Sbjct: 280 EQYRPNGDPAQAVMRSRQVNENEQVGGAYPGGVPGALSNQPAPANAAPISTPPANQQNGQ 339

Query: 321 --------PLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVL 372
                       +   T+ + E +NYE++     T  +   ++RLS+AVVVN   L    
Sbjct: 340 QNQQTTTSTASNAGPRTNSRNETTNYEVDRTIRHTKLNVGDIQRLSVAVVVNYKTLPNGK 399

Query: 373 GRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDIL 432
                       + +I  +   A G + +RGD++ + +  F                   
Sbjct: 400 ----PLPLTAEQMKQIEDLTREAMGYSEKRGDSLNVVNSPFNPVDETGGELP----FWQQ 451

Query: 433 SRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTG 492
                 +++A  +L+  ++   L    +R         +                     
Sbjct: 452 QAFIDQLMSAGRWLLVLIVAWLLWRKGVRPQLQRRAEAEKAA------------REQINA 499

Query: 493 LMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARS 552
               +       ++D     R    R+ + V  Q   R+  M + +    A ++R+W  +
Sbjct: 500 RQEVEEAVEVRLSKDEQMQQRRANQRMGAEVMSQ---RIREMSDNDPRVVALVIRQWMGN 556

Query: 553 EIE 555
           E E
Sbjct: 557 EHE 559


>gi|73538922|ref|YP_299289.1| flagellar MS-ring protein [Ralstonia eutropha JMP134]
 gi|72122259|gb|AAZ64445.1| Flagellar FliF M-ring protein [Ralstonia eutropha JMP134]
          Length = 568

 Score =  363 bits (930), Expect = 6e-98,   Method: Composition-based stats.
 Identities = 113/582 (19%), Positives = 217/582 (37%), Gaps = 66/582 (11%)

Query: 12  KSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEAN 71
           +    L     L L                +  +P Y  LY  L   D   +  +L + N
Sbjct: 13  EVLDRLKANPKLPLMLGGAALAAAIAVGVLWSRAPDYKVLYSNLSERDGGAVLQSLQQMN 72

Query: 72  IDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITR 131
           + ++ ++ G ++ VP+  V + R+ LA+QGLP S   +G EL D    FG++ F +++  
Sbjct: 73  VPYKFAEGGGAVMVPAEKVHETRLRLASQGLPKSG-TTGLELMDN-QKFGISQFAEQVNY 130

Query: 132 VRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS--VYKSAE 189
            R LEGE+AR+I+SI+ + +ARVH+ +P    F +   +PTAS++++             
Sbjct: 131 QRGLEGELARSIESIAAVQSARVHLAIPKPTLFVRERQKPTASIVLQLYPGRAIDEGQVA 190

Query: 190 AIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKAL 249
           AI HLV+++VP L    ++++D  G LL+ +  ER +    L  VQA++      I   L
Sbjct: 191 AISHLVSSSVPELTPKAISIVDQHGNLLSNSGNERMLDATQLKYVQALEQNYLKRIESIL 250

Query: 250 AAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PESAV 306
              +G DN R+ V A+++    +  +  Y P+     +   S+    S       P    
Sbjct: 251 TPIVGKDNVRAQVTADVDFSIVEHTDESYKPNQDPTHAAIRSQQTSESNQQGATPPGGVP 310

Query: 307 TVEQNMPHVSDRKV----------------------------------PLPRSLENTDKK 332
               N P                                             +  +++++
Sbjct: 311 GALSNQPPAPATAPITTAQTPRAGQAPGQAGAPAQPQGAQAGQAQAATSTASTGPSSNRR 370

Query: 333 EEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIV 392
           +   NYE++            + RLS+AVVVN  +  +  G+   Q    + LA+I  + 
Sbjct: 371 DSTVNYELDRTVRHVQQAPGGVRRLSVAVVVNYRQQADAKGKMVAQPLPPALLAQIENLT 430

Query: 393 SAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLV 452
               G ++ RGD+I + +  F       +  + +     +     T    L+  +  L  
Sbjct: 431 KETMGFSADRGDSINVVNSPFT-VDREVTPELPLWKQPEMIDLAKTGAGYLLLALLALFA 489

Query: 453 TFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHS 512
            F     + R +            ++     P        ++                  
Sbjct: 490 WFKIARPILRRYTTPPLPAPTPAAETTAELLPPEEPTNPEVLRL---------------- 533

Query: 513 RNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                   +   +     +    + +    A +++ W  +++
Sbjct: 534 --------AAKYESDLALVRDAAQRDPRLVASVIKNWIGNDL 567


>gi|87119487|ref|ZP_01075384.1| flagellar M-ring protein [Marinomonas sp. MED121]
 gi|86164963|gb|EAQ66231.1| flagellar M-ring protein [Marinomonas sp. MED121]
          Length = 551

 Score =  363 bits (930), Expect = 6e-98,   Method: Composition-based stats.
 Identities = 112/555 (20%), Positives = 222/555 (40%), Gaps = 31/555 (5%)

Query: 9   QFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALS 68
           +       L   R L L   +   I + +AA  + + P Y  +   +   + ++I   LS
Sbjct: 16  ELLTGFNKLTVIRQLALMVGLAASIAIGLAAILWTDGPEYKPVLSSITDYNADQIVEVLS 75

Query: 69  EANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQE 128
             NI F++ +N  ++ V +    +AR+ LA  G+ +  +  G E+ D+    G + F++ 
Sbjct: 76  INNIPFKLDENTGALLVEADQYHQARLKLAGSGIVND-TIVGMEIMDQEQGLGTSQFVEG 134

Query: 129 ITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR--AINPSVYK 186
               R LEGE++RTI S+  I +ARVH+ +P    F +   +P+ASV +           
Sbjct: 135 TRYRRGLEGELSRTISSLQSIKSARVHLAIPKESVFVRDTRKPSASVFLEMYPGRRLDRS 194

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNI--LGKSLSIVQAIQHEIEMN 244
             +AI +LV++++  L    VTV+D  G LL+  E    +   GK     + ++  +   
Sbjct: 195 QVDAIVNLVSSSISQLSAKSVTVVDQRGTLLSEKETSSELSVAGKQFDYTRKVEDVLLSR 254

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPES 304
           +N  L   +G D F++ V  +++  + +  +  Y+PD    RS +   +++   T     
Sbjct: 255 VNSILGPVVGADRFKAEVSTDVDFTSVEQTDEQYNPDLLALRSEQTLNESRNGTT--NSG 312

Query: 305 AVTVEQNMPHVS------DRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLS 358
                 N P  +                    ++E   N+E++     T      + RLS
Sbjct: 313 IPGSLTNQPPGAITAPEVANSAGAASGTNGESRQETTRNFELDRSISYTRRQQGTIRRLS 372

Query: 359 IAVVVNK-GRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           +AVVV+    +             D  L+ +  +V  A G +S RGD++++ +  F   +
Sbjct: 373 VAVVVDDLVSIDPETSELVRTPWSDDELSRLTLLVRDAVGYDSARGDSVSVINSPFAVPE 432

Query: 418 LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGK 477
              +      +       F ++I   +     L++  + +  + +          +    
Sbjct: 433 PLPTPEELPFYQ---QEWFLSLIQPTLVGFFVLILLMVVVRPILKTLG------EQNKIA 483

Query: 478 SILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEI 537
                     A  T  + +D ++L S+   +   S     R            +  +I  
Sbjct: 484 VAEDAEASIFADETDEISDDQVSLVSAEDIMVPGSPEKIER--------QLNAIRGLIAE 535

Query: 538 NEERFAKILRKWARS 552
             ER A+++++W   
Sbjct: 536 EPERVAQVVKQWVMD 550


>gi|237731986|ref|ZP_04562467.1| flagellar MS-ring protein [Citrobacter sp. 30_2]
 gi|226907525|gb|EEH93443.1| flagellar MS-ring protein [Citrobacter sp. 30_2]
          Length = 557

 Score =  363 bits (930), Expect = 6e-98,   Method: Composition-based stats.
 Identities = 123/569 (21%), Positives = 228/569 (40%), Gaps = 49/569 (8%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +  +P Y  L+  L   D   I   L++ 
Sbjct: 14  LEWLNRLRANPRIPLIVAGAAAVAIIVAMVLWAKAPDYRTLFSNLSDQDGGAIVTQLTQM 73

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           N+ +R ++   +I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 74  NVPYRFTEGSGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVN 131

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVM--IRAINPSVYKSA 188
             RALEGE+ARTI+++  +  ARVH+ MP    F +    P+ASV   +           
Sbjct: 132 YQRALEGELARTIETLGPVKRARVHLAMPKPSLFVREQKAPSASVTVNLEPGRALDEGQI 191

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQHEIEMNINK 247
            A+ HLV++AV  L  G+VT++D  G LLT +      +    L     ++  ++  I  
Sbjct: 192 SAVTHLVSSAVAGLPPGNVTLVDQAGHLLTQSNTSSRDLNDAQLKYASDVEGRVQRRIES 251

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRS---ETSQPES 304
            L+  +G  N  + V A+L+   ++  E  Y P+    +++  S+    S    +  P  
Sbjct: 252 ILSPIVGNGNVHAQVTAQLDFANKEQTEEQYRPNGDDSQAVLRSRQLNVSEQIGSGAPGG 311

Query: 305 AVTVEQNMPHVSDRKV------------------PLPRSLENTDKKEEQSNYEINTKSIA 346
                 N P  ++                         +   + ++ E SNYE++     
Sbjct: 312 VPGALSNQPAPANTAPIANPPANQQNAQTTQTANNSNNAGPRSTQRNETSNYEVDRTIRH 371

Query: 347 TTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTI 406
           T  +   ++RLS+AVVVN   L +              + +I  +   A G + +RGDT+
Sbjct: 372 TKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLTADQMKQIEDLTREAMGFSDKRGDTL 427

Query: 407 TITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNI 466
            + +  F                         ++ A  +L+  L+   L   A+R     
Sbjct: 428 NVVNSPFTATDDSMGELP----FWKQPFFIDQLMTAGRWLLVLLVAWILWRKAVRPQLVR 483

Query: 467 DDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQ 526
              +   V  ++ +                +       ++D  +  R    R+ + V  Q
Sbjct: 484 RSEEAKAVQEQTRIR------------QETEEAVEVRLSKDEQTQQRRTNQRLGAEVMSQ 531

Query: 527 SDLRLLHMIEINEERFAKILRKWARSEIE 555
              R+  M + +    A ++R+W  ++ E
Sbjct: 532 ---RIREMSDNDPRVVALVIRQWMSNDHE 557


>gi|162136034|ref|YP_530830.2| flagellar MS-ring protein [Rhodopseudomonas palustris BisB18]
          Length = 539

 Score =  363 bits (930), Expect = 6e-98,   Method: Composition-based stats.
 Identities = 130/551 (23%), Positives = 230/551 (41%), Gaps = 19/551 (3%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           +         LG  R++ + +V    I  F      V +P    L+  L V D + I   
Sbjct: 1   MQGLVSFLKGLGAARLMAMIAVTAALIGFFAFVIMRVTTPQMTTLFTDLSVEDSSGIIKD 60

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L    I F I + GS I VP   V + R+ LA           GYE+FDK ++ G TSF+
Sbjct: 61  LERQAIPFEIRNEGSVIMVPKDKVTRLRMKLAEG-GLPKGGGVGYEIFDKSDALGSTSFV 119

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           Q I  +RALEGE+ARTI++I  I AARVH+V+P+   F +    P+AS+++R       +
Sbjct: 120 QNINHLRALEGELARTIRAIDRIQAARVHLVLPERPLFSRETPEPSASIVLRVRGALEPQ 179

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKS--LSIVQAIQHEIEMN 244
              AIRH+VA+AV  L    V+++D  G+LL            +         +  +   
Sbjct: 180 QVRAIRHVVASAVNGLKPQRVSIVDEAGQLLADGAAGDPASDGATGDERRAGFEKRMRNQ 239

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPES 304
           +   +++ +G    R  + A+ + +        +DP+ +V RS +  +++ ++  +    
Sbjct: 240 VEAIVSSVVGSGRARVQLTADFDYNKVTQTSDKFDPEGRVLRSSQSREESSQTAAANDGQ 299

Query: 305 AVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVN 364
                 N    +        + + + K EE +NYEI+  +     +  ++ R+S+AV+V+
Sbjct: 300 V--TVNNELPGAQAGAGAAVARDQSKKSEETNNYEISRVTKTEITEAGRVNRISVAVLVD 357

Query: 365 KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTV 424
                   G    Q +    L  I  +V +A G + +RGD + + ++ F E         
Sbjct: 358 GIYGKNDKGEMVYQERSKDQLDRIAALVRSAIGFDQKRGDQVEVVNLRFAEAPSVPPVAE 417

Query: 425 Q---VSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILS 481
               +  +         VI   V ++  L+V F+ +  L R     +       G   L+
Sbjct: 418 PGGLLGMVQFTKDDVMYVIELAVMMLLGLVVMFMVIRPLVRRILAAEPGAAGANGVPALT 477

Query: 482 PPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEER 541
               ++           I  D         +    +++   V  QS  R+  + + N   
Sbjct: 478 DASGTA-----------IGPDGLPLVAPGPNMIDIAQVQGQVHAQSVHRVGELADRNPNE 526

Query: 542 FAKILRKWARS 552
            A I+R+W + 
Sbjct: 527 TAAIVRQWLQE 537


>gi|167561148|ref|ZP_02354064.1| flagellar MS-ring protein [Burkholderia oklahomensis EO147]
          Length = 490

 Score =  363 bits (930), Expect = 7e-98,   Method: Composition-based stats.
 Identities = 115/443 (25%), Positives = 194/443 (43%), Gaps = 15/443 (3%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G ++ VP++ V + R+ LA+ G
Sbjct: 50  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAVLVPANQVHETRLKLASIG 109

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RTI+SI+ + +ARVH+ +P  
Sbjct: 110 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTIESINTVRSARVHLAIPKP 167

Query: 162 GSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++              A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 168 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 227

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 228 TASASGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYG 287

Query: 280 PDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDR--------KVPLPRSLEN 328
           P+   +++   S+    +     S          N P             +   P +   
Sbjct: 288 PNGAPQQTAIRSQQTSTATELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 347

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEI 388
           +D+K+  +NYE++            ++RLS+AVVVN     +  GR   Q      LA+I
Sbjct: 348 SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPAADAKGRVTMQPLTAEKLAQI 407

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  A G + +RGD++ + +  F       +        D++           V    
Sbjct: 408 QQLVKDAMGYDEKRGDSVNVVNSAFSTAADPFADLPWWRQPDMIELGKDIAKWLGVAAAA 467

Query: 449 TLLVTFLGLHALRRLHNIDDAKK 471
             L       ALRR         
Sbjct: 468 AALYFMFVRPALRRAFPPPAEPA 490


>gi|114319870|ref|YP_741553.1| flagellar M-ring protein FliF [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226264|gb|ABI56063.1| flagellar M-ring protein FliF [Alkalilimnicola ehrlichii MLHE-1]
          Length = 580

 Score =  362 bits (929), Expect = 7e-98,   Method: Composition-based stats.
 Identities = 123/557 (22%), Positives = 223/557 (40%), Gaps = 20/557 (3%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           + Q             L LA V+L  +   +    +   P Y  L+ +L+  D   +   
Sbjct: 38  MDQLEGLFGGRQNVMRLGLAVVLLFTVAAGVLLYLWAQEPSYRTLFSELDDQDAAAVIEQ 97

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L E  I +R+ +   ++ VPS  V  AR+ LAA+GLP   +  G+E+  + ++FG + FM
Sbjct: 98  LEEQGIPYRLDERTGAVRVPSDQVHPARLQLAAEGLPR-GTGFGFEMLQEDSAFGTSEFM 156

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPSV 184
           +     RALE E+AR+I ++  + AARVH+ +P    F +   +P ASV++         
Sbjct: 157 EGARFDRALETELARSIGTLRQVDAARVHLALPRESVFVRDRRQPRASVVVNLAQGRRLN 216

Query: 185 YKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL-GKSLSIVQAIQHEIEM 243
            +  +AI H+VA++VP+L   +V+V+D  G+LLT +E                ++     
Sbjct: 217 DEQVDAIVHMVASSVPDLAHENVSVVDERGRLLTRDEGRGLASTAGQFQYKTQVEETYVR 276

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            I   LA  +G +  R+ V A L+   QQ  E +YDPDS+V RS  L     +       
Sbjct: 277 RIEDLLAPLVGRNRVRAQVNASLDFSEQQRTEELYDPDSRVIRSEALQGRRTQQGADAAM 336

Query: 304 SAVTVEQNMPHVSDRKVPL---PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
                  N P  + +                  E  NYEI+            ++R+S+A
Sbjct: 337 GVPGALTNQPPGAGQLDGEEAPENPPPVDISSSETRNYEISRTLRQVRDPIGSIQRVSVA 396

Query: 361 VVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN 420
           VVV++   T+  G +  +   D  +  IN +V  A G ++ RGD++ + +  FLE +   
Sbjct: 397 VVVDERITTDEEGNTVREPLSDEEMDRINALVQEAVGFDAARGDSVNVVNAAFLEEEPVE 456

Query: 421 SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL 480
           +                 +I   +  +  + +    +  + +                  
Sbjct: 457 AMPPVPLLE---REWVRELIRFAIAALAFIALLLFVVRPMIKGMQRQ----------RDQ 503

Query: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540
           +    +S     L         +      ++ + L + +     +        ++    E
Sbjct: 504 ALRAPASEEQARLAQQGGGGGAAQLAGPDANEQALLAGVQHKPYEAKLEAAKKLVNDEPE 563

Query: 541 RFAKILRKWARSEIEDR 557
             A +++ W   +   R
Sbjct: 564 LAANVIKSWLAEDDGKR 580


>gi|300693364|ref|YP_003749337.1| flif: flagellar biosynthesis protein, m-ring protein, belongs to
           the flif family [Ralstonia solanacearum PSI07]
 gi|299075401|emb|CBJ34696.1| FliF: Flagellar biosynthesis protein, M-ring protein, Belongs to
           the fliF family [Ralstonia solanacearum PSI07]
          Length = 611

 Score =  362 bits (929), Expect = 7e-98,   Method: Composition-based stats.
 Identities = 127/554 (22%), Positives = 232/554 (41%), Gaps = 47/554 (8%)

Query: 40  RFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAA 99
             +  +P+Y  LY  +  SD   I  AL + N+ +R +D GS+I VP + V +AR+ LAA
Sbjct: 65  MLWSRTPNYGVLYSNVADSDGGAIIAALQQMNVPYRFADGGSAIMVPEANVHEARLKLAA 124

Query: 100 QGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMP 159
           QGLP     +G+EL  +   FG + F +++   RALEGE+ARTIQ++  + +ARVH+ + 
Sbjct: 125 QGLPKGGL-AGFELM-ENQKFGTSQFAEQVNYQRALEGELARTIQAMQEVQSARVHLALS 182

Query: 160 DMGSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
               F +  A+P+ASV+++            +AI HLV+++VPNL + +VTV+D +G+LL
Sbjct: 183 KPSVFVREQAKPSASVLLKLYPGRMLDRSQVQAIGHLVSSSVPNLPLANVTVVDQSGRLL 242

Query: 218 TA--NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           ++   +    +    L+ V+ I+      I   L   LG DN R+ V A++++D  +   
Sbjct: 243 SSSFQDNASGLDPTQLNYVRDIEQGYIKRIEAILGPVLGEDNVRAQVTADVDLDNTEQMA 302

Query: 276 IVYDPDSKVERSIRLSKDAQRSETSQP---ESAVTVEQNMPHVSDRKVPL---------- 322
             Y P+      +  S     S  ++            N P  + R +P           
Sbjct: 303 ETYRPNQDPSNGVVRSTHTSESTQNKAGAQGGVPGALSNQPPSAPRMLPTAPAPASQQAA 362

Query: 323 ----------------------PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
                                   +   +  ++   NYE++     T      + RLS+A
Sbjct: 363 AGQNGQNGQNGQQQAAAATGQTAANGVESSARDTTINYEVDKTVRRTRAAVGTVRRLSVA 422

Query: 361 VVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN 420
           VVVN     +       +   D+ + ++N +V  A G +++RGD++ + +  F       
Sbjct: 423 VVVNYRADGKA-----WKPLSDAEMVKLNALVKDAVGYDAKRGDSVNVVNSQFSGTLPVA 477

Query: 421 SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL 480
              + +     +  +           +G L++ F  +  L R  N  D            
Sbjct: 478 KDDLPLWKQPEMIHYAIQAAKYGALAIGFLILVFAVIRPLIRSMNKKDEHAAATFVGREG 537

Query: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRIN-SYVSKQSDLRLLHMIEINE 539
             P               +   S+        +    ++  ++  +Q    +  + + N 
Sbjct: 538 EDPNAPIITGAAAPAGPELEGPSAASAQGDEVQIEVPQLKMNHDFEQKLETMRRIAQQNP 597

Query: 540 ERFAKILRKWARSE 553
              A ++++W  SE
Sbjct: 598 RAVAAVVKQWVSSE 611


>gi|283785708|ref|YP_003365573.1| flagellar M-ring protein [Citrobacter rodentium ICC168]
 gi|282949162|emb|CBG88770.1| flagellar M-ring protein [Citrobacter rodentium ICC168]
          Length = 560

 Score =  362 bits (929), Expect = 8e-98,   Method: Composition-based stats.
 Identities = 123/572 (21%), Positives = 223/572 (38%), Gaps = 52/572 (9%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +  SP Y  L+  L   D   I   L++ 
Sbjct: 14  LEWLNRLRANPKIPLIIAGSAAVAIIVAMVLWAKSPDYRTLFSNLSDQDGGAIVTQLTQM 73

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +R ++   +I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 74  NIPYRFTEGSGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVN 131

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVM--IRAINPSVYKSA 188
             RALEGE+ARTI+++  +  ARVH+ MP    F +    P+ASV   +           
Sbjct: 132 YQRALEGELARTIETLGPVRRARVHLAMPKPSLFVREQKSPSASVTINLEPGRALDEGQI 191

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQHEIEMNINK 247
            A+ HLV++AV  L  G+VT++D +G+LLT +      +    L     +++ I+  I  
Sbjct: 192 SAVVHLVSSAVAGLPPGNVTLVDQSGRLLTQSNTSSRDLNDAQLKYASDVENRIQRRIES 251

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PES 304
            L+  +G  N  + V A+L+   ++  E  Y P+    ++   S+    SE      P  
Sbjct: 252 ILSPIVGNGNVHAQVTAQLDFANKEQTEEQYRPNGDASQAALRSRQVNESEQIGSGLPGG 311

Query: 305 AVTVEQNMPHVSDRKV---------------------PLPRSLENTDKKEEQSNYEINTK 343
                 N P  ++                                  ++ E SNYE++  
Sbjct: 312 VPGALSNQPAPANAAPITTPPANQQNAQNGQNAQQTSTNNAVGPRNTQRNETSNYEVDRT 371

Query: 344 SIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRG 403
              T  +   ++RLS+AVVVN    ++              + +I  +   A G + +RG
Sbjct: 372 IRHTKMNVGDIQRLSVAVVVNYKTPSDGK----PLPLTADQMKQIENLTREAMGFSDKRG 427

Query: 404 DTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL 463
           DT+ + +  F      N+G V             +    L+ L+   L+    +    + 
Sbjct: 428 DTLNVVNSPFSATD-ENAGEVPFWKQQFFIEQLFSAGRWLLVLLVGWLLWRKAVRPQLQR 486

Query: 464 HNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYV 523
              +     E       +   +   ++         A      ++ S             
Sbjct: 487 RAEEAKAAREREQLRQETKEAVEVRLSKDEQTQQQRANQRLGAEVLSQ------------ 534

Query: 524 SKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
                 R+  M + +    A ++R+W  ++ E
Sbjct: 535 ------RIREMSDNDPRVVALVIRQWMSNDHE 560


>gi|146312175|ref|YP_001177249.1| flagellar MS-ring protein [Enterobacter sp. 638]
 gi|145319051|gb|ABP61198.1| flagellar M-ring protein FliF [Enterobacter sp. 638]
          Length = 565

 Score =  362 bits (929), Expect = 8e-98,   Method: Composition-based stats.
 Identities = 125/549 (22%), Positives = 219/549 (39%), Gaps = 57/549 (10%)

Query: 39  ARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLA 98
              +  SP Y  LY  +   D   I   L++ NI +R +DNG +I VP+  V + R+ LA
Sbjct: 42  MVLWAKSPDYRTLYSNVSDQDGGAIVTQLTQLNIPYRFADNGGAIEVPADKVHELRLRLA 101

Query: 99  AQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVM 158
            QGLP   +  G+EL D+   FG++ F ++I   RALEGE+ARTI+++  +  ARVH+ M
Sbjct: 102 QQGLPKGGA-VGFELLDQE-KFGISQFSEQINYQRALEGELARTIETLGPVKTARVHLAM 159

Query: 159 PDMGSFRKIGARPTASVMIRAINPSVYK--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKL 216
           P    F +    P+ASV +              A+ HLV++AV  L  G+VTV+D +G L
Sbjct: 160 PKPSLFVREQKNPSASVTVTLEPGRALDEGQISAVTHLVSSAVAGLPTGNVTVVDQSGHL 219

Query: 217 LTANEMERN-ILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           LT +      +    L     ++  I+  I   L   +G  N  + V A++N D ++  E
Sbjct: 220 LTQSNTSSRDLNDAQLKYANDVEGRIQRRIEAILGPIVGSSNIHAQVTAQINFDNKEQTE 279

Query: 276 IVYDPDSKVERSIRLSKDAQRS---ETSQPESAVTVEQNMPHVSDRKV------------ 320
             Y P+    +++  S+    +       P        N P  ++               
Sbjct: 280 EQYSPNGDAAQAVMRSRQLNTTEQIGGQNPGGVPGALSNQPAPANSAPISTPPANQQNGQ 339

Query: 321 --------------PLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG 366
                             S      + E +NYE++     T  +   ++RLS+AVVVN  
Sbjct: 340 QNGQQNNQQQQTTSTAASSGPRNSSRNETTNYEVDRTIRHTKMNVGDVQRLSVAVVVNYK 399

Query: 367 RLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQV 426
            L +              + +I  +   A G   +RGD++ + +  F             
Sbjct: 400 TLPDGK----PLPLTTDQMKQIEDLTREAMGFTEKRGDSLNVVNSPFTATDETGGELP-- 453

Query: 427 SFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPIS 486
                       +++A  +L+  ++   L   A+R        +                
Sbjct: 454 --FWQQQSFIEQMLSAGRWLLVLIVAWLLWRKAIRPQLTRRAEEAKAA------------ 499

Query: 487 SAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKIL 546
             + +     +       ++D  +  R +  R+ + V  Q   R+  M + +    A ++
Sbjct: 500 QEMMSARQDIEEAVEVRLSKDEQTQQRRVNQRLGAEVMSQ---RIREMSDNDPRVVALVI 556

Query: 547 RKWARSEIE 555
           R+W  ++ E
Sbjct: 557 RQWMSNDHE 565


>gi|152980320|ref|YP_001353131.1| flagellar MS-ring protein [Janthinobacterium sp. Marseille]
 gi|151280397|gb|ABR88807.1| flagellar basal-body M-ring protein [Janthinobacterium sp.
           Marseille]
          Length = 585

 Score =  362 bits (929), Expect = 9e-98,   Method: Composition-based stats.
 Identities = 121/588 (20%), Positives = 217/588 (36%), Gaps = 66/588 (11%)

Query: 6   QLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISV 65
            +   F         R ++L       I + +A   +   P Y  L+      D   I  
Sbjct: 24  NMQNSFMDMAKSPNGRKVMLMLGSAAVIAIMIALVLWSQKPEYKVLFSNFSDRDGGAIMS 83

Query: 66  ALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSF 125
           +L  +N+ ++ ++ G +I VP+  V + R+ LAA+GLP      G+EL  +    G++ F
Sbjct: 84  SLQASNVPYKFAEGGGAILVPADKVHEIRLKLAAEGLPKGGG-VGFELM-ENQKLGVSQF 141

Query: 126 MQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPS 183
           ++++   RALEGE+AR+IQS+  + AARVH+ MP    F +   +PTASV++        
Sbjct: 142 LEQVNFQRALEGELARSIQSVGAVQAARVHLAMPKASVFVRDQQKPTASVLLNLRQGRAL 201

Query: 184 VYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE---MERNILGKSLSIVQAIQHE 240
             +   AI HLVA++VP L   +VT++D +G LL+          +    L  VQ +Q  
Sbjct: 202 DQQQVSAIVHLVASSVPELSPKNVTIVDQSGNLLSETNKPAGSNTLDPSQLKYVQELQQS 261

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           I   I   +   +G  N R+   A+++  T +    +Y P+     +   S     S  +
Sbjct: 262 ITKRIESIITPIVGASNIRAEATADVDFSTSEQAAEIYKPNQVPNSATVRSLQTSESRGN 321

Query: 301 QPE--SAVTVEQNMPHVSDRKVPLPRS--------------------------------- 325
                       N P  +                                          
Sbjct: 322 GTGASGVPGALTNQPAPNATAPLTAPPLAADGTPSTATNPPAPGTPAAAAAAAAAATAAA 381

Query: 326 LENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYL 385
                +K+  +N+E++            L+RLS+AVVVN  R+    G+       ++  
Sbjct: 382 NATPTQKDTTTNFEVDKTVRYVQQPMGGLKRLSVAVVVNYKRVVAKDGKVTIAPLSETEK 441

Query: 386 AEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVF 445
            +I  +V  A G N  RGDT+ + +  F   +        +     +          L  
Sbjct: 442 NQITDLVKEAMGYNKDRGDTLNVVNSPFAGVEKDEIVQPPLWERPEIIEMAIQAAKYLAI 501

Query: 446 LVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSN 505
            +   L+        R+L      K      + +      + A+    +  D   +   N
Sbjct: 502 GIVLFLLY-------RKLLKPMLNKLNPPPPEPLALEDESAEALEKMHLEEDGKPMGIQN 554

Query: 506 QDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
                              +Q+      +   + +  A I++ W  ++
Sbjct: 555 T-----------------YQQNLEAAKELARKDPKVVANIVKSWVGND 585


>gi|254502238|ref|ZP_05114389.1| flagellar M-ring protein FliF [Labrenzia alexandrii DFL-11]
 gi|222438309|gb|EEE44988.1| flagellar M-ring protein FliF [Labrenzia alexandrii DFL-11]
          Length = 538

 Score =  362 bits (928), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 134/552 (24%), Positives = 246/552 (44%), Gaps = 17/552 (3%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           +    +   +LG  RI  + +V  + + +F    F V +P    LY +L + D   I   
Sbjct: 1   MNGLIEFIKTLGPARIAAMGAVAAILVGVFAFIIFRVTAPQMTTLYNELTLEDSAAIVSQ 60

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L    + F+++  G+SI VP   V + R+ LAA+GLP+  S  GYE+FD+ ++ G TSF+
Sbjct: 61  LESQGVQFKLAREGASIMVPQEQVARLRMQLAAEGLPTGGS-IGYEIFDRSDTLGATSFV 119

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           Q I  +RA+EGE++RTI S+  I +ARVH+V+P+   F++    P+AS+++         
Sbjct: 120 QNINHLRAMEGELSRTISSLDRIRSARVHLVIPERQLFQRDRRPPSASIVLNVRGGLGPG 179

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA---NEMERNILGKSLSIVQAIQHEIEM 243
              A++HLVA AV  LD   V+++D +G+LL +   ++ E  +  +      AI+  +  
Sbjct: 180 EIRAVQHLVATAVDGLDPDKVSIVDESGRLLASGASSDDEGMVSARLQERSTAIESRLRN 239

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            + + L + +G    R  V A+++ +        +DP+ +V RS +  ++A  S      
Sbjct: 240 QVEEILNSVVGPGRARVRVNADIDFNRLTETTETFDPEGQVVRSTQSKEEATSSTRQD-- 297

Query: 304 SAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVV 363
             VTV   +P+    +       + +   EE  NYEI+  +     +  ++ RLS+AV+V
Sbjct: 298 GQVTVGNELPNADANQNNDAEEQDTSSLTEEIVNYEISRSTRTEVVEAGRITRLSVAVLV 357

Query: 364 NKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGT 423
           +    T+  G S    +    L  I  +V +A G +  RGD + + ++ F      +   
Sbjct: 358 DGTYQTDEDGNSIYTPRAQEALDRIAVLVRSAVGFDEARGDVVEVINLQFALPPELDIA- 416

Query: 424 VQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPP 483
                 D             V  +  +L+    +  L R     + ++          P 
Sbjct: 417 EPDGLFDFTRSDIMRFAELGVLFLIAILLLLFVVRPLLRRIVTPEERQ----------PQ 466

Query: 484 PISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFA 543
            +       L+ +  +  +   +D F      Q++    +   S  ++  MI  +     
Sbjct: 467 ELVIGPDGTLVADSEVPKEEEEEDEFVIEWLEQAKQEGALQASSIAKVGEMISDHPTEAV 526

Query: 544 KILRKWARSEIE 555
            I+R W   +  
Sbjct: 527 NIVRGWLDEQAA 538


>gi|166712032|ref|ZP_02243239.1| flagellar MS-ring protein [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 574

 Score =  362 bits (928), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 112/568 (19%), Positives = 229/568 (40%), Gaps = 28/568 (4%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           ++  Q+F    SL  TR L + ++I + +   +A  F+   P Y +LY  L+       +
Sbjct: 15  EKAGQWFDRVRSLQITRKLTMMAMIALAVAAGLAVFFWSQKPGYQSLYTGLDEKGNAEAA 74

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L  A I ++I     +ISVP   +  AR+ LA  GL    +  G+EL +K   FG++ 
Sbjct: 75  DLLRTAQIPYKIDQGTGAISVPQDRLYDARLKLAGSGLTGKETGGGFELMEKDPGFGVSQ 134

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INP 182
           F++      ALE E++RTI ++  +  ARVH+ +P   +F +     +ASV++       
Sbjct: 135 FVENARYQHALETELSRTIGTLRPVREARVHLAIPKPSAFTRQRDVASASVVLELRGGQG 194

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL--GKSLSIVQAIQHE 240
                 +AI +LVA+++P++    VTV+D +G++L+  +   +          V+  +  
Sbjct: 195 LERNQVDAIVNLVASSIPDMTPERVTVVDQSGRMLSIADPNSDAAQHAAQFEQVRRQESS 254

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
               I + L    G          +++    +    +Y+ +    RS ++  +   +  +
Sbjct: 255 YNQRIRELLEPMTGPGRVNPETSVDMDFSVVEEARELYNGEPAKLRSEQV--NDTSTTAT 312

Query: 301 QPESAVTVEQN--------------MPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIA 346
            P+       N                  +        +      K    NYE++     
Sbjct: 313 GPQGPPGATSNSPGQPPAPAAAGAPGTPAAANGQATAAAAPTESSKSATRNYELDRTLQH 372

Query: 347 TTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTI 406
           T     +++R+S+AV+++        G+  +Q    + L  I  +V  A G ++ RGDT+
Sbjct: 373 TRQPAGRIKRVSVAVLLDNVPRPGAKGKMVEQPLTAAELTRIEGLVKQAVGFDAARGDTV 432

Query: 407 TITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNI 466
           ++ +  F+   +      +      +       +  LV  V  L + F  +    R    
Sbjct: 433 SVMNAPFVREAVAGEEGPKWWEDPRVQY----GLRLLVGAVVVLALLFGVVRPTLRQLTG 488

Query: 467 DDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQ 526
               K +         P         ++ +++  L    +D  S  +  +  I    + +
Sbjct: 489 VTPIKEKQRKGGNDDTPQN---ADVRMVDDEDSLLPQMGEDTASIGQERKPAIALPDAYE 545

Query: 527 SDLRL-LHMIEINEERFAKILRKWARSE 553
             +R+    ++ + +R A++++ W  SE
Sbjct: 546 ERMRVAREAVKADSKRVAQVVKGWVASE 573


>gi|62180544|ref|YP_216961.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|62128177|gb|AAX65880.1| flagellar biosynthesis; basal-body MS(membrane and
           supramembrane)-ring and collar protein [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|322715020|gb|EFZ06591.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 560

 Score =  362 bits (928), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 126/572 (22%), Positives = 228/572 (39%), Gaps = 52/572 (9%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +  +P Y  L+  L   D   I   L++ 
Sbjct: 14  LEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQM 73

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +R ++   +I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 74  NIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVN 131

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--SA 188
             RALEGE+ARTI+++  + +ARVH+ MP    F +    P+ASV +             
Sbjct: 132 YQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQI 191

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEIEMNINK 247
            A+ HLV++AV  L +G+VT++D +G LLT +    R++    L     ++  I+  I  
Sbjct: 192 SAVVHLVSSAVAGLPLGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEA 251

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PES 304
            L+  +G  N  + V A+L+   ++  E  Y P+    ++   S+    SE      P  
Sbjct: 252 ILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGG 311

Query: 305 AVTVEQNMP---------------------HVSDRKVPLPRSLENTDKKEEQSNYEINTK 343
                 N P                       +        +     ++ E SNYE++  
Sbjct: 312 VPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNSAGPRNTQRNETSNYEVDRT 371

Query: 344 SIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRG 403
              T  +   +ERLS+AVVVN   L +              + +I  +   A G + +RG
Sbjct: 372 IRHTKMNVGDIERLSVAVVVNYKTLADGK----PLPLTADQMKQIEDLTREAMGFSDKRG 427

Query: 404 DTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL 463
           DT+ + +  F                         ++ A  +L+  ++   L   A+R  
Sbjct: 428 DTLNVVNSPFSAVDNTGGELP----FWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQ 483

Query: 464 HNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYV 523
                 +      ++ +                +       ++D     R    R+ + V
Sbjct: 484 LTRRVEEAKAAQEQAQVR------------QETEEAVEVRLSKDEQLQQRRANQRLGAEV 531

Query: 524 SKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
             Q   R+  M + +    A ++R+W  ++ E
Sbjct: 532 MSQ---RIREMSDNDPRVVALVIRQWMSNDHE 560


>gi|161613462|ref|YP_001587427.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|161362826|gb|ABX66594.1| hypothetical protein SPAB_01179 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 531

 Score =  362 bits (928), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 123/542 (22%), Positives = 219/542 (40%), Gaps = 52/542 (9%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R+ LA Q
Sbjct: 15  LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQ 74

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 75  GLPKGGA-VGFELLDQE-KFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 132

Query: 161 MGSFRKIGARPTASVMIRAINPSVYK--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV +              A+ HLV++AV  L  G+VT++D +G LLT
Sbjct: 133 PSLFVREQKSPSASVTVTLEPGRALDEGQISAVVHLVSSAVAGLPPGNVTLVDQSGHLLT 192

Query: 219 ANE-MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIV 277
            +    R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  E  
Sbjct: 193 QSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQTEEH 252

Query: 278 YDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMP--------------------- 313
           Y P+    ++   S+    SE      P        N P                     
Sbjct: 253 YSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNAQNT 312

Query: 314 HVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLG 373
             +        +     ++ E SNYE++     T  +   +ERLS+AVVVN   L +   
Sbjct: 313 PQTSTSTNSNNAGPRNTQRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLADGK- 371

Query: 374 RSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILS 433
                      + +I  +   A G + +RGDT+ + +  F                    
Sbjct: 372 ---PLPLTADQMKQIEDLTREAMGFSDKRGDTLNVVNSPFSAVDNTGGELP----FWQQQ 424

Query: 434 RHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGL 493
                ++ A  +L+  ++   L   A+R        +      ++ +             
Sbjct: 425 SFIDQLLAAGRWLLVLVVAWILWRKAVRPQLTRRVEEAKAAQEQAQVR------------ 472

Query: 494 MPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
              +       ++D     R    R+ + V  Q   R+  M + +    A ++R+W  ++
Sbjct: 473 QETEEAVEVRLSKDEQLQQRRANQRLGAEVMSQ---RIREMSDNDPRVVALVIRQWMSND 529

Query: 554 IE 555
            E
Sbjct: 530 HE 531


>gi|83309602|ref|YP_419866.1| flagellar MS-ring protein [Magnetospirillum magneticum AMB-1]
 gi|82944443|dbj|BAE49307.1| Flagellar biosynthesis/type III secretory pathway lipoprotein
           [Magnetospirillum magneticum AMB-1]
          Length = 574

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 145/555 (26%), Positives = 256/555 (46%), Gaps = 7/555 (1%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           D +  F +    LG  R+  +A V +  +  F+     V +P  + LY  L++ D  +I 
Sbjct: 20  DDVNAFLQMLRGLGPMRLAAIAGVGVSILGFFIYLMSRVAAPQMELLYGDLDLGDSKQII 79

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L+   I + +  +G+ + VP       R+ +A Q LP+    +GYELFDK ++ G TS
Sbjct: 80  EKLTADKIPYELRKDGTEVWVPKDRKLDLRVRMAEQALPAGGRMAGYELFDKQDALGSTS 139

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN--P 182
           F Q IT VRALEGE+++TI+SI  + AARVH+V+P   +F +    P+ASV+I+      
Sbjct: 140 FQQNITMVRALEGELSKTIRSIDRVKAARVHLVLPKREAFSRDTQEPSASVIIKMNGAQR 199

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMER--NILGKSLSIVQAIQHE 240
                  AI+HL+AAAVP +    ++++D  G LL              +  +    + +
Sbjct: 200 LDKGQVSAIQHLIAAAVPKMKPSRISIVDDKGTLLAKGFENSKEYQAQTAEEMKVKTEAK 259

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           +   I   L   LG    R+ V  +++M      E  +DP++KV RS     + ++S+ +
Sbjct: 260 LVKTIEDLLERSLGPGRVRAEVTVDMDMSQATTTEETFDPETKVVRSQVTVNEGEQSQDA 319

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           +P + VTV+QN+P  +       R+    +K +E  NYEI+ K+ +T  +  ++ ++S A
Sbjct: 320 EP-TPVTVQQNLPDPNASSSGNIRTSTKINKNQETVNYEISRKTKSTVREMGEIRKVSAA 378

Query: 361 VVVNKGRLTEVLGRSA-DQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           V+V+  R     G+    + +    L++I  +V +A G    R D + + SM F + +  
Sbjct: 379 VIVDGVREQSADGKQTSYRERTAEELSQIEALVKSAIGYTKDRDDQVKVASMPFYKGEEL 438

Query: 420 NSGTVQVSFMDILSRHF-ATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKS 478
                   F+  + R F   + + L   V  +L   L L  L          +    G+ 
Sbjct: 439 LQAEEPGEFIFGMRRDFVEKIASNLGLSVVAILFLLLVLRPLISRAIESMQGQVGPDGRR 498

Query: 479 ILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEIN 538
           +L+    +    TG       A     +++ +       ++   V   S  ++  ++E +
Sbjct: 499 LLTTDGGAMPQLTGPGAAAMPAPLGGEEEVIADELIDIDKVEGRVKASSIRKIGEIVEKH 558

Query: 539 EERFAKILRKWARSE 553
            E    I+R W   E
Sbjct: 559 PEEALSIIRNWLYQE 573


>gi|161511085|ref|NP_773639.2| flagellar MS-ring protein [Bradyrhizobium japonicum USDA 110]
          Length = 537

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 133/549 (24%), Positives = 227/549 (41%), Gaps = 18/549 (3%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           +         +G  R   + +V    +  F      V +P    L+  L V D + I   
Sbjct: 1   MQGLADFLKGIGAARFGAMIAVTAALVGFFAFVIMRVTTPQMTTLFTDLSVEDSSSIIKD 60

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L    I F + + G+ I VP   V + R+ LA           GYE+FDK ++ G TSF+
Sbjct: 61  LERQAIQFELRNEGTIIMVPKDKVTRLRMKLAEG-GLPKGGGVGYEVFDKSDALGTTSFV 119

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           Q I  +RALEGE+ARTI++I  I AARVH+V+P+   F +    P+AS+++R       +
Sbjct: 120 QNINHLRALEGELARTIRAIDRIQAARVHLVLPERPLFSREAPEPSASIVVRVRGALEAQ 179

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNIN 246
              AIRHLVA+AV  L    V+++D  G+LL                    +  +   + 
Sbjct: 180 QIRAIRHLVASAVNGLKPQRVSIVDEAGQLLADGAATDPEQALGDERRTTFEKRMRKQVE 239

Query: 247 KALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAV 306
             +++ +G    R  + A+ + +        +DP+ +V RS +  ++   S T+     V
Sbjct: 240 DIVSSVVGSGRARVQLSADFDFNKITQTSDKFDPEGRVLRSTQTREE--SSMTADNNGQV 297

Query: 307 TVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG 366
           TV   +P           + + + K EE +NYEI+  +     +  ++ R+S+AV+V+  
Sbjct: 298 TVNNELPGNQQN--NGVAAKDQSKKTEETNNYEISRTTKTEVTEAGRVNRISVAVLVDGI 355

Query: 367 RLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQV 426
                 G  A Q +    L  I  +V +A G + +RGD + + ++ F +           
Sbjct: 356 YSKNDKGELAYQDRTKEQLDRIATLVRSAIGFDQKRGDQVEVVNLRFADAPSTAPIAEPS 415

Query: 427 SFMDILS---RHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPP 483
            F+ +L          +   V ++  L+V F+ +  L +     D     + G       
Sbjct: 416 GFLGMLQFTKDDVMYFVELGVMMLLGLVVLFMVIRPLVKRILASDEVAAAISGVLSGPAA 475

Query: 484 PISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFA 543
              +A   G                 + S    + I   V  QS  R+  + E N     
Sbjct: 476 SDEAAPAAGQAL----------LPGGAASAIDVATIQGQVHAQSVHRVGELAERNPNETV 525

Query: 544 KILRKWARS 552
            I+R+W   
Sbjct: 526 AIIRQWLTE 534


>gi|254470345|ref|ZP_05083749.1| flagellar M-ring protein FliF [Pseudovibrio sp. JE062]
 gi|211960656|gb|EEA95852.1| flagellar M-ring protein FliF [Pseudovibrio sp. JE062]
          Length = 528

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 139/530 (26%), Positives = 238/530 (44%), Gaps = 9/530 (1%)

Query: 28  VILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPS 87
           +  + I LF        +P    L+  L + D   I   +    + + +  NG S+ VP 
Sbjct: 1   MAALLIGLFSFIIVRATAPQMVPLFTDLTLEDAAAIVSQVESQGVSYELGVNGRSVLVPQ 60

Query: 88  SMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSIS 147
             V + R+ LA  GLP S    GYE+FDK ++ G TSF+Q + R RALEGE++RTI+SI 
Sbjct: 61  ENVHRLRMTLAEAGLP-SGGGVGYEIFDKTDTLGATSFVQNLNRTRALEGELSRTIRSIG 119

Query: 148 GIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDV 207
            I +ARVH+V+P+   F++    PTAS+ I+           AI+HLVA AV  L+   V
Sbjct: 120 RIASARVHLVIPEKQLFQRDREPPTASIAIKVQGSLTNGQIRAIQHLVATAVEGLEPSYV 179

Query: 208 TVLDSTGKLL---TANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVA 264
           +++D  G LL   T ++               ++  +   + + L   +G    R  V A
Sbjct: 180 SIVDERGTLLASGTGDKEGLAGGSSLDERRLTMESRLRQQVEEILNNVVGTGRARVRVAA 239

Query: 265 ELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPR 324
           E+N + +   + ++DPD +V RS +  ++   S   +   +V    N    +D       
Sbjct: 240 EINYNRKTETQELFDPDGQVLRSSQSKEENASSTNGEDTVSVG---NQLPNADAAGSSAG 296

Query: 325 SLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSY 384
           S ++++  EE  NYEI+  ++   ++   LERLS+AV+V+    T   G    Q +    
Sbjct: 297 SKDSSNVSEEILNYEISKSTVTEIYEAGGLERLSVAVLVDGTYTTSEDGTQTYQPRSREE 356

Query: 385 LAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALV 444
           L +I  +V  A G +  RGDT+ + +M F+E  L +    +    D             V
Sbjct: 357 LEQIATLVRTAVGFSKHRGDTVEVVNMRFVEAPLSDFADGEGGLFDFTRADIMKFAELGV 416

Query: 445 FLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNI--ALD 502
             V T+L+    +  L +     D +         +   P  + VT      + I   ++
Sbjct: 417 LFVITVLLLIFAVSPLMKRILAKDDEPEAAIEGGGVQMLPDGTLVTESPAQVEGIVGEME 476

Query: 503 SSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARS 552
           +   +I +      +++ + + + S  ++  MIE +      I+R W   
Sbjct: 477 AVPTEIPTAEWIEDAKMQAALHQSSIKQISEMIEDSPSEAVNIVRGWLNE 526


>gi|39648187|emb|CAE26707.1| putative flagellar M-ring protein [Rhodopseudomonas palustris
           CGA009]
          Length = 522

 Score =  361 bits (927), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 134/535 (25%), Positives = 228/535 (42%), Gaps = 21/535 (3%)

Query: 23  LILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSS 82
           + + +V +  +  F      V+ P    LY  L V D + I   L    I F + ++G+ 
Sbjct: 1   MAMIAVTVALVGFFAFVIMRVSQPQMTTLYTDLSVEDSSSIIKELERQGIPFEMRNDGAI 60

Query: 83  ISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIART 142
           + VP   V + R+ LA           GYE+FDK ++ G TSF+Q I  +RALEGE++RT
Sbjct: 61  LLVPKDKVTRLRMKLAEG-GLPKGGGVGYEIFDKSDALGTTSFVQNINHLRALEGELSRT 119

Query: 143 IQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNL 202
           I++I  + AARVH+V+P+   F +    P+AS+++R       +   AIRHLVA+AV  L
Sbjct: 120 IRAIDRVQAARVHLVLPERPLFSREAPEPSASIVLRVRGALEPQQVRAIRHLVASAVNGL 179

Query: 203 DMGDVTVLDSTGKLLTANEMERNI--LGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRS 260
               V+++D  G+LL              S     A +  +   I   +++ +G    R 
Sbjct: 180 KPQRVSIVDEAGQLLADGSASGEQVEGATSDERRAAFEKRMRNQIEGIVSSVVGSGRARV 239

Query: 261 AVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKV 320
            V A+ + +        +DP+ +V RS +  ++   + TS  +  VTV   +P  +  + 
Sbjct: 240 QVSADFDYNKITQTSDKFDPEGRVLRSSQTREE--SAATSAADGQVTVNNELPGAN--QG 295

Query: 321 PLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGK 380
               + + + K EE +NYEI+  +     +  ++ RLS+AV+V+        G      +
Sbjct: 296 QGAGARDVSKKSEETNNYEISRVTKTEVTEAGRVNRLSVAVLVDGAYTKNDKGELVYAER 355

Query: 381 IDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQV---SFMDILSRHFA 437
               L  I  +V +A G + +RGD I + ++ F E                         
Sbjct: 356 PKEQLDRIAALVRSAIGFDQKRGDQIEVVNLKFAEAPQVEKLPEPAGLMGMFQFTKDDIM 415

Query: 438 TVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPND 497
            +I   V  +  L+V F+ +  L +     +      GG   L+   +            
Sbjct: 416 NMIQLGVMFLLGLVVLFMVIRPLVKRILAAEPAPEAAGGLPALADGTVP----------- 464

Query: 498 NIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARS 552
            I  D         S    +++   V  QS  R+  + E N    A I+R+W   
Sbjct: 465 QIGADGQPVPASVPSMIDIAQVQGQVHAQSVHRVGELAERNPNETAAIIRQWLAE 519


>gi|321224614|gb|EFX49677.1| Flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
          Length = 531

 Score =  361 bits (926), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 123/542 (22%), Positives = 220/542 (40%), Gaps = 52/542 (9%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R+ LA Q
Sbjct: 15  LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQ 74

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 75  GLPKGGA-VGFELLDQE-KFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 132

Query: 161 MGSFRKIGARPTASVMIRAINPSVYK--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV +              A+ HLV++AV  L  G+VT++D +G LLT
Sbjct: 133 PSLFVREQKSPSASVTVTLEPGRALDEGQISAVVHLVSSAVAGLPPGNVTLVDQSGHLLT 192

Query: 219 ANE-MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIV 277
            +    R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  E  
Sbjct: 193 QSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQTEEH 252

Query: 278 YDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMP--------------------- 313
           Y P+    ++   S+    SE      P        N P                     
Sbjct: 253 YSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNAQNT 312

Query: 314 HVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLG 373
             +        +   + ++ E SNYE++     T  +   +ERLS+AVVVN   L +   
Sbjct: 313 PQTSTSTNSNSAGPRSTQRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLADGK- 371

Query: 374 RSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILS 433
                      + +I  +   A G + +RGDT+ + +  F                    
Sbjct: 372 ---PLPLTADQMKQIEDLTREAMGFSDKRGDTLNVVNSPFSAVDNTGGELP----FWQQQ 424

Query: 434 RHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGL 493
                ++ A  +L+  ++   L   A+R        +      ++ +             
Sbjct: 425 SFIDQLLAAGRWLLVLVVAWILWRKAVRPQLTRRVEEAKAAQEQAQVR------------ 472

Query: 494 MPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
              +       ++D     R    R+ + V  Q   R+  M + +    A ++R+W  ++
Sbjct: 473 QETEEAVEVRLSKDEQLQQRRANQRLGAEVMSQ---RIREMSDNDPRVVALVIRQWMSND 529

Query: 554 IE 555
            E
Sbjct: 530 HE 531


>gi|326622865|gb|EGE29210.1| flagellar M-ring protein FliF [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 531

 Score =  361 bits (926), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 123/542 (22%), Positives = 219/542 (40%), Gaps = 52/542 (9%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R+ LA Q
Sbjct: 15  LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQ 74

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 75  GLPKGGA-VGFELLDQE-KFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 132

Query: 161 MGSFRKIGARPTASVMIRAINPSVYK--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV +              A+ HLV++AV  L  G+VT++D +G LLT
Sbjct: 133 PSLFVREQKSPSASVTVTLEPGRALDEGQISAVVHLVSSAVAGLPPGNVTLVDQSGHLLT 192

Query: 219 ANE-MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIV 277
            +    R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  E  
Sbjct: 193 QSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQTEEH 252

Query: 278 YDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMP--------------------- 313
           Y P+    ++   S+    SE      P        N P                     
Sbjct: 253 YSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNAQNT 312

Query: 314 HVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLG 373
             +        +     ++ E SNYE++     T  +   +ERLS+AVVVN   L +   
Sbjct: 313 PQTSTSTNSNSAGPRNTQRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLADGK- 371

Query: 374 RSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILS 433
                      + +I  +   A G + +RGDT+ + +  F                    
Sbjct: 372 ---PLPLTADQMKQIEDLTREAMGFSDKRGDTLNVVNSPFSAVDNTGGELP----FWQQQ 424

Query: 434 RHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGL 493
                ++ A  +L+  ++   L   A+R        +      ++ +             
Sbjct: 425 SFIDQLLAAGRWLLVLVVAWILWRKAVRPQLTRRVEEAKAAQEQAQVR------------ 472

Query: 494 MPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
              +       ++D     R    R+ + V  Q   R+  M + +    A ++R+W  ++
Sbjct: 473 QETEEAVEVRLSKDEQLQQRRANQRLGAEVMSQ---RIREMSDNDPRVVALVIRQWMSND 529

Query: 554 IE 555
            E
Sbjct: 530 HE 531


>gi|89899361|ref|YP_521832.1| flagellar M-ring protein FliF [Rhodoferax ferrireducens T118]
 gi|89344098|gb|ABD68301.1| flagellar M-ring protein FliF [Rhodoferax ferrireducens T118]
          Length = 588

 Score =  361 bits (926), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 114/566 (20%), Positives = 213/566 (37%), Gaps = 43/566 (7%)

Query: 10  FFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSE 69
             +  + L + + L +   ++V + + +          +  LY  L   D   I   L+ 
Sbjct: 41  LSQRFSGLDQGQRLRMGLGLVVFVAIGIIGLMMGRQAEWRVLYANLADKDGGAIVAQLTT 100

Query: 70  ANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEI 129
            N+ ++ +D G +I VP+  V   R+ LA+QGLP   + +G+E  D    FG+T F + +
Sbjct: 101 MNVPYKYADGGGAILVPADKVYDTRLRLASQGLPK-GAVAGFETMDAN-RFGMTQFQERL 158

Query: 130 TRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--S 187
              R LEGE+ R+IQ++S + +ARVH+ +P+   F +   +P+ASV++            
Sbjct: 159 AFQRGLEGELTRSIQALSSVQSARVHLALPNQNGFFREQQKPSASVLVSLNAGRTLDRAQ 218

Query: 188 AEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG----KSLSIVQAIQHEIEM 243
              I HLV+++VP ++   V+VLD +GKLL+      +  G    + L  VQ ++     
Sbjct: 219 LAGIVHLVSSSVPEMNASAVSVLDDSGKLLSTPPEGADGAGGGDAQQLQYVQQLEQLYSR 278

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS--- 300
            I   L   +G  N R+ V AEL+    +     + P+   + S   S+    S      
Sbjct: 279 RILDILEPVVGRGNARAQVTAELDFSQTESTSESHKPNQTPDSSAIRSQQVSESSNGSGI 338

Query: 301 --QPESAVTVEQNMPHVSDRKVPLPRSLENTD-----------KKEEQSNYEINTKSIAT 347
              P        N P               T            ++E   NYE++      
Sbjct: 339 SGPPSGVPGATSNKPPGPSSAPINGAPQTLTAAGAGASAGAGGRRESIINYEVDKTVKVV 398

Query: 348 THDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTIT 407
                 ++R+S AVVVN   +T+  G++         + ++  +V    G N  RGD++ 
Sbjct: 399 RGGTGIVKRISAAVVVNHQSVTDAKGKTTTTPLSAQQIEQMTALVRETVGFNKERGDSVN 458

Query: 408 ITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNID 467
           + +  F   +      +       +     ++   L  L+   LV    +    +     
Sbjct: 459 LMNAPFT-TERVVPVDLPFWKQSEIQDLARSLAWPLGTLLFGALVLLGVIRPALKTL--- 514

Query: 468 DAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQS 527
                                ++      + I  ++  +   +              + +
Sbjct: 515 ---------------AQSQPRISASSHQLNAIESEAPERAQLAAPARSSELAGPTSGELA 559

Query: 528 DLRLLHMIEINEERFAKILRKWARSE 553
                 +   N    A I++ W   E
Sbjct: 560 LDDARKLTRDNPAAVANIVKTWINGE 585


>gi|308187290|ref|YP_003931421.1| Flagellar M-ring protein [Pantoea vagans C9-1]
 gi|308057800|gb|ADO09972.1| Flagellar M-ring protein [Pantoea vagans C9-1]
          Length = 575

 Score =  361 bits (926), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 136/586 (23%), Positives = 237/586 (40%), Gaps = 57/586 (9%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
            +   F      L     + L       + + +A   +   P Y  LY  L   D   I 
Sbjct: 11  QEKKGFGDLLARLRANPRIPLIVAAAAVVAIVIAMVLWAKQPSYSVLYNNLTDEDGGAIV 70

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L++ NI +R ++NG ++ VP + V + R+ LA QGLP   S  G+EL DK   FG++ 
Sbjct: 71  TQLTQMNIPYRFAENGGALIVPEANVHELRLRLAQQGLPKGGS-VGFELLDKE-KFGISQ 128

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV 184
           F +++   RALEGE+ARTI+S+  + +ARVH+ MP    F +    P+ASV +       
Sbjct: 129 FSEQVNYQRALEGELARTIESLGPVKSARVHLAMPKPTLFVREQKAPSASVTLTLQPGRA 188

Query: 185 YK--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEI 241
                 +AI H+V+++V  L  G+VTV+D TG+LLT ++   R++    L     ++   
Sbjct: 189 LDEGQIQAIAHMVSSSVAGLPPGNVTVVDQTGRLLTRSDNAGRDLNDAQLKYSSEVEARY 248

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
           +  I   L   LG  N  + V A++N DT +  +  Y P++    +   S+    S+ S 
Sbjct: 249 QQRIEAILNPILGQGNVHAQVTAQINFDTSEQTDEKYQPNANPSNTAIRSRQTSTSDQSG 308

Query: 302 ---PESAVTVEQNMPHVSDRKVPLPR------------------------------SLEN 328
              P        N P  ++                                     S   
Sbjct: 309 SPYPGGVPGALSNQPAPANTAPVTTPNNNAANGQNANGQNNAANNASQTTSTAAASSAPT 368

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEI 388
             ++++  NYE++     T  +   ++RLS+AVVVN         +       +  L +I
Sbjct: 369 NSRRDDTVNYELDRSIRHTKVNVGDVQRLSVAVVVN----FRADDKGKAVALNEQQLKQI 424

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
             +   A G +  RGD++ + +  F   +   +              F  ++NA  +L+ 
Sbjct: 425 EDLTREAMGYSQTRGDSVNVVNSQFNTTEAVTADLP----FWQQQSFFDQLMNAGKWLLI 480

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
            L+   L    +R                +  +     +A      P +       ++D 
Sbjct: 481 ALVAFILYRKLVRPHL--------VRKQAAEKAAAEAVAARAAAQQPEEEAFNVQLSKDE 532

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
               R   +R+++ V  Q   R+  M E +    A ++R+W   E+
Sbjct: 533 LDQERKSNNRMSAEVMSQ---RIRDMSENDPRVVALVIREWMSKEL 575


>gi|213053157|ref|ZP_03346035.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|289829461|ref|ZP_06547073.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
          Length = 531

 Score =  361 bits (926), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 122/542 (22%), Positives = 218/542 (40%), Gaps = 52/542 (9%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  L+  L   D   I   L++ NI +R ++   +I VP+  V + R+ LA Q
Sbjct: 15  LWAKTPDYRTLFSNLSDQDGGAIVAQLTQMNIPYRFANGSGAIEVPADKVHELRLRLAQQ 74

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ MP 
Sbjct: 75  GLPKGGA-VGFELLDQE-KFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAMPK 132

Query: 161 MGSFRKIGARPTASVMIRAINPSVYK--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV +              A+ HLV++AV  L  G+VT++D +G LLT
Sbjct: 133 PSLFVREQKSPSASVTVTLEPGRALDEGQISAVVHLVSSAVAGLPPGNVTLVDQSGHLLT 192

Query: 219 ANE-MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIV 277
            +    R++    L     ++  I+  I   L+  +G  N  + V A+L+   ++  E  
Sbjct: 193 QSNTSGRDLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQTEEH 252

Query: 278 YDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMP--------------------- 313
           Y P+    ++   S+    SE      P        N P                     
Sbjct: 253 YSPNGDASKATLRSRQLNISEQVGAGYPGGVPGALSNQPAPPNEAPIATPPTNQQNAQNT 312

Query: 314 HVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLG 373
             +        +     ++ E SNYE++     T  +   +ERLS+AVVVN   L +   
Sbjct: 313 PQTSTSTNSNNAGPRNTQRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKTLADGK- 371

Query: 374 RSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILS 433
                      + +I  +   A G + +RGDT+ + +  F                    
Sbjct: 372 ---PLPLTADQMKQIEDLTREAMGFSDKRGDTLNVVNSPFSAVDNTGGELP----FWQQQ 424

Query: 434 RHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGL 493
                ++ A  +L+  ++   L   A+         +      ++ +             
Sbjct: 425 SFIDQLLAAGRWLLVLVVAWILWRKAVHPQLTRRVEEAKAAQEQAQVR------------ 472

Query: 494 MPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
              +       ++D     R    R+ + V  Q   R+  M + +    A ++R+W  ++
Sbjct: 473 QETEEAVEVRLSKDEQLQQRRANQRLGAEVMSQ---RIREMSDNDPRVVALVIRQWMSND 529

Query: 554 IE 555
            E
Sbjct: 530 HE 531


>gi|58582224|ref|YP_201240.1| flagellar MS-ring protein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84624117|ref|YP_451489.1| flagellar MS-ring protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188576784|ref|YP_001913713.1| flagellar MS-ring protein [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188576976|ref|YP_001913905.1| flagellar MS-ring protein [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|58426818|gb|AAW75855.1| flagellar protein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84368057|dbj|BAE69215.1| flagellar protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188521236|gb|ACD59181.1| flagellar M-ring protein FliF [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188521428|gb|ACD59373.1| flagellar M-ring protein FliF [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 574

 Score =  361 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 112/568 (19%), Positives = 230/568 (40%), Gaps = 28/568 (4%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           ++  Q+F   +SL  TR L + ++I + +   +A  F+   P Y +LY  L+       +
Sbjct: 15  EKAGQWFDRVSSLQITRKLTMMAMIALAVAAGLAVFFWSQKPGYQSLYTGLDEKGNAEAA 74

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L  A I ++I     +ISVP   +  AR+ LA  GL    +  G+EL +K   FG++ 
Sbjct: 75  DLLRTAQIPYKIDQGTGAISVPQDRLYDARLKLAGSGLTGKETGGGFELMEKDPGFGVSQ 134

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INP 182
           F++      ALE E++RTI ++  +  ARVH+ +P   +F +     +ASV++       
Sbjct: 135 FVENARYQHALETELSRTIGTLRPVREARVHLAIPKPSAFTRQRDVASASVVLELRGGQG 194

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL--GKSLSIVQAIQHE 240
                 +AI +LVA+++PN+    VTV+D +G++L+  +   +          V+  +  
Sbjct: 195 LERNQVDAIVNLVASSIPNITPERVTVVDQSGRMLSIADPNSDAAQHAAQFEQVRRQESS 254

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
               I + L    G          +++    +    +Y+ +    RS ++  +   +  +
Sbjct: 255 YNQRIRELLEPMTGPGRVNPETSVDMDFSVVEEARELYNGEPAKLRSEQV--NDTSTTAT 312

Query: 301 QPESAVTVEQN--------------MPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIA 346
            P+       N                  +        +      K    NYE++     
Sbjct: 313 GPQGPPGATSNSPGQPPAPAAAGAPGTPAAANGQATAAAAPTESSKSATRNYELDRTLQH 372

Query: 347 TTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTI 406
           T     +++R+S+AV+++        G+  +Q    + L  I  +V  A G ++ RGDT+
Sbjct: 373 TRQPAGRIKRVSVAVLLDNVPRPGAKGKMVEQPLTAAELTRIEGLVKQAVGFDAARGDTV 432

Query: 407 TITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNI 466
           ++ +  F+   +      +      +       +  LV  +  L + F  +    R    
Sbjct: 433 SVMNAPFVREAVAGEEGPKWWEDPRVQN----GLRLLVGALVVLALLFGVVRPTLRQLTG 488

Query: 467 DDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQ 526
               K +         P         ++ +++  L    +D  S  +  +  I    + +
Sbjct: 489 VTPIKEKQRKGGNDGTPQS---ADVRMVDDEDSLLPHMGEDTASIGQERKPAIALPDAYE 545

Query: 527 SDLRL-LHMIEINEERFAKILRKWARSE 553
             +R+    ++ + +R A++++ W  SE
Sbjct: 546 ERMRVAREAVKADSKRVAQVVKGWVASE 573


>gi|56384261|gb|AAV85779.1| FliF [Azospirillum brasilense]
          Length = 521

 Score =  361 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 150/519 (28%), Positives = 255/519 (49%), Gaps = 10/519 (1%)

Query: 43  VNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGL 102
           +++P  + LY +L+ ++   I+  L EA + F +   G+ I V +  VG  R+ +AA GL
Sbjct: 4   LSTPEMELLYAELQPTEAAAIAKKLEEAKVPFTVDKTGTKIMVAAEQVGPTRMRMAAAGL 63

Query: 103 PSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMG 162
           P S  + GYELFDK   FG TSFMQ I  +RALEGE+ART+Q+++G+ +ARVH+V+P   
Sbjct: 64  P-SGGSIGYELFDKGEGFGATSFMQNINHLRALEGEMARTVQTLNGVQSARVHLVLPKRE 122

Query: 163 SFRKIGARPTASVM--IRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL--- 217
            F +     TAS+   +R       ++ +AI+HL+AA+VPNLD   ++++D  G LL   
Sbjct: 123 LFARQQNPATASIFIKLRPGAQLSRENIQAIQHLIAASVPNLDPSRISIVDDKGTLLARG 182

Query: 218 TANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIV 277
           T N+    +L  +     A +  +   I   L   +G    R+ V A+L+ D    +  +
Sbjct: 183 TGNDSADAMLASAEEKKVAYESRVARIIEDLLGRTVGYGKVRAEVSADLDFDRITTQSEI 242

Query: 278 YDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSN 337
           +DP+S+V RS +   +A  S    P S VTV+QN+P         P S    ++ EE  N
Sbjct: 243 FDPESQVVRSTQTVTEANESHDRDPLSPVTVDQNLPTAQSGNNAGPISQNKQNRSEETIN 302

Query: 338 YEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRS-ADQGKIDSYLAEINKIVSAAT 396
           YEI+  +     ++ ++ RLS+AV+V+        G   A Q + +  L  I  +V +A 
Sbjct: 303 YEISRTTKNHVRESGQVRRLSVAVLVDGTYSLPRDGNPAAYQPRPEQELESIKALVRSAV 362

Query: 397 GINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLG 456
           G+++ RGDT+ + +M F   +       ++ F+ +       +   +V  +  +L+  L 
Sbjct: 363 GLDAVRGDTLEVINMRFWSPEDDVQKPEEL-FLGMTKDDLFRIAEMVVLGIVAVLIILLV 421

Query: 457 LHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGL--MPNDNIALDSSNQDIFSHSRN 514
           +  L         ++ E     +L+      A           ++AL+++  D       
Sbjct: 422 IRPLITRAFEKADQQEEDDMDRLLADQSGMPAALAAPTGALAQDLALEAAQADEELEQMI 481

Query: 515 LQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
             +R+   V   S  ++  ++E + E    ILR W   E
Sbjct: 482 DINRVEGRVRASSLRKVGEIVEKHPEEAVSILRNWLYQE 520


>gi|226941278|ref|YP_002796352.1| FliF1 [Laribacter hongkongensis HLHK9]
 gi|226716205|gb|ACO75343.1| FliF1 [Laribacter hongkongensis HLHK9]
          Length = 571

 Score =  361 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 113/579 (19%), Positives = 230/579 (39%), Gaps = 44/579 (7%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
               ++ +  +   +L   + L+L   +     + +AA  +   P Y  L+  L   +  
Sbjct: 11  TFQQRVREALERYRALPGNKKLLLFGGMAAVASILVAAYLYTREPAYKVLFSNLPDREGG 70

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           +++ AL++ N+ ++++ +G  I VP+  V   R+ LA++GLP +S   G+EL D    FG
Sbjct: 71  QVTEALTKLNVPYQLA-DGGVIRVPAEQVYSTRLKLASEGLPKASG-IGFELMDN-QKFG 127

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           ++ F +++   RA+EGE+ARTI+++  + +ARVH+ MP    F +    PTASV++    
Sbjct: 128 ISQFAEQVNYQRAVEGELARTIEALGVVESARVHLAMPKQSVFVREQQLPTASVLLNLRP 187

Query: 182 P--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTAN----EMERNILGKSLSIVQ 235
                      IR+LVA+AVP L   ++T++D  G L++      +    +  + L  V+
Sbjct: 188 GFILDAGQIAGIRNLVASAVPGLPQKNITIVDQEGNLISRMPDMEDGSAGLSRRQLDYVR 247

Query: 236 AIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQ 295
            I+  +   I   L   +G  N R+ V A ++    +     ++P++        S+   
Sbjct: 248 QIETSLTKRIEAILEPIVGSGNARAQVTAAVDFSEVEQTAETFNPNTPPNAGAIRSQQTS 307

Query: 296 RSE---TSQPESAVTVEQNMPHV-----------------SDRKVPLPRSLENTDKKEEQ 335
            S+    +          N P                           ++      KE  
Sbjct: 308 ESQTREEAPQGGVPGALSNQPPNAAAAPVTLPPGTQAGLMPAPNGQQNQARPVKSSKEAT 367

Query: 336 SNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAA 395
           +NYE++            L+R++ AVVVN  R T   G +      +  + +++K+V  A
Sbjct: 368 TNYEVDRTIQHVRQQTGALKRVTAAVVVNFKRTTTADGNAKMTPLSEQEMQQLDKLVREA 427

Query: 396 TGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFL 455
            G    RGD++ + +  F +     +   Q    D  S +   ++  ++  +  L + F 
Sbjct: 428 MGFTQARGDSVQVVNASFADTAGSKAAL-QDRLFDYASNNPGEILKWVLGALVVLYLLFG 486

Query: 456 GLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNL 515
            +  + R            G  +  +     +      + +                   
Sbjct: 487 VIRPVVRDIVKPKPVLPPPGSDAAAAEGEGVAGEGGMTLEDLANL--------------D 532

Query: 516 QSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
              +              ++  +    A+I+++W  ++ 
Sbjct: 533 PKELARREYDSMLEGARQVVRADPRMAAQIIKEWVNNDE 571


>gi|114330758|ref|YP_746980.1| flagellar M-ring protein FliF [Nitrosomonas eutropha C91]
 gi|114307772|gb|ABI59015.1| flagellar M-ring protein FliF [Nitrosomonas eutropha C91]
          Length = 547

 Score =  361 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 123/566 (21%), Positives = 212/566 (37%), Gaps = 47/566 (8%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
            +          L   + L L       I LF     +  +P Y  LY  L   +   I 
Sbjct: 12  KKAFSQLDKIKQLPAQKKLGLMVAAAAVIALFAGTWLWSQTPDYRVLYANLSEQEGGAII 71

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
            AL + N+ ++ S++  SI VP + V + R+HLA QGLP   + SG+E+  +   FG + 
Sbjct: 72  DALQKMNVPYQFSESSGSILVPVNQVHEVRLHLAGQGLPK-GNLSGFEIL-ENQKFGSSQ 129

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INP 182
           F++++   RALEGE+AR+IQS+S +  ARVH+ +     F +   +P+ SV++       
Sbjct: 130 FLEQVNYQRALEGELARSIQSLSAVQGARVHLAIARPSVFTRERQQPSVSVLLNLHHGRM 189

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG---KSLSIVQAIQH 239
              +   AI HLV++++P+L + +VTV+D  G LL+  +  +   G     L  VQ ++ 
Sbjct: 190 LSPEQVSAIVHLVSSSIPDLTVKNVTVVDQQGNLLSGQKENQMETGLDPGQLKYVQDMEQ 249

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERS---IRLSKDAQR 296
                I   L    G DN  + V A+++    +  E  Y P++  E S       K    
Sbjct: 250 NFVRRIEAILTPVTGQDNVHAQVTADIDFSRIERSEETYRPNNNPEESAAVRSQQKSESV 309

Query: 297 SETSQPESAVTVEQNMPHVSDRKV--------PLPRSLENTDKKEEQSNYEINTKSIATT 348
           S +           N P    +             ++     +KE  +NYE++       
Sbjct: 310 SISQPDGGVPGALSNRPPAPAQAPVETKEGQEETAQTTPTDTRKESTTNYEVDKTISHIR 369

Query: 349 HDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITI 408
               ++ RLS AVVVN        G   ++      + +I  +V  A G +  RGDT+T+
Sbjct: 370 QSTGQINRLSAAVVVNYRTRMNEEGNPINEPLSGEEIEKITALVKQAIGFSEARGDTLTV 429

Query: 409 TSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDD 468
           T+  F   +            D          +    L+   +V F      R       
Sbjct: 430 TNSQFRLKEEILEELPLWKDPDT----VLLAKDIGKQLLIAAIVLFFLQKIFRPFLKNLL 485

Query: 469 AKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSD 528
                    ++ +                                   + I     +Q+ 
Sbjct: 486 PPPPPAPVPALTAKDSEQDEAA-------------------------INTIKVMTLEQNL 520

Query: 529 LRLLHMIEINEERFAKILRKWARSEI 554
            +   +        A +++ W     
Sbjct: 521 EKARLLAANEPAIVANVVKGWVSGNE 546


>gi|207728374|ref|YP_002256768.1| flagellar m-ring protein [Ralstonia solanacearum MolK2]
 gi|206591620|emb|CAQ57232.1| flagellar m-ring protein [Ralstonia solanacearum MolK2]
          Length = 614

 Score =  361 bits (925), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 125/556 (22%), Positives = 230/556 (41%), Gaps = 50/556 (8%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +  +P Y  LY  +  SD   I  AL + N+ +R +D  S+I VP + V + R+ LAAQ
Sbjct: 66  LWSRAPDYRVLYSNVADSDGGAIIAALQQMNVPYRFADGDSAIMVPEANVHEVRLKLAAQ 125

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP     +G+EL  +   FG + F +++   RALEGE+ARTIQ++  + +ARVH+ +  
Sbjct: 126 GLPKGGL-AGFELM-ENQKFGTSQFAEQVNYQRALEGELARTIQAMQEVQSARVHLALSK 183

Query: 161 MGSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +  A+P+ASV+++            +AI HLV+++VPNL + +VTV+D +G+LL+
Sbjct: 184 PSVFVREQAKPSASVLLKLYPGRMLDRSQVQAIGHLVSSSVPNLPLANVTVVDQSGRLLS 243

Query: 219 A--NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI 276
           +   +    +    L+ V+ I+      I   L   +G DN R+ V A++++D  +    
Sbjct: 244 SSFQDNASGLDPTQLNYVRDIEQGYIKRIEAILGPVVGDDNVRAQVTADVDLDNTEQMAE 303

Query: 277 VYDPDSKVERSIRLSKDAQRSETSQP---ESAVTVEQNMPHVSDRKVPL----------- 322
            Y P+      +  S     S  ++            N P  + R +P            
Sbjct: 304 TYRPNQDPANGVVRSTHTSESTQNKAGAQGGVPGALSNQPPTAPRMLPTAPAPASQQAAA 363

Query: 323 ------------------------PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLS 358
                                     +   +  ++   NYE++     T      + RLS
Sbjct: 364 GQNGQNGQNAPNGQQQAAAAAGQAATNSVESSARDTTVNYEVDKTVRRTRAAVGTVRRLS 423

Query: 359 IAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQL 418
           +AVVVN             +   D+ + ++N +V  A G +++RGD++ + +  F     
Sbjct: 424 VAVVVNYRA-----DGKTWKPLSDADMVKLNALVKDAVGYDAKRGDSVNVVNSQFSGTLP 478

Query: 419 FNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA-KKGEVGGK 477
            +   + +     +  +           +G L++ F  +  L R  N  +        G+
Sbjct: 479 MSRDDLPLWKQPEMIHYAIQAAKYGALAIGFLILVFAVIRPLIRSMNKKEELATATFVGR 538

Query: 478 SILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEI 537
               P              +     +S  D  +    L     ++  +Q    +  + + 
Sbjct: 539 EGDDPNAPIITGAAAPAGPELEGPSASAADGNAVPEELPQLKQNHEFEQKLETMRRIAQQ 598

Query: 538 NEERFAKILRKWARSE 553
           N    A ++++W   E
Sbjct: 599 NPRAVAAVIKQWVSIE 614


>gi|288962688|ref|YP_003452982.1| flagellar M-ring protein [Azospirillum sp. B510]
 gi|288914954|dbj|BAI76438.1| flagellar M-ring protein [Azospirillum sp. B510]
          Length = 579

 Score =  360 bits (924), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 171/574 (29%), Positives = 269/574 (46%), Gaps = 28/574 (4%)

Query: 9   QFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALS 68
               +  SLGR R+L+LA   L  ++        ++ PH   LY  LE ++  RI+ A+ 
Sbjct: 7   SLIDTLRSLGRGRLLVLAGTGLGIVLAVAGMALLLSQPHMTALYSGLEPAEAGRIAKAVQ 66

Query: 69  EANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQE 128
           E  +      +G++ISVP + V + R+ LA +GLPS     GYELFD     G+TSFMQ 
Sbjct: 67  EMGVPVNAGFDGTTISVPQADVSRVRMALAEKGLPSRGG-VGYELFDTDKPLGITSFMQR 125

Query: 129 ITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP--SVYK 186
           I R+RA+EGE+ RTI+++SG+ AARVHIV+P+   F +   +PTASV++R         K
Sbjct: 126 INRLRAMEGELGRTIETLSGVEAARVHIVLPEREEFSRSAPKPTASVVVRMRGRAAMDRK 185

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLS-IVQAIQHEIEMNI 245
            A +IRHLV+AAVPNL    VTV+DS+G+LL   +    +       +  A +  +   +
Sbjct: 186 QALSIRHLVSAAVPNLKPSAVTVMDSSGELLLTEDDGPGLASARTDGLRVAAETRVARAV 245

Query: 246 NKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESA 305
            + L A LG  N R  V AE+    + +R   +DP+S+V RS +  ++ +RS+ S  E  
Sbjct: 246 EQMLTARLGAGNVRVQVAAEVETKREVVRSQSFDPNSQVVRSTQTVQEQERSQDSNGEPP 305

Query: 306 VTVEQNMPH-VSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVN 364
           VT EQN+P      +   P+S  +T ++EE  NYEI+  S  T  +   + RLS+AV+VN
Sbjct: 306 VTAEQNLPQRDVRAQSQGPQSSNDTKRQEETVNYEISNVSRETVIEPGDVRRLSVAVLVN 365

Query: 365 KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTV 424
               T   G    + +    L  + ++V +A G +  RGD +T+ +++F++     +   
Sbjct: 366 GTWKTAPDGTRQYEPRSTEELRRLGELVRSAMGFSEARGDRVTVDNLEFVDLAPDLTPRP 425

Query: 425 -QVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPP 483
                 + L+R+  T+I  ++ LV + LV  +GL  L R                 L+ P
Sbjct: 426 LGDEIAETLTRNIMTLIQWVILLVLSALVILVGLRPLIRRVFPAPGPVAAEASAPALAAP 485

Query: 484 PISSAVT----------------------TGLMPNDNIALDSSNQDIFSHSRNLQSRINS 521
                                                        +           +  
Sbjct: 486 AGGPMPQLTGPAIAGAGAAGLAPADAGEAEAAAFGAAPMAPQLGIEETMDQLIELRTVEG 545

Query: 522 YVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
            V   S  RL  +++   +    ILR W   E+ 
Sbjct: 546 RVRASSIRRLGELVDQYPDEAIDILRSWLYEEVA 579


>gi|323139667|ref|ZP_08074709.1| flagellar M-ring protein FliF [Methylocystis sp. ATCC 49242]
 gi|322395099|gb|EFX97658.1| flagellar M-ring protein FliF [Methylocystis sp. ATCC 49242]
          Length = 565

 Score =  360 bits (924), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 196/554 (35%), Positives = 311/554 (56%), Gaps = 6/554 (1%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           +D++     +  +LG  ++  L     + + +   + ++++ P ++ LY  L+  DV+RI
Sbjct: 13  MDRITLLLDNLKALGTRKLAALGLTFALVVAIVSISAYYLSRPTFEVLYAGLDREDVSRI 72

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
              L    I F I+  G+++SVP     +AR+ LA +GLP S +N+GYELFDKV + GLT
Sbjct: 73  GSVLKSTGIPFDINTEGNAVSVPYGQTAQARMLLAERGLPQS-ANAGYELFDKVGALGLT 131

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS 183
           SFMQE+TRVRALEGE+ARTIQ I G+ AARVHIVMPD GSFR+    P+ASV+IR   P 
Sbjct: 132 SFMQEVTRVRALEGELARTIQLIRGVKAARVHIVMPDEGSFRRAKQPPSASVIIRTEGPD 191

Query: 184 VYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG--KSLSIVQAIQHEI 241
              +A+AIRHLVA+++P +++  VTVL++ G +L++++ +       K+L++ + IQ +I
Sbjct: 192 DTSAAQAIRHLVASSLPGMNVDQVTVLNTDGMILSSSDGDATDAVPVKTLTLEKNIQKDI 251

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
           + NI + L  +L + NF+  V A +N D +QI E +YDPDSKVERS+R  K++ RS+ S 
Sbjct: 252 QDNIRRTLTPYLRLPNFQVTVRARVNTDRKQINETIYDPDSKVERSVRTVKESSRSQDSS 311

Query: 302 PESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAV 361
             +A TV  N+P          +S +   K EE +NYE+++K++ T    Y +E LS+AV
Sbjct: 312 SAAATTVTNNIPQNGVNNADGKQSNDENKKNEELTNYEMSSKTVTTVSGGYNIEHLSVAV 371

Query: 362 VVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNS 421
           ++N+    E       Q  ID  L EI +++S+A G+   RGD + +T++DF+ N+   +
Sbjct: 372 LINRSAFAEPNKEPPKQEAIDRQLKEIEQLISSAAGLKKERGDALKVTAVDFMFNEHEMT 431

Query: 422 GTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILS 481
                 F+ +L  H  +++N +  L    LV   GL   RR    + + +       I  
Sbjct: 432 PVESPGFVAMLGSHLGSILNMIAALGIAALVVIFGLAPARRALLAESSTERTEPPPLIGM 491

Query: 482 PPPISSAVTTGLMPNDNI---ALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEIN 538
                 + T      D I   A  +    I      L   I+      +  +L  +I+ +
Sbjct: 492 GDQSFESPTFEAPTFDGIPGLAGATPGGAIAMSGPTLLEDISERRQDIARRKLEELIQND 551

Query: 539 EERFAKILRKWARS 552
           E + A IL++W RS
Sbjct: 552 EAQAAAILKQWMRS 565


>gi|163757999|ref|ZP_02165087.1| flagellar M-ring protein [Hoeflea phototrophica DFL-43]
 gi|162284288|gb|EDQ34571.1| flagellar M-ring protein [Hoeflea phototrophica DFL-43]
          Length = 560

 Score =  360 bits (924), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 240/561 (42%), Positives = 349/561 (62%), Gaps = 7/561 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M++L+QL Q  K+  SLG+ R+L L  V    + L +AA  F+N P  + LY+ L   D+
Sbjct: 1   MSLLNQLSQIGKNLASLGQARMLTLGGVGAASVALIIAAALFLNKPARETLYIGLSGEDM 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
            +IS+ L+E+NIDF    +G+SI+VP+ M  +AR+ LA +GLP SS+ +GYELFDKV S 
Sbjct: 61  TQISLVLAESNIDFASGLDGNSITVPAGMTSRARMLLAERGLP-SSNTAGYELFDKVGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQSI+GI AARVH+VM D G+FR+   +P+ASVM+R  
Sbjct: 120 GLTSFMQEVTRVRALEGEIARTIQSINGISAARVHLVMADRGNFRRGEQQPSASVMVRTG 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL-GKSLSIVQAIQH 239
                ++A +IRHLVA++VP L++ +VTVLD+TG+LL   +   N    +SLSIVQ +Q+
Sbjct: 180 TNLAPRTANSIRHLVASSVPGLNVDEVTVLDATGQLLATGDDFSNSNLNRSLSIVQLVQN 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           E+E NI KALA FLG++NFR++V A +N D+QQ++E ++DP+S+VERS R++++ Q S  
Sbjct: 240 EVETNIEKALAPFLGIENFRASVTATVNTDSQQVQETIFDPESRVERSTRVTRENQTSNQ 299

Query: 300 SQPESAVTVEQNMPHV--SDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
           S  ++  TVEQN+P    +      P+S E  ++KEEQ+NYEIN+K I+T  ++Y +E L
Sbjct: 300 SATDTPATVEQNIPDQGPAAGGAAGPQSSELAERKEEQTNYEINSKVISTVRNSYTVEGL 359

Query: 358 SIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           S+AVVVN+ R+ ++ G +  + +  ++LAE+  +V+ A G++  RGD   IT MDF+ ++
Sbjct: 360 SVAVVVNRARIADMYGGAPTEEQTAAFLAEVQTLVNLAAGVDDERGDRANITVMDFMASE 419

Query: 418 LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGK 477
           L  +   Q  F D L  H  T+INA+ F+   +L+   G   L       +  +  V   
Sbjct: 420 LLTADAAQGGFGDTLKTHIGTIINAIAFITVAVLLIMFGFRPLLGAGKTAEQAEDAVDDI 479

Query: 478 SILSP---PPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHM 534
            +  P   P          M                         N  V +  + RL  M
Sbjct: 480 GLELPDFSPAAMGGPGAMPMEGFGADFGFGEDGDSELEMEESGSFNRRVKEGPERRLARM 539

Query: 535 IEINEERFAKILRKWARSEIE 555
           +EINEER AKILR+W+  E  
Sbjct: 540 VEINEERAAKILRQWSSGEAA 560


>gi|302037604|ref|YP_003797926.1| flagellar M-ring protein FliF [Candidatus Nitrospira defluvii]
 gi|300605668|emb|CBK42001.1| Flagellar M-ring protein FliF [Candidatus Nitrospira defluvii]
          Length = 518

 Score =  360 bits (924), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 124/555 (22%), Positives = 224/555 (40%), Gaps = 49/555 (8%)

Query: 10  FFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSE 69
            F         +  I+   +   I   +A   +   P    L+  L V D + I   L +
Sbjct: 1   MFSKFNQFTINQRFIILLALAGSIAGLVAVTLWTQQPDMQVLFANLAVDDASGIIDKLKD 60

Query: 70  ANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEI 129
           A + +  ++ G+++ VPS+ V   R+ LA QGLP      GYE+FD+    G++ F+Q++
Sbjct: 61  AKVPYETANGGTTVLVPSAQVHDLRLELAGQGLPHGGG-VGYEIFDRTT-MGMSDFVQKL 118

Query: 130 TRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVM--IRAINPSVYKS 187
              RAL+GE+ARTI  +  +  ARVH+ +P+   F     R  ASV+  +RA        
Sbjct: 119 NYRRALQGELARTITQMPEVERARVHLAIPERRLFATEQDRARASVVVSLRASQTLSKAQ 178

Query: 188 AEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT--ANEMERNILGKSLSIVQAIQHEIEMNI 245
            + + HLV+++V  L   DVTV+D  G LL+  +++    + G  +   + ++ +IE  I
Sbjct: 179 IQGVVHLVSSSVEGLQSRDVTVVDGHGNLLSNTSSDESAGLSGTQMEYQRTLEKDIETRI 238

Query: 246 NKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESA 305
              L   +GV+     V + L+    +  E  YDP+ +V RS +  ++            
Sbjct: 239 QTMLERIVGVNKAVVRVSSVLDFRKIETTEERYDPNGQVVRSEQRGQEKSSGVNGTSGGV 298

Query: 306 VTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNK 365
             VE N+P  ++ +     S  N  K  E  NYEI+            +++LS+AV+V+ 
Sbjct: 299 PGVESNVPGGTEAEGGQTSSNNNQTK-NETVNYEISRTVSRIVEPTGTIKKLSVAVLVDG 357

Query: 366 GR-------LTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQL 418
                                + +  +  I +IV  A G ++ R D + + S+ F     
Sbjct: 358 TYEGGGKAGEAGADQPKKYVPRSEEEMKRIEEIVKKAMGYSTERQDQVEVVSIQFG--LG 415

Query: 419 FNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKS 478
               T  V      S+ +   +   V  +   L+ F+ +  L  +        G     +
Sbjct: 416 AEEPTGGVEAAPDASKAWMPYVRYAVGGLLFFLIFFMVVRPLMVMLVQSAPAAGGGETPA 475

Query: 479 ILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEIN 538
           + +      A  +G  P                                  ++L M + N
Sbjct: 476 LPASVGQVEAAISGKQPG---------------------------------QILDMAKNN 502

Query: 539 EERFAKILRKWARSE 553
               A ++++W ++ 
Sbjct: 503 PANTAVVVKQWLKNN 517


>gi|146342729|ref|YP_001207777.1| flagellar MS-ring protein [Bradyrhizobium sp. ORS278]
 gi|146195535|emb|CAL79562.1| Flagellar basal body M-ring protein [Bradyrhizobium sp. ORS278]
          Length = 532

 Score =  360 bits (924), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 127/549 (23%), Positives = 228/549 (41%), Gaps = 24/549 (4%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           +         LG  R+  + +V    +  F      V +P    L+  L + D + I   
Sbjct: 1   MQGLLDFLKGLGAARLAAMVAVTAALVGFFGFVIMRVTAPQMTTLFTDLSMDDSSSIIKD 60

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L    I F I + GS I VP   V + R+ LA           GYE+FDK ++ G TSF+
Sbjct: 61  LERQGIAFEIRNEGSVIMVPKDKVTRLRMKLAEG-GLPKGGGVGYEIFDKSDALGTTSFV 119

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           Q I  +RALEGE+ARTI++I  + AARVH+V+P+   F +    P+AS+++R        
Sbjct: 120 QNINHLRALEGELARTIRAIDRVQAARVHLVLPERPLFSRETPEPSASIVVRVRGSLEAN 179

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNIN 246
              AIRHLVA+AV  L    V+++D  G+LL                  A +  +   + 
Sbjct: 180 QIRAIRHLVASAVNGLKPQRVSIVDEAGQLLADGTQTDIDQQVGDERRNAFEKRMRKQVE 239

Query: 247 KALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAV 306
             +++ +G    R  + A+ + +        YDP+ +V RS +  ++   +  S  +  V
Sbjct: 240 DIVSSVVGSGRARVQLSADFDFNRITQTSDRYDPEGRVLRSSQTREEQSATSESNGQVTV 299

Query: 307 TVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG 366
               N    + +     +  + + K EE +NYEI+  +     +  ++ R+S+AV+V+  
Sbjct: 300 ---NNELPGNQQNQQGQQPKDQSKKTEETNNYEISRTTKTEVTEAGRVNRISVAVLVDGA 356

Query: 367 RLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQV 426
                 G    + +    L  I  +V +A G + +RGD + + ++ F +  +    +   
Sbjct: 357 YSKNEKGDLVYKERSKEELDRIAALVRSAIGFDQKRGDQVEVVNLKFADGPVVPQISEPT 416

Query: 427 SFMDIL---SRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPP 483
            F+ +L         VI   V ++  ++V F+ +  L +     +         +I    
Sbjct: 417 GFLGMLHFTKDDVMYVIELAVMMLLGIVVVFMVVRPLVKKIISTEEIAAANAVPAITD-- 474

Query: 484 PISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFA 543
                              +      +      +++   V  QS  R+  + + N    A
Sbjct: 475 ---------------ETAQAQAHAQQTAQLIDVAQVQGQVHAQSVHRVGELADRNPGEAA 519

Query: 544 KILRKWARS 552
            I+R+W   
Sbjct: 520 AIIRQWLAE 528


>gi|237653561|ref|YP_002889875.1| flagellar MS-ring protein [Thauera sp. MZ1T]
 gi|237624808|gb|ACR01498.1| flagellar M-ring protein FliF [Thauera sp. MZ1T]
          Length = 571

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 131/567 (23%), Positives = 228/567 (40%), Gaps = 33/567 (5%)

Query: 6   QLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISV 65
           ++ Q  ++  +L   + +  A  I + I L   +  +  +P Y  L+  L+  D  +I  
Sbjct: 24  RMQQALQNLAALSTRQKIAGAVAIALAIALVAGSLLWNRAPEYAVLFSNLDERDGGQIIA 83

Query: 66  ALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSF 125
            L + NI +R+S  G +I VP + V + R+ LAA GLP   S +G+EL D     G++ F
Sbjct: 84  ELQQRNIPYRMSPTGHAILVPQAQVHETRLRLAADGLPK-GSLAGFELMD-GQKLGISQF 141

Query: 126 MQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP--S 183
            +++   RALEGE+ RT+Q+I  + +ARVH+ MP   +F +   RPTASVM+        
Sbjct: 142 NEQVNYQRALEGELTRTVQAIDAVASARVHLAMPKQTAFLRDDQRPTASVMVNLRGGRIL 201

Query: 184 VYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEME---RNILGKSLSIVQAIQHE 240
                  I HLV+++VP +    V ++D  GKLLT          +    L  V+ ++  
Sbjct: 202 SPDQVAGIVHLVSSSVPRMHAEGVKIVDQNGKLLTEQADPLLRAGLDATQLEYVRLLEQG 261

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQ-RSET 299
               I+K LA  +G  N+ + V A+++ +  +     Y P+   +++IR  + ++  +  
Sbjct: 262 FIERIDKILAPLVGKGNYGAQVAADVDFNQVEQTAETYKPNPTPDQAIRSQQTSEAFNPQ 321

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRS--------LENTDKKEEQSNYEINTKSIATTHDN 351
              +       N P V                     +  +    NYE++          
Sbjct: 322 PGAQGVPGALTNQPPVPATAPITNPQVAGGGGAQGLASGNRSAVLNYELDRNIQHVKQAV 381

Query: 352 YKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSM 411
            +++RLS+AVVVN   L    G   +    D  +A I  +V  A G N+ RGDTI + S 
Sbjct: 382 GQIKRLSVAVVVNNRTLPGPDGTPTNVPLPDEEIARITNLVREAVGYNADRGDTINVASG 441

Query: 412 DFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKK 471
            F ++   +           +       +N L+ L+  L   F  +  L R       K+
Sbjct: 442 AFADDG--SGAAPPPWKDPEIVALGKEGLNWLLVLIAILFAYFGVIRPLLRTVVPPKPKE 499

Query: 472 GEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRL 531
            + G  +               +       +    + F                      
Sbjct: 500 EKKGAAAGEEGGEGEEGEEGVRVTLSGETGEGEETETFEQRLERARAAAR---------- 549

Query: 532 LHMIEINEERFAKILRKWARSEIEDRY 558
                 + +  A +++ W     E R 
Sbjct: 550 -----NDPKMVANLIKDWMGMNEEARK 571


>gi|251789188|ref|YP_003003909.1| flagellar MS-ring protein [Dickeya zeae Ech1591]
 gi|247537809|gb|ACT06430.1| flagellar M-ring protein FliF [Dickeya zeae Ech1591]
          Length = 568

 Score =  360 bits (923), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 127/582 (21%), Positives = 226/582 (38%), Gaps = 61/582 (10%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
             F +    L     + L       I + +A   +   P Y  LY  L   D   I   L
Sbjct: 13  KNFGEILDRLRANPRIPLLIAAAATIAIVVALSLWARGPDYRVLYTNLNERDGGSIVSEL 72

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
            + NI +R +++G++I +P+  V + R+ LA QGLP   +  G+EL D+   FG++ F +
Sbjct: 73  GKMNIPYRFTESGAAIMIPADKVYETRLKLAQQGLPKGGA-VGFELLDQE-KFGISQFSE 130

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN--PSVY 185
           +I   RALEGE+ART++++  I  ARVH+ +P    F +    P+A+V +          
Sbjct: 131 QINYQRALEGELARTMETLGPIQNARVHLAIPKPSLFVREQKSPSAAVTVTLQPGRALDD 190

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQHEIEMN 244
               AI +LV+++V  L    VTV+D TGKLLT N+     +    L     I+   +  
Sbjct: 191 NQINAITYLVSSSVAGLPADKVTVVDQTGKLLTQNDGSGRDLNAAQLKYANEIEGNYQRR 250

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQP-- 302
           I   LA  +G  N  + V A+++   ++  +  Y P+    +S   S+ + +S+      
Sbjct: 251 IEAILAPVVGAGNVHAQVTAQIDFANREQTDEQYQPNQSPNQSAVRSQQSSQSDQRGGSN 310

Query: 303 -ESAVTVEQNMPHVSDRKV-----------------------------PLPRSLENTDKK 332
                    N P  +                                     +     + 
Sbjct: 311 VGGVPGALSNTPSPAPTAPISTPPANNANNTNNTNNTNTAGTNTQTSGNNAANQTYNSRH 370

Query: 333 EEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIV 392
           ++  NYE++     T      ++RLS+AVVVN        G+ A     D  L +I  +V
Sbjct: 371 DQTINYEVDRTIRHTKQSTGNIQRLSVAVVVNY--TQGEDGKPA--ALSDEQLKKIEALV 426

Query: 393 SAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLV 452
             + G ++ RGD++ + +  F                      F  +  A  +L+  ++ 
Sbjct: 427 RESMGFSTERGDSLNVVNTPFTITDTSGGELP----FWQKQVFFDLLTAAGRWLLVLIVG 482

Query: 453 TFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHS 512
             L    +R         +      + L       +VT   M  +               
Sbjct: 483 WILYRKLVRPQLQRRVQIQEAAAAAAALRGQDPDVSVTISSMEEE-------------LQ 529

Query: 513 RNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
           +  + R ++ +  Q   R+  + E +    A ++R W  +E+
Sbjct: 530 KKSEQRAHTEMHSQ---RIRELAENDPRVVALVIRHWMSNEL 568


>gi|332095496|gb|EGJ00512.1| flagellar M-ring protein FliF [Shigella dysenteriae 155-74]
          Length = 473

 Score =  360 bits (923), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 112/467 (23%), Positives = 200/467 (42%), Gaps = 32/467 (6%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M       +  +    L     + L       + + +A   +  +P Y  L+  L   D 
Sbjct: 1   MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             I   L++ NI +R S+   +I VP+  V + R+ LA QGLP   +  G+EL D+   F
Sbjct: 61  GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-- 178
           G++ F +++   RALEGE++RTI++I  +  ARVH+ MP    F +    P+ASV +   
Sbjct: 119 GISQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLL 178

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAI 237
                      AI HLV++AV  L  G+VT++D  G LLT +    R++    L     +
Sbjct: 179 PGRALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDV 238

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DA 294
           +  I+  I   L+  +G  N  + V A+L+  +++  E  Y P+    ++   S+   ++
Sbjct: 239 EGRIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESQAALRSRQLNES 298

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKV----------------PLPRSLENTDKKEEQSNY 338
           ++S +  P        N P  ++                       S   + ++ E SNY
Sbjct: 299 EQSGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNY 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN   L +           +  + +I  +   A G 
Sbjct: 359 EVDRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGK----PLPLSNEQMKQIEDLTREAMGF 414

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVF 445
           + +RGD++ + +  F  +                      ++ A  +
Sbjct: 415 SEKRGDSLNVVNSPFNSSDESGGELP----FWQQQAFIDQLLAAGCW 457


>gi|94314180|ref|YP_587389.1| flagellar MS-ring protein [Cupriavidus metallidurans CH34]
 gi|93358032|gb|ABF12120.1| flagellar MS-ring protein [Cupriavidus metallidurans CH34]
          Length = 563

 Score =  360 bits (922), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 110/589 (18%), Positives = 218/589 (37%), Gaps = 62/589 (10%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M     L         +     L +       +        +  +P Y  LY  L   D 
Sbjct: 1   MNATATLPNGTALLEKVKANPRLPMMLGGAALVAAIAVGVMWSRAPDYKVLYSNLSERDG 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             +  +L + N+ ++ ++ G ++ VP+  V + R+ LA+QGLP S   +G EL D    F
Sbjct: 61  GAVIQSLQQMNVPYKFAEGGGAVMVPADKVAETRLRLASQGLPKSG-TTGMELMDN-QKF 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           G++ F +++   R LEGE+AR+I+SI  + +ARVH+ +P    F +   +PTASV+++  
Sbjct: 119 GISQFAEQVNYQRGLEGELARSIESIGAVQSARVHLAIPKPTLFVRERQKPTASVVLQLY 178

Query: 181 NPS--VYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQ 238
                      AI HLV+++VP L    ++++D  G LL+       +    L  VQ ++
Sbjct: 179 PGRAVDEGQVAAITHLVSSSVPELTPKSISIVDQQGNLLSGTNDRS-LDASQLKYVQQVE 237

Query: 239 HEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE 298
                 +   LA  LG DN  + V A+++  + +  +  Y P+    ++   S+    S 
Sbjct: 238 QGYVKRVESILAPILGKDNIHAQVTADVDFSSVEHTDESYKPNQDPTKAAIRSQQTSESN 297

Query: 299 TSQPESAVT--------------------------------VEQNMPHVSDRKVPLPR-S 325
           +                                         + N P  + +       +
Sbjct: 298 SQGGTPVGGVPGALSNQPPAAAAAPVTTPQPPRQPGQPNPPAQANQPAQTTQTTQTAEKT 357

Query: 326 LENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYL 385
             +  +++  +NYE++            ++RLS+AVVVN     +  G+   +      L
Sbjct: 358 GPSNSRRDSTTNYELDRVVRHVQQAAGGVKRLSVAVVVNYRTKVDAKGKPVTEALSAKEL 417

Query: 386 AEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVF 445
           A+I  +   A G ++ RGD++ + +  F    +     V V     +     T +  L+ 
Sbjct: 418 AQIENLTKEAMGFSADRGDSLNVVNSPFTS-DIKTEPEVPVWKQPQMIDLAKTGVGYLLL 476

Query: 446 LVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSN 505
            +  + + F     + R +             +  +        T   +           
Sbjct: 477 ALLAVFLWFKVARPVLRKYTAPPLPAPTETAAATEAVLLPPEEETNPEVLRL-------- 528

Query: 506 QDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                          +   +     +    + +    A +++ W  ++ 
Sbjct: 529 ---------------AAKYESDLALVRDAAQRDPRLVASVIKTWMANDE 562


>gi|194292866|ref|YP_002008773.1| flagellar ms-ring protein [Cupriavidus taiwanensis LMG 19424]
 gi|193226770|emb|CAQ72721.1| FliF: Flagellar biosynthesis protein, M-ring protein, Belongs to
           the fliF family [Cupriavidus taiwanensis LMG 19424]
          Length = 576

 Score =  359 bits (921), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 112/560 (20%), Positives = 215/560 (38%), Gaps = 72/560 (12%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +   P Y  LY  L   D   +  +L + N+ ++ ++ G ++ VP+  V + R+ LA+Q
Sbjct: 42  LWSRGPDYKVLYSNLSERDGGAVLQSLQQMNVPYKFAEGGGAVMVPAEKVHETRLRLASQ 101

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP S   +G EL D    FG++ F +++   R LEGE+AR+I+SI+ + +ARVH+ +P 
Sbjct: 102 GLPKSG-TAGMELMDN-QKFGISQFAEQVNYQRGLEGELARSIESIAAVQSARVHLAIPK 159

Query: 161 MGSFRKIGARPTASVMIRAINPS--VYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +   +PTAS++++             AI HLV+++VP L    ++++D  G LL+
Sbjct: 160 PTLFVRERQKPTASIVLQLYPGRAIDEGQVAAISHLVSSSVPELTPKSISIVDQHGNLLS 219

Query: 219 ANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
               ER +    L  VQA++      I   L   +G DN R+ V A+++    +  +  Y
Sbjct: 220 NTGNERMLDATQLKYVQALEQNYLKRIEAILTPIVGKDNVRAQVTADVDFSIVEHTDESY 279

Query: 279 DPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVSD------------------ 317
            P+    R+   S+    S       P        N P  +                   
Sbjct: 280 KPNQDPTRTAIRSQQTSESTQQGATPPGGVPGALSNQPPAAAVAPVTTPQTPRAGQAPGQ 339

Query: 318 -----------------------RKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKL 354
                                         S  ++++++   NYE++            +
Sbjct: 340 AGAPGAGQPGQPGQAGQAGQAAQGATATASSGPSSNRRDSTVNYELDRSVRHVQQAPGGV 399

Query: 355 ERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFL 414
            RLS+AVVVN  +  +  G+   +    + LA+I  +   A G ++ RGD+I + +  F 
Sbjct: 400 RRLSVAVVVNYRQQADAKGKLVAEPLPPALLAQIQNLTKEAMGFSAERGDSINVVNSPFT 459

Query: 415 ENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEV 474
             +      + +     +     ++   L+  +  L   F     + R +        E 
Sbjct: 460 AEREKAEPELPLWKQPDMIALGKSLAGYLLLALLALFAWFKVARPILRRYTAPPLPAPEP 519

Query: 475 GGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHM 534
             ++     P        ++                          +   +     +   
Sbjct: 520 KDETEAVLLPPEEPANPEILRL------------------------AAKYESDLALVRDA 555

Query: 535 IEINEERFAKILRKWARSEI 554
            + +    A +++ W  ++ 
Sbjct: 556 AQRDPRLVASVIKNWISNDN 575


>gi|188579876|ref|YP_001923321.1| flagellar MS-ring protein [Methylobacterium populi BJ001]
 gi|179343374|gb|ACB78786.1| flagellar M-ring protein FliF [Methylobacterium populi BJ001]
          Length = 570

 Score =  359 bits (921), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 186/570 (32%), Positives = 303/570 (53%), Gaps = 18/570 (3%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M   +Q  + + +   LG  R++ L  V L+  +      ++++ P  + LY  L   DV
Sbjct: 1   MFGREQAERLWSNIVDLGARRLIALGLVGLLVFLGVGIGAYYLSRPAQETLYTGLSREDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           +RI   L +  I F +S +G+++ V      +AR+ LA +GLP SS  SGYELF+ + S 
Sbjct: 61  SRIGGVLKDNGIPFDVSSDGTAVLVSFGHTAQARMLLAEKGLPQSS-KSGYELFNDLGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           G+TSFMQE+TRVRALEGEIARTIQ + G+ AARVH+V+PD GSFR+     +ASV++R  
Sbjct: 120 GMTSFMQEVTRVRALEGEIARTIQGMKGVRAARVHLVLPDRGSFRRDQQPASASVVVRTE 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNI-LGKSLSIVQAIQH 239
                  A+AIR LVA+A+P +    VTV+ S G +L A +       GK  ++ +++  
Sbjct: 180 PADDVSGAQAIRQLVASAIPGMKPDRVTVIGSEGTVLLAGDDAGTAPTGKMATLEKSVSR 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           E++ NI + L+ +LGV NF  +V  +LN D     E +Y+PD +VERS+R  ++++ ++ 
Sbjct: 240 EMQDNIRRTLSPYLGVGNFEVSVATQLNTDKTSTNETIYNPDQRVERSVRSVRESENAQN 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
              +   + ++N+P    R     +S   + KKE+ +NYEI+ K++ T  D Y + RLS+
Sbjct: 300 RNSQRPTSAQENLPDQRTRSDGNDQSSNESSKKEDLTNYEISQKTVQTVSDGYAIRRLSV 359

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AV+VN+ RLT + G        D  +AEI ++V +A G +  RGDTI + ++ F+ +   
Sbjct: 360 AVLVNRSRLTALAGPDDKAAL-DKQIAEIEELVGSAAGFSKERGDTIKVAAVGFVNDGQP 418

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHA-LRRLHNIDDAKKGEVGGKS 478
                 +S  D++ +   T+INA   LV   L+ + GL   LR +    +A + EV   +
Sbjct: 419 LEPVPPLSLTDVMMKQSGTLINAATILVVAGLLIWFGLRPALRAILATPEAAQSEVAALA 478

Query: 479 ILSPPPISSA--------------VTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVS 524
                P  +A                 G      +    + +        L   +   ++
Sbjct: 479 GPEGAPALAAGMASGLAADGNMALAAPGTALPGAVGAGEAAKLPAPGVAGLLEELEDKMA 538

Query: 525 KQSDLRLLHMIEINEERFAKILRKWARSEI 554
           +    RL  +I+I+EE+ A +L++W   E 
Sbjct: 539 RSPQKRLEQLIDIDEEQVAAVLKRWLMREE 568


>gi|171057703|ref|YP_001790052.1| flagellar M-ring protein FliF [Leptothrix cholodnii SP-6]
 gi|170775148|gb|ACB33287.1| flagellar M-ring protein FliF [Leptothrix cholodnii SP-6]
          Length = 576

 Score =  359 bits (921), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 125/566 (22%), Positives = 212/566 (37%), Gaps = 40/566 (7%)

Query: 10  FFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSE 69
           F      L   R L LA  +L  I L   A F+    +   L+  L   D   I   L++
Sbjct: 23  FAARLAGLPLGRKLALAGGVLALIGLLAMAVFWNTGNNDKVLFANLSDKDGGAIVAQLTQ 82

Query: 70  ANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEI 129
            N+ ++ ++ G++I VP+  V   R+ LA  GLP   S  G+EL D    FG T F + +
Sbjct: 83  MNVPYKFTEGGTAILVPAEKVHDVRLKLAQAGLPK-GSTVGFELMDNA-RFGTTQFQERL 140

Query: 130 TRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--S 187
              R LEGE+ R+I ++S + AARVH+ +P+   F +   +P+ASV++            
Sbjct: 141 NFQRGLEGELVRSITALSAVEAARVHLALPNQNGFFRDQQKPSASVLLTLHPGRTLDRAQ 200

Query: 188 AEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG--------KSLSIVQAIQH 239
              I HLV+A+V  L+   V+VLD +G LL                   + L  V  I+ 
Sbjct: 201 LAGIVHLVSASVAELNPKAVSVLDQSGSLLAGPPEGMAGAAGGTNGLDAQQLQYVNQIET 260

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLS---KDAQR 296
                I   L   LG DN R+ V AE++    +     + P+     +   S    +   
Sbjct: 261 VYTKRILDILEPVLGRDNLRAQVSAEIDFSQTESTSEEFKPNQGDAPAAVRSAQSTEQSN 320

Query: 297 SETSQPESAVTVEQNMPHVSDRKVPLPR-----------SLENTDKKEEQSNYEINTKSI 345
              + P      + N P          +               T ++E  +NYE++    
Sbjct: 321 PGAAMPAGVPGAQSNQPPTPATAPINGQAQQMQAAQGGVGSNGTARREAVTNYEVDKTVR 380

Query: 346 ATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDT 405
            T   + +++RLS AVVVN   +T+  G           L ++  +V    G +  RGD+
Sbjct: 381 VTRAASGQVKRLSAAVVVNSRSVTDKKGNVQVVPLTPEELDKLTALVQETVGFSKDRGDS 440

Query: 406 ITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHN 465
           + + +  F +       T  +     +     T+   L   +  L++ F  +    +   
Sbjct: 441 VKVINAPF-KVDKPVEDTTPLWKQPEVQDMVRTLALPLGLALLALIIVFGAIRPALKAAQ 499

Query: 466 IDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSK 525
             +  +            P            +   L + + +      +   R       
Sbjct: 500 PPEPVQLVDAVVDDAQELPALEG-----SAEEAAHLAAGHMNALPAPEDDAQR------- 547

Query: 526 QSDLRLLHMIEINEERFAKILRKWAR 551
               +   M + N    A I+R W  
Sbjct: 548 -RLEQARKMAKDNPAAVANIVRGWVS 572


>gi|206890854|ref|YP_002248115.1| flagellar M-ring protein FliF [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206742792|gb|ACI21849.1| flagellar M-ring protein FliF [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 505

 Score =  359 bits (921), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 124/555 (22%), Positives = 229/555 (41%), Gaps = 53/555 (9%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           MAI D++    ++  ++   R L LA + L+   + +    ++    Y  LY  L   D 
Sbjct: 1   MAITDRVKTVLENIKNMPLNRKLALAGLTLIVFAIILTLFLWLPKQDYQVLYSNLSAEDA 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             +   L E  + +++ DN  +I VPS  V + R+ LA+QG+P S    G+E+FDK    
Sbjct: 61  GNVINKLKEKKVPYQVKDN--AIYVPSQKVHELRLELASQGIP-SGGGVGFEIFDKTQ-I 116

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLT F Q +  +RAL+GE+ RTI+ +  +   RVHI +P+   F +    PTASV+++  
Sbjct: 117 GLTEFSQRVNYIRALQGELQRTIKQLQEVDQVRVHIAIPEKSIFTEKEDHPTASVVLKLK 176

Query: 181 N--PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL-GKSLSIVQAI 237
                  +   +I HLV+++V  L    VTV+D  G LL+A +    +     +   + I
Sbjct: 177 PGRALSKEQVSSIVHLVSSSVEGLSPQYVTVVDQYGNLLSAPKDSTQLAEATHIEYKRNI 236

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRS 297
           +   E NI   L   +G       V A+++    +  E  YDPD+   R+ + +++  ++
Sbjct: 237 EKTYEKNIQSMLENIVGKGKAIVRVSADIDFSKVEKVEEKYDPDTIAIRNEQRTQE--KT 294

Query: 298 ETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
            + Q      V  N P     +    +    + K++E  NYE++           +++++
Sbjct: 295 MSPQQGGIPGVLSNQPGQP--QTGATQQNIQSQKQQESINYEVSKSISKILQSTGQIKKI 352

Query: 358 SIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           S+AV+++     E  G+     + D  + +  ++V A+ G N  RGD + + S+ F    
Sbjct: 353 SVAVLIDGIY-KEEKGKKVYVPRSDEEIKKYQELVQASIGYNKERGDYVIVESIPFEIVP 411

Query: 418 LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGK 477
               G               T++  L+ LV   L+    +  +  L      +       
Sbjct: 412 EEKPGIDYWGI-------ATTILKYLIPLVIIALIILFVVKPIIELLKKPVEE------- 457

Query: 478 SILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEI 537
                                               + ++       +     + H+   
Sbjct: 458 ---------------------------KIKKKEIVISEEAVPPVMKERDIREEIRHIART 490

Query: 538 NEERFAKILRKWARS 552
           N ++   ILR+W   
Sbjct: 491 NPKKVIAILREWITE 505


>gi|224373126|ref|YP_002607498.1| flagellar MS-ring protein [Nautilia profundicola AmH]
 gi|223589285|gb|ACM93021.1| flagellar M-ring protein FliF [Nautilia profundicola AmH]
          Length = 561

 Score =  359 bits (921), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 133/565 (23%), Positives = 234/565 (41%), Gaps = 20/565 (3%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVN-----SPHYDNLYVKL 55
           M   +   Q      +L + + +++ S I+  + +      F          Y  L+  L
Sbjct: 1   MNFEELFKQIIAFTKNLNKRQKIVIISAIVALVAIISFLVVFNTTSSKTKTGYAILFDNL 60

Query: 56  EVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFD 115
              D   I   L +  I + I ++G  I VP  +V K R+ +AAQGLP SS   G+ELFD
Sbjct: 61  SSKDAALIVQYLDKKQIPYVIPEDG-VIEVPKDVVQKIRLDVAAQGLPKSS-KVGFELFD 118

Query: 116 KVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASV 175
           K + FG+T F Q++  +RALEGE+ RTI+S+  + +A V+I +P    F +    PTASV
Sbjct: 119 KNS-FGITDFEQKVKYLRALEGELGRTIESLDAVESATVNIAIPKDSVFVEKQTPPTASV 177

Query: 176 MIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM---ERNILGKS 230
           +I+         K  + I++LVAAAVP +   +V ++D  G LL  N+       +L   
Sbjct: 178 VIKLKPNMVLTPKQIQGIKYLVAAAVPKMKPENVKIIDQYGNLLGENDELTQNNELLKAE 237

Query: 231 LSIVQAIQHEIEMNINKALAAFLG-VDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIR 289
           +   + ++  +E  I   LA  +G  +   + V  +++    + +  +Y PD+ V     
Sbjct: 238 IIYKKRMEKALEDKIVSILAPVIGGKNKVVAKVNLDIDFSQVKSKSTIYSPDNVVRSEQT 297

Query: 290 LSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTH 349
           L +     +  +         N+  V   K       +   K +  +NYEI+T       
Sbjct: 298 LEESRTGYKPKEVGGVPGAVSNVGPVQGTK--SNEVKDKYTKSQTTTNYEISTTVKDVKE 355

Query: 350 DNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITIT 409
              K++R++ AVVV+     +  G+          L  I  +V    G + +RGD+++++
Sbjct: 356 PLAKIKRITAAVVVDGHYKEDKDGKKEFVPLTKLELTNIENLVKNTIGYDPKRGDSVSVS 415

Query: 410 SMDFLENQLFNSGTVQVSF-MDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDD 468
           S  F  N   N  T  V   M  +  +   +   L +L   +++       +        
Sbjct: 416 SFQFTGNSANNEPTSAVGKVMQSVQMYLGPISGILKYLFLAIVLFVFYKKVITPFTQKML 475

Query: 469 AKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSD 528
             K E   + +     I+               +   Q +   S   +  +     +   
Sbjct: 476 EVKIEEEPEYVKPDIEINEEEVESTYDKIKELKEKVEQQLGISSDVNEEEL---KYEVLL 532

Query: 529 LRLLHMIEINEERFAKILRKWARSE 553
            R++ M E   E  AK+L    + E
Sbjct: 533 DRIVKMAEEKTEEVAKVLENLIKEE 557


>gi|238796932|ref|ZP_04640436.1| Flagellar M-ring protein [Yersinia mollaretii ATCC 43969]
 gi|238719192|gb|EEQ11004.1| Flagellar M-ring protein [Yersinia mollaretii ATCC 43969]
          Length = 563

 Score =  359 bits (921), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 116/582 (19%), Positives = 223/582 (38%), Gaps = 59/582 (10%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           +  +    +   +  +  ++L   +   + L +A   +  +P Y  LY  +   D   I 
Sbjct: 11  NNTVNLMAALERIRASPKIVLLICVSAAVTLLIALLLWAKAPDYRVLYSNISDQDGGAIV 70

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L++ N+ +R  D G +I VP   V +AR+ LA  GLP   S  G+EL D+   FG++ 
Sbjct: 71  AQLAQMNVPYRFEDRGGAIMVPVDKVYEARLKLAQLGLPKGGS-VGFELLDQE-KFGISQ 128

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV 184
           F +++   RALEGE++RTI+++  +  ARVH+ +P    F +     +ASV +   N   
Sbjct: 129 FSEQVNFQRALEGELSRTIETLGPVNGARVHLAIPKPSMFVREQKPSSASVTVNLSNGRS 188

Query: 185 YK--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIE 242
            +     AI +L+A+AVP L+  +VT++D  G LLT    +       L     ++ + +
Sbjct: 189 LESGQVSAISYLIASAVPGLNADNVTIVDQGGHLLTQRGGQEVQTS-QLKFTSEVEADFQ 247

Query: 243 MNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DAQRSET 299
             I   LA  +G +N ++ V A+L+  T +     + P++  ++    S+   D+++   
Sbjct: 248 QRIQSILAPIVGRNNVKAQVTAQLDFTTHEQTAEQFQPNTASDKMSIRSRQSSDSEQGSK 307

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLEN-------------------------TDKKEE 334
           +          N P                                         ++++ 
Sbjct: 308 NGVGGVPGALSNQPPTPATAPITQPVGAKEATPTTPTTPGAKGAATTVATPVPFNNRRDN 367

Query: 335 QSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSA 394
            +NYE++            +ERLS+AVVVN                  + + +IN +V  
Sbjct: 368 TTNYELDRTLTHIKRSAGSIERLSVAVVVNYL----PAKEGVPAALSKAQMDQINSLVKE 423

Query: 395 ATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTF 454
           A G +  RGDT+ I +  F + +   +           +     ++ A  +L+  ++  F
Sbjct: 424 AVGFSVERGDTVNIVNSLFSDVEEEVAPP-----FWKQAGFINLLMAAGRYLLVAIVAWF 478

Query: 455 LGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRN 514
               A++     +             +      A             +   +   +    
Sbjct: 479 FWRKAIQPAWMRNQELILARLELEKEARQAELDANKRKAESGAKNKAEQRVEVELNTQS- 537

Query: 515 LQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIED 556
                           L  + E      A +LR+W   +++ 
Sbjct: 538 ----------------LRELAEQEPRVIALVLRQWMNKDLDS 563


>gi|320354317|ref|YP_004195656.1| flagellar M-ring protein FliF [Desulfobulbus propionicus DSM 2032]
 gi|320122819|gb|ADW18365.1| flagellar M-ring protein FliF [Desulfobulbus propionicus DSM 2032]
          Length = 550

 Score =  359 bits (920), Expect = 8e-97,   Method: Composition-based stats.
 Identities = 134/551 (24%), Positives = 240/551 (43%), Gaps = 25/551 (4%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
               ++  +    R + LA+V  + + LF        +  Y  LY  L  SD + +   L
Sbjct: 17  KTLVETVKAWPMPRKIALAAVTAITLGLFAFIIVQARTADYQLLYGNLAESDASSVVEWL 76

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
              NI +++++NG +I +P+  V + R+ LA+ GLP      G+E+FDK  SF LT F+Q
Sbjct: 77  KGQNIPYKLANNGHNILIPAKDVYETRLSLASLGLPQGGG-VGFEIFDK-QSFALTDFVQ 134

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR--AINPSVY 185
           ++   RAL+GE+ARTI S+  +  ARVH+ +P+   F+      TASV+I+         
Sbjct: 135 KVNYSRALQGELARTIASLGPVETARVHLALPEKRLFKDQQKPATASVIIKLAPGKRLSE 194

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM---ERNILGKSLSIVQAIQHEIE 242
              E + HLV++++  LD G VTV+D  G +L+         N+    L     ++  +E
Sbjct: 195 AQIEGVVHLVSSSIEGLDPGQVTVIDQNGNVLSRIGEKGLSGNLSPDMLEFQMQVEQRLE 254

Query: 243 MNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQP 302
                 L   LG  N    V A L+    +  E  +DP+  V RS +LS++  +S +   
Sbjct: 255 DRAQALLDKSLGAKNAMVRVSATLDFAQTEKTEETFDPEEPVIRSEQLSEE--KSGSEIT 312

Query: 303 ESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVV 362
                V+ N+   +        +   + + +  +NYEI+     TT     + +LS++V+
Sbjct: 313 GGVPGVQSNLEGNTA---QTAGATPPSSRSQRTTNYEISKVVSKTTQPVGTISKLSVSVL 369

Query: 363 VNKGRLTEVLGRSA-DQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNS 421
           V    +       A  + + ++ L  +  +V++A GI++ RGD I +TSM FLE+     
Sbjct: 370 VADKVVPGKDKEPAKTEPRSETELKTLQTMVASALGIDTARGDKIEVTSMPFLESAEDGG 429

Query: 422 GTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILS 481
              Q      L   +   I   + ++G +L+    +  L +  + D  +  +   +    
Sbjct: 430 ---QEGMAANLLYQYLPFIRYGLLILGAVLIYLFMIRPLMKTLHRDVTEHYKTVEEMEAE 486

Query: 482 PPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEER 541
               ++A   G  P    AL        +        +          ++   +E +   
Sbjct: 487 QVQAAAAREPGAGPAGAGALVGGAAYREAMESAPLDPLE---------KIRKGVEQDPVF 537

Query: 542 FAKILRKWARS 552
            A +L+ W   
Sbjct: 538 SAHVLKGWIHE 548


>gi|197120199|ref|YP_002140626.1| flagellar M-ring mounting plate protein FliF [Geobacter
           bemidjiensis Bem]
 gi|197089559|gb|ACH40830.1| flagellar M-ring mounting plate protein FliF [Geobacter
           bemidjiensis Bem]
          Length = 523

 Score =  359 bits (920), Expect = 8e-97,   Method: Composition-based stats.
 Identities = 128/556 (23%), Positives = 234/556 (42%), Gaps = 47/556 (8%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           + L +  +   +L   + L++  V L  ++ F A     N   Y  L+  L   D   I 
Sbjct: 3   EGLKKLLEPFLALSTAKRLVVGGVALASLLGFAALIAVANKTDYRPLFANLTQEDAGEIV 62

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L E  + ++IS +G +I VPS  V   R+ LA+ GLP      G+E+FD+ N FG+T 
Sbjct: 63  KKLKEQKVPYQISPDGKAILVPSDNVYDLRLSLASDGLPQGGG-VGFEIFDRKN-FGMTE 120

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV 184
           F+Q++   RAL+GE+ RTI  I+G+ +ARVH+ +P+   F+      TASV+++  +   
Sbjct: 121 FVQKLNYQRALQGELGRTIAQIAGVESARVHLALPEKALFKDQEKPATASVVLKMKSNRQ 180

Query: 185 YK--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTAN---EMERNILGKSLSIVQAIQH 239
            +    + I HLVA+++  +D   VTVLD+ GK+L+++   +    + G      +A + 
Sbjct: 181 LREGEVQGIVHLVASSIEGMDPEQVTVLDTRGKVLSSHSPNDPTSKVAGARQDTQRAFEK 240

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
             E  +   L   +G     + V A  +    +  E  YDP+S   RS + S++     +
Sbjct: 241 TEEEKLQSLLDRVVGSGKSVARVSASFDFKQVEKYEERYDPESAAVRSEQRSEEK-GGGS 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
           S       V+ NM                  K +E  NYE++  +         L ++S+
Sbjct: 300 STASGVPGVQSNMGRAQGAAGSTTGGGS---KTDETLNYEVSRSTARIIEPVGSLSKVSV 356

Query: 360 AVVVNKGRL----TEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLE 415
           A++V+         +       Q +    + +I  +V +A G N+ RGD +T+ ++ F E
Sbjct: 357 AILVDGKYELSPGAKPGATPKYQPRSPDEMQKIESLVKSAVGFNAERGDQVTVANIPFQE 416

Query: 416 NQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVG 475
                          I+     T+I   +  +  L + F  +  L ++  I+ A    + 
Sbjct: 417 TGDQGGEQPSWYDAPIVQ----TLIKNGLIGLAFLALLFYVIRPLMKMLKIEKAAHHFLP 472

Query: 476 GKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMI 535
                                          D+         ++     + + L L+  +
Sbjct: 473 ----------------------------IQDDVEQQQMLEMQKVEHEKMRVTQLELVEKV 504

Query: 536 EINEERFAKILRKWAR 551
           + +  + A+IL+ W  
Sbjct: 505 KQDPYQAAQILQNWLT 520


>gi|300311375|ref|YP_003775467.1| hypothetical protein Hsero_2059 [Herbaspirillum seropedicae SmR1]
 gi|300074160|gb|ADJ63559.1| hypothetical protein Hsero_2059 [Herbaspirillum seropedicae SmR1]
          Length = 569

 Score =  359 bits (920), Expect = 9e-97,   Method: Composition-based stats.
 Identities = 122/545 (22%), Positives = 221/545 (40%), Gaps = 42/545 (7%)

Query: 38  AARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHL 97
               +     Y  L+      D   I  +L + N+ ++ SD G++I VP +MV  AR+ L
Sbjct: 38  GIWLWSQKVEYRVLFSNFNDRDGGAIVASLQQMNVPYKYSDGGTAILVPENMVHDARLKL 97

Query: 98  AAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIV 157
           AAQGLP    N G+EL  +    G++ F++++   RALEGE+AR++ S++ +  ARVH+ 
Sbjct: 98  AAQGLPK-GGNVGFELM-ENQKLGISQFLEQVNFQRALEGELARSVGSLASVQTARVHLA 155

Query: 158 MPDMGSFRKIGARPTASVMIRAIN--PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
           +P    F +   +PTASV++          +   AI HLVA++VP L    VT++D  G 
Sbjct: 156 LPKASVFVRDQQKPTASVVLSLYPGRYLDPQQVSAIVHLVASSVPELSPKAVTIVDQNGN 215

Query: 216 LLTA---NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQ 272
           LL+          +    L  VQ +Q +I   +   +A  +G  N R+   A+++    +
Sbjct: 216 LLSDTTKQAQPNTLDPTQLKYVQDMQQDIVKRVESIIAPIVGNGNVRAEATADVDFSRSE 275

Query: 273 IREIVYDPDSKVERSIRLSKDAQ--RSETSQPESAVTVEQNMPHVSDRKVP--------- 321
                Y P+   + +   SK +    S ++          N P                 
Sbjct: 276 QASEAYKPNQTKDSAAVRSKQSSEANSASNGTSGVPGALSNQPPAPATAPIVNPAVANGA 335

Query: 322 -------------LPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRL 368
                           +     +K+E  NYE++     T      + RL++AVVVN  R 
Sbjct: 336 ANQTGAATPNGALPTPTATGNSRKDETINYEVDKTVRYTQQPMGGVRRLTVAVVVNYKRT 395

Query: 369 TEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSF 428
            +  G+   +   ++   +I  +V  A G N  RGD++ + +  F          V +  
Sbjct: 396 MDNTGKIVMRPLTEAERNQITDLVKEAMGYNKDRGDSLNVVNTQF---STDMEPEVPLWK 452

Query: 429 MDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSA 488
              +      +   ++     L + F  L  +    +  + ++     K+       ++A
Sbjct: 453 QPGMIDLAKEIGKYVLVAAVLLFLYFRVLRPIVWKLSGREERERLAKEKAEAEAAAAAAA 512

Query: 489 VTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRK 548
           V  G  P+D  A+ + + +     R           K +        + + +  A I++ 
Sbjct: 513 VAAGFDPDDPDAIVNLSGESEVDER--------AQYKANLETAKQWAKNDPKLVASIIKS 564

Query: 549 WARSE 553
           W  +E
Sbjct: 565 WVNNE 569


>gi|307822872|ref|ZP_07653103.1| flagellar M-ring protein FliF [Methylobacter tundripaludum SV96]
 gi|307736476|gb|EFO07322.1| flagellar M-ring protein FliF [Methylobacter tundripaludum SV96]
          Length = 611

 Score =  359 bits (920), Expect = 9e-97,   Method: Composition-based stats.
 Identities = 134/573 (23%), Positives = 241/573 (42%), Gaps = 36/573 (6%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            K    L   R + L   + + + + +A   +   P Y  LY ++  SDV+ I   L++ 
Sbjct: 44  IKGLAGLTIARQIGLMLGLALSVAIGVAIVLWSQEPSYGRLYSEIGESDVSEILEILNKE 103

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +++     +I VP   V   ++ LAAQGLP S+S  GYEL DK   FG +  ++ + 
Sbjct: 104 NIKYKVETGSGAIMVPMDQVSAVKLKLAAQGLPKSNS-LGYELLDKEQGFGASKGVETVR 162

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--SA 188
             RALEGEIARTI SI  +  ARV + +P    F +   +P+ASV++             
Sbjct: 163 FQRALEGEIARTIMSIQNVKTARVLLAIPAQSVFVRERKKPSASVIVNLYQGRSLDKGQV 222

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEME--RNILGKSLSIVQAIQHEIEMNIN 246
           E+I HLVA++VP L+   VTV+D  G+LL +N+     N+  K     + I+  +   I 
Sbjct: 223 ESIIHLVASSVPQLEAEQVTVVDQKGQLLNSNDSSVAGNLTSKQFEYKKNIEEHLMGRIE 282

Query: 247 KALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAV 306
             L+  +G D  R  + A+++       + +++PD    RS + S++  +S  S  +   
Sbjct: 283 NILSPLVGSDGMRVQISADVDFTETDRTQEMFNPDLPALRSEQTSEE--QSTQSAIQGVP 340

Query: 307 TVEQNMPH-------------------VSDRKVPLPRSLENTDKKEEQSNYEINTKSIAT 347
               N P                     +    P   +   +  K    NYE++     T
Sbjct: 341 GALSNQPTPAGAAPDPAAAPAAPGSSATTAAAAPTSTATPGSAAKNATRNYELDKTITHT 400

Query: 348 THDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTIT 407
                 L RLS+AVVV+   + +  G    Q      +   + +V  A G +S RGD +T
Sbjct: 401 RLATGALRRLSVAVVVDDRHVPQSDGTVKGQSYSQEDINRFSDLVKQAVGFDSSRGDQVT 460

Query: 408 ITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHA-LRRLHNI 466
           +T++ F  ++L  +      +       F  ++  +  ++  L + F  L   +R L   
Sbjct: 461 VTNVTFKIDELIEALPAIPVWE---QGWFLDLMKQVAAVLAVLFLLFGVLRPTMRSLVGR 517

Query: 467 DDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRIN------ 520
           D  +K  +                        +A+ +  Q++     N     +      
Sbjct: 518 DIEEKKALALAEAQEKAIAIGGSVRFNDQGAPVAVPAGQQNVSFAKPNEMEMQDLLLLDV 577

Query: 521 SYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
               +     +  +++ + +  A++++ W + +
Sbjct: 578 PQSYEHRLEYVKRLVDDDSKVVAQVIKSWIKKD 610


>gi|188534120|ref|YP_001907917.1| flagellar MS-ring protein [Erwinia tasmaniensis Et1/99]
 gi|188029162|emb|CAO97034.1| Flagellar basal-body M-ring protein [Erwinia tasmaniensis Et1/99]
          Length = 571

 Score =  359 bits (920), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 120/548 (21%), Positives = 226/548 (41%), Gaps = 56/548 (10%)

Query: 41  FFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQ 100
            +   P Y  LY  L   D   I   L++ N+ ++  D G ++ VP++ V + R+ LA+Q
Sbjct: 46  LWAKQPDYRVLYNNLSNEDGGAIVTQLTQMNVPYKFDDRGGALLVPAAQVHELRLRLASQ 105

Query: 101 GLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPD 160
           GLP   +  G+EL DK   FG++ F ++I   RALEGE+ARTI ++  +  ARVH+ MP 
Sbjct: 106 GLPKGGA-VGFELLDKE-KFGISQFSEQINYQRALEGELARTIATLGPVKDARVHLAMPK 163

Query: 161 MGSFRKIGARPTASVM--IRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT 218
              F +    P+ASV   ++           A+ H+V+++V  +  G+VTV+D +G+LLT
Sbjct: 164 PTLFVREQKSPSASVTLALQPGRALDEGQINAVVHMVSSSVAGMPQGNVTVVDQSGRLLT 223

Query: 219 ANE-MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIV 277
            N+   R++    L     ++   +  I   L   +G  N  + V A+++ + ++  +  
Sbjct: 224 QNDTTGRDLNDAQLKYASDVETRYQQRIEAILGPIVGNSNVHAQVTAQIDFNKREKTDEQ 283

Query: 278 YDPDSKVERSIRLSKDAQRS---ETSQPESAVTVEQNMP--------------------- 313
           Y P+S  E+    S+    S                N P                     
Sbjct: 284 YAPNSNPEQQAVRSRQTSNSEQLGGQSAGGVPGALSNQPAPANAGPVTTPNNTNANGANG 343

Query: 314 -------HVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKG 366
                    ++      ++  +  + +  +NYE+N   + T  +  +++RLS+AVVVN  
Sbjct: 344 ANANNGQPANNAASGAQKTSPSNTRSDNTTNYEVNRTILHTKMNVGEVQRLSVAVVVNYR 403

Query: 367 RLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQV 426
                          ++ + +I  +   A G + +RGD++ + +  F +N          
Sbjct: 404 S----DAAGKPIALNEAQIKQIEDLTREAMGYSEKRGDSLNVVNSPFTQNSDLGDELP-- 457

Query: 427 SFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPIS 486
                       +  A  +L+  ++   L    LR       A +      +  +    +
Sbjct: 458 --FWKQPAFIDQMFEAGRWLLVLIVAFILYRKLLRPQLLRKAALEKSTREAATSAARNST 515

Query: 487 SAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKIL 546
                 +           ++D     R  + R+++ V  Q   R+  M E +    A ++
Sbjct: 516 QQEGVSV---------KLSKDELDQERKSEHRMSAEVMSQ---RIREMSENDPRVVALVI 563

Query: 547 RKWARSEI 554
           R+W + E+
Sbjct: 564 RQWMKDEL 571


>gi|189426353|ref|YP_001953530.1| flagellar M-ring protein FliF [Geobacter lovleyi SZ]
 gi|189422612|gb|ACD97010.1| flagellar M-ring protein FliF [Geobacter lovleyi SZ]
          Length = 530

 Score =  358 bits (919), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 125/561 (22%), Positives = 230/561 (40%), Gaps = 48/561 (8%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           + L +  +   +L   + L++  V+L  ++ F       N   Y  L+  L   D   I 
Sbjct: 3   EGLKRIVEPFMALAPGKRLLVGGVVLACLLSFALLIMLANRTDYRPLFTNLASEDAGEIV 62

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L EA   ++I+ +G  I VP+  V + R+ LA++GLP      G+E+FD+ N FG+T 
Sbjct: 63  KKLKEAKTPYQITPDGKGIMVPADKVYELRLSLASEGLPQGGG-VGFEIFDRKN-FGMTE 120

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN--P 182
           F+Q++   RAL+GE+ARTI  ISG+  ARVH+V+P+   F++    PTASV+++      
Sbjct: 121 FVQKLNYQRALQGELARTITQISGVEQARVHLVIPEKTLFKEAEKPPTASVVLKMKGNKN 180

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA-----NEMERNILGKSLSIVQAI 237
                 + + HLV++++  ++  +VTVLDS GK+L+       +             +  
Sbjct: 181 LRDNEVQGVVHLVSSSIEGMNADNVTVLDSRGKILSKGGNGMADASAKATSAMQETQRGY 240

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRS 297
           +  +E  +   L   +G     + V A  +    +  E  +DP++   RS + S++    
Sbjct: 241 ERNVEERLQTLLDRVVGGGKSVARVSATFDFKQVERVEEKFDPETIAVRSEQRSEEKAGG 300

Query: 298 ETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
                     V+ N+   +              K +E  NYE++  +  T      L ++
Sbjct: 301 SAVST-GVPGVQTNLGRTAPGAGGAAGGG---SKNDETLNYEVSRSTSRTVEPVGTLSKV 356

Query: 358 SIAVVVNKGRLTEVL------GRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSM 411
           S+A++V+    T         G++    +    L +I  +V  A G N  RGD I+I ++
Sbjct: 357 SVAILVDGKYETGAPGKDGAAGKAKYVPRSPDELQKIEALVKGAVGFNQERGDQISIQNI 416

Query: 412 DFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKK 471
            F +       T    +   ++  F T+   L+  +G L +    +  +          +
Sbjct: 417 AFQDAGEAAGSTESAKWW--MNPFFLTLFKNLMIALGFLALMLFVVKPMLNTLRAARPAR 474

Query: 472 GEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRL 531
            ++    +       SA                             R    +       L
Sbjct: 475 PDILEAIVPDAQEKMSA---------------------------SERAQLAMHMAEQQEL 507

Query: 532 LHMIEINEERFAKILRKWARS 552
           +   + N  + A+IL+ W   
Sbjct: 508 MEKAKTNPYQVAQILQNWLGE 528


>gi|46201261|ref|ZP_00055409.2| COG1766: Flagellar biosynthesis/type III secretory pathway
           lipoprotein [Magnetospirillum magnetotacticum MS-1]
          Length = 560

 Score =  358 bits (919), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 144/555 (25%), Positives = 256/555 (46%), Gaps = 7/555 (1%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           D +  F +    LG  R+  +A V +  +  F+     V +P  + LY  L++ D  +I 
Sbjct: 6   DDVNAFLQMLRGLGPMRLAAIAGVGVSILGFFIYLMSRVAAPQMELLYGDLDLGDSKQII 65

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L+   I + +  +G+ + VP       R+ +A Q LP+    +GYELFDK ++ G TS
Sbjct: 66  EKLTADKIPYELRKDGTEVWVPKDRKLDLRVRMAEQALPAGGRMAGYELFDKQDALGSTS 125

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN--P 182
           F Q IT VRALEGE+++TI+SI  + AARVH+V+P   +F +    P+ASV+I+      
Sbjct: 126 FQQNITMVRALEGELSKTIRSIDKVKAARVHLVLPKREAFSRDTQEPSASVIIKMNGSQR 185

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMER--NILGKSLSIVQAIQHE 240
                  AI+HL+AAAVP +    ++++D  G LL              +  +    + +
Sbjct: 186 LDKGQVSAIQHLIAAAVPKMKPSRISIVDDKGTLLAKGFENSKEYQAQTAEDMKVKTEAK 245

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           +   I   L   LG    R+ V  ++++      E  +DP++KV RS     + ++S+ +
Sbjct: 246 LVKTIEDLLERSLGPGRVRAEVTVDMDLSQATTTEETFDPETKVVRSQVTVNEGEQSQDA 305

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           +P + VTV+QN+P  +       R+    +K +E  NYEI+ K+ +T  +  ++ ++S A
Sbjct: 306 EP-TPVTVQQNLPDPNASSGGNIRTSTKINKNQETVNYEISRKTKSTVREMGEIRKVSAA 364

Query: 361 VVVNKGRLTEVLGRSA-DQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           V+V+  R     G+    + +    L++I  +V +A G    R D + + SM F + +  
Sbjct: 365 VIVDGVREQSADGKQTSYRDRTAEELSQIEALVKSAIGYTKDRDDQVKVASMPFYKGEEL 424

Query: 420 NSGTVQVSFMDILSRHF-ATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKS 478
                   F+  + R F   + + L   V  +L   L L  L          +    G+ 
Sbjct: 425 LQAEEPGEFIFGMRRDFVEKIASNLGLSVVAILFLLLVLRPLISRAIESMQGQVGPDGRR 484

Query: 479 ILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEIN 538
           +L+    +    TG       A     +++ +       ++   V   S  ++  ++E +
Sbjct: 485 LLTTDGGAMPQLTGPSGAAMPAPLGGEEEVIADELIDIDKVEGRVKASSIRKIGEIVEKH 544

Query: 539 EERFAKILRKWARSE 553
            E    I+R W   E
Sbjct: 545 PEEALSIIRNWLYQE 559


>gi|300114783|ref|YP_003761358.1| flagellar M-ring protein FliF [Nitrosococcus watsonii C-113]
 gi|299540720|gb|ADJ29037.1| flagellar M-ring protein FliF [Nitrosococcus watsonii C-113]
          Length = 567

 Score =  358 bits (919), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 126/562 (22%), Positives = 243/562 (43%), Gaps = 33/562 (5%)

Query: 6   QLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISV 65
           +L     +   L   + + L   I   + L +    +  +P Y  +Y  +   +   I  
Sbjct: 24  RLAALQANIGRLSLQKQVGLLLAIAASVALVVGVVMWALAPTYQVMYGAVTGEEKGEIVA 83

Query: 66  ALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSF 125
           AL +ANI++R+++N  +I VP+S V + R+ LA +GLP S +++G+EL ++   FG + F
Sbjct: 84  ALQKANIEYRLAENTGAIMVPASKVHEVRLQLAMEGLPRS-ADTGFELLEQNPGFGASEF 142

Query: 126 MQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPS 183
           +++    RALEGE+ARTI +++ +  ARVH+ +P    F +    P+ASV++        
Sbjct: 143 LEKARYQRALEGELARTIGTLNNVRNARVHLALPKQSVFIRNRQAPSASVVLDLYAGRAL 202

Query: 184 VYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE--MERNILGKSLSIVQAIQHEI 241
                 AI HLV++++PNL+   VT++D  G LLT  +      +        + ++ + 
Sbjct: 203 DPGQVAAITHLVSSSIPNLESSGVTLVDQRGNLLTRQDRSQSLGMTEGQFEYTRRLEEKY 262

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
              I   LA  +G D  R+ VVAE++    +  +  Y+P+S   RS ++S++ +      
Sbjct: 263 IRRIQHILAPMIGSDKARAQVVAEVDFTVTEQTQEYYNPESAALRSEQMSEEERTGSRF- 321

Query: 302 PESAVTVEQNMPHVSDRKV----------PLPRSLENTDKKEEQSNYEINTKSIATTHDN 351
           P+       N P    +                ++  T  +    NYE++     +    
Sbjct: 322 PQGIPGALSNQPPAEAQAPEVVPEANDDEAPIEAVPTTRSQRATRNYELDRTISHSRLSP 381

Query: 352 YKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSM 411
             + RLS+AV+V++  + +  G  +   +    LA++  +V  A G N+ RGDTI + + 
Sbjct: 382 GSIRRLSVAVLVDEKAVADAEGTVSTVPRSPQELAQVTALVKEAVGFNAERGDTINVINA 441

Query: 412 DFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKK 471
            F+      S      +       F   +     ++  LL+    L    R         
Sbjct: 442 PFVPANEEESFPEPSLWQ---QDWFWQAVKQGGGVLAILLLLLGVLRPAFRRLTALP--- 495

Query: 472 GEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRL 531
                 ++ + P      +   +  D ++L S+   +     +          + +   +
Sbjct: 496 ---ESVTLPAIPNKDEEKSDDGLQEDQLSLSSNKPTLRLAGPHSL--------EANLEIV 544

Query: 532 LHMIEINEERFAKILRKWARSE 553
             M   +  R A++++ W  S+
Sbjct: 545 RDMATGDSRRVAQVVKNWLVSD 566


>gi|167717602|ref|ZP_02400838.1| flagellar MS-ring protein [Burkholderia pseudomallei DM98]
          Length = 476

 Score =  358 bits (919), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 126/472 (26%), Positives = 206/472 (43%), Gaps = 18/472 (3%)

Query: 7   LLQFFKSGTSLGRTR---ILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           L  F +    L R +    L       + I   +A   +  +P Y  LY  L   D   I
Sbjct: 6   LGGFAERIPGLSRMKTNPRLPFLIGAALAIAAIVALVLWSRAPDYRVLYSNLSDRDGGAI 65

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
             AL +AN+ ++ +D G +I VP++ V + R+ LAA GLP   S  G+EL D    FG++
Sbjct: 66  IAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMGLPKGGS-VGFELMDN-QKFGIS 123

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP- 182
            F +++   RALEGE+ RT++SI+ + AARVH+ +P    F +    P+ASV++      
Sbjct: 124 QFAEQVNYQRALEGELQRTVESINAVRAARVHLAIPKPSVFVRDREAPSASVLVDLYPGR 183

Query: 183 -SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEI 241
                   A+  +V+++VP++   +VT++D  G LLT       +    L  VQ I+   
Sbjct: 184 VLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQTASATGLDASQLKYVQQIERNT 243

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE--- 298
           +  I+  LA   G  N RS V A+++    +     Y P+   ++S   S+    S    
Sbjct: 244 QKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYGPNGTPQQSAIRSQQTSSSTELA 303

Query: 299 TSQPESAVTVEQNMPHVSDR--------KVPLPRSLENTDKKEEQSNYEINTKSIATTHD 350
            S          N P             +   P +   +D+K+  +NYE++         
Sbjct: 304 QSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPVSDRKDSTTNYELDKTVRHVEQS 363

Query: 351 NYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITS 410
              ++RLS+AVVVN    T+  GR   Q      LA++ ++V  A G + +RGD++ + +
Sbjct: 364 MGTIKRLSVAVVVNYQPSTDAKGRVTMQPLAADKLAQVQQLVKDAMGYDEKRGDSVNVVN 423

Query: 411 MDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRR 462
             F       +        D++           V      L       ALRR
Sbjct: 424 SAFSAAADPFANLPWWRQPDMIELGKDIAKWLGVAAAAAALYFMFVRPALRR 475


>gi|77165822|ref|YP_344347.1| flagellar FliF M-ring protein [Nitrosococcus oceani ATCC 19707]
 gi|254434642|ref|ZP_05048150.1| flagellar M-ring protein FliF [Nitrosococcus oceani AFC27]
 gi|76884136|gb|ABA58817.1| Flagellar FliF M-ring protein [Nitrosococcus oceani ATCC 19707]
 gi|207090975|gb|EDZ68246.1| flagellar M-ring protein FliF [Nitrosococcus oceani AFC27]
          Length = 567

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 127/563 (22%), Positives = 245/563 (43%), Gaps = 33/563 (5%)

Query: 6   QLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISV 65
           +L     +   L   + + L   I   + L +    +  +P Y  +Y  +   +   I  
Sbjct: 24  RLAALQANIGRLSLQKQVGLLLAIAASVALVVGIFMWSWAPTYQVMYGAVTGKEKGEIVA 83

Query: 66  ALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSF 125
           AL +ANI++R+++N  +I VP+S V + R+ LA +GLP S +++G+EL ++   FG + F
Sbjct: 84  ALQKANIEYRLAENTGAIMVPASKVHEVRLQLAMEGLPRS-ADTGFELLEQNPGFGASEF 142

Query: 126 MQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPS 183
           +++    RALEGE+ARTI +++ +  ARVH+ +P    F +    P+ASV++        
Sbjct: 143 LEKARYQRALEGELARTIGALNNVRNARVHLALPKQSVFIRNRRAPSASVVLDLYAGRTL 202

Query: 184 VYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE--MERNILGKSLSIVQAIQHEI 241
                 AI HLVA+++PNL+   VT++D  G LLT  +      +        + ++ + 
Sbjct: 203 DPGQVAAITHLVASSIPNLESSGVTLVDQRGNLLTRQDRSQSLGMTEGQFEHTRRLEEKY 262

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
              I   LA  +G +  R+ VVAE++    +  +  Y+P S   RS ++S++ +R+ +  
Sbjct: 263 ISRIQHILAPMIGSNKVRAQVVAEVDFTVTEQTQEYYNPGSAALRSEQMSEE-ERTGSRL 321

Query: 302 PESAVTVEQNMPHVSDRKVPLPRSL----------ENTDKKEEQSNYEINTKSIATTHDN 351
           P+       N P    +                    T  +    NYE++     +    
Sbjct: 322 PQGIPGALSNQPPADAQAPETVPEANGDEAQIEPVPTTRSQRATRNYELDRTISHSRLSP 381

Query: 352 YKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSM 411
             + RLS+AV+V++  +T+  G  +   +    LA++  +V  A G N+ RGDTI + + 
Sbjct: 382 GSIRRLSVAVLVDEKAVTDAEGAVSTLPRSPQELAQVTALVKEAVGFNAERGDTINVINA 441

Query: 412 DFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKK 471
            F+      +      +       F   +     ++  LL+    L    R         
Sbjct: 442 PFVPANEEEAFPELSLWQ---QDWFWQAVKQGGGILAILLLLLGVLRPAFRRLTALPEP- 497

Query: 472 GEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRL 531
                 ++ + P      +   +  D ++L S+   +     +          + +   +
Sbjct: 498 -----VALSAIPNKDEEESDDGLQEDQLSLSSNKPTLQLSGPHSL--------EANLEIV 544

Query: 532 LHMIEINEERFAKILRKWARSEI 554
             M   +  R A++++ W  S++
Sbjct: 545 REMATGDSRRVAQVVKNWLVSDV 567


>gi|121602745|ref|YP_989390.1| flagellar MS-ring protein [Bartonella bacilliformis KC583]
 gi|120614922|gb|ABM45523.1| flagellar M-ring protein FliF [Bartonella bacilliformis KC583]
          Length = 553

 Score =  358 bits (918), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 207/556 (37%), Positives = 319/556 (57%), Gaps = 15/556 (2%)

Query: 3   ILDQLLQFFKS----GTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVS 58
           +LD+   F  S       LG  R++ L  V +      + + F++  P ++ LYV L   
Sbjct: 1   MLDKFFVFLSSSGSALYKLGAKRLIALGLVGVTLFGTILFSSFYLTRPSHETLYVGLSRD 60

Query: 59  DVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVN 118
           DVNRI +AL EA I F +S +G S+ VP      AR+ LA +GLP+S+ N+GYELFD + 
Sbjct: 61  DVNRIGMALGEAGIAFDVSSDGGSVQVPVGQAEHARMFLAEKGLPTSN-NAGYELFDNMG 119

Query: 119 SFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR 178
           S GLTSFMQEITR RALEGEIARTIQ++ G+ AARVHIV+PD GSFR+   +PTASV+IR
Sbjct: 120 SLGLTSFMQEITRQRALEGEIARTIQAVQGVKAARVHIVLPDKGSFRRANQKPTASVVIR 179

Query: 179 AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL-TANEMERNILGKSLSIVQAI 237
                  +SA++IRHLVAAAVP+L+   VTV+D+ G++L +  +          S+   +
Sbjct: 180 TDGGFSVESAQSIRHLVAAAVPSLEASSVTVMDTRGQMLASGVDAINGAPVVMASLEHQV 239

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRS 297
             +I+ NI K L  +LG+D+F+++V   L+ D +QI E ++DP+S+V RSIR  +D   S
Sbjct: 240 ASQIDANIRKQLVPYLGLDHFQTSVQVALDTDRRQINETIFDPESQVVRSIRSVRDQADS 299

Query: 298 ETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERL 357
           + S+   AV VEQN+P           S +  D++EE +NYEIN+K I+T  D Y +++L
Sbjct: 300 QNSRNSDAVGVEQNIPQEEIANGSGETSTDKKDRREETTNYEINSKIISTVRDGYSVKKL 359

Query: 358 SIAVVVNKGRLTEVLGRSA-DQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLEN 416
           +IA+VV++ RL    G +   +  I+  +  I ++VSAA G++  RGD I +T++DF+ +
Sbjct: 360 AIAIVVDRARLVPANGETTVSEDFINDEVNRIQQMVSAAAGLDPNRGDIINVTAVDFIGH 419

Query: 417 QLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGG 476
              +   ++      +SR+   V+N +  ++  LL+ FLG+  L R            G 
Sbjct: 420 NDADLTPIETPLWKSVSRYIPGVVNGVALVIAVLLILFLGVRPLMREMR--------EGQ 471

Query: 477 KSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIE 536
           K+  S     + +      ++     +    +   + +    + + +      RL  MI+
Sbjct: 472 KARNSGENALAGLGAVPALDNQSQAAAGVGGVTKTNDDTLRDLRNRMRVPPQNRLEKMID 531

Query: 537 INEERFAKILRKWARS 552
           ++EERFA ILR+W   
Sbjct: 532 MDEERFAGILREWVND 547


>gi|15887871|ref|NP_353552.1| flagellar MS-ring protein [Agrobacterium tumefaciens str. C58]
 gi|15155457|gb|AAK86337.1| flagellar M-ring protein [Agrobacterium tumefaciens str. C58]
          Length = 566

 Score =  358 bits (918), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 266/555 (47%), Positives = 380/555 (68%), Gaps = 7/555 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M +L+Q+ Q  K+  +LG+TR+L+L  V ++ + + +AA  +VN P Y+ LYV LE SD+
Sbjct: 7   MNLLNQIPQVLKNVAALGQTRLLMLGGVGVLSMAIILAAALYVNRPAYETLYVGLEKSDL 66

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           N+IS+AL+E+ +DF++  +GSS+ VP  +  KAR+ LA +GLP  S+N+GYELFD V S 
Sbjct: 67  NKISIALAESGLDFQVGTDGSSLQVPVGLTSKARLLLAERGLP-DSANAGYELFDNVGSL 125

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEI R+IQ I G+ AARVHIV+PD+G+FR+   +PTASVMIRA 
Sbjct: 126 GLTSFMQEVTRVRALEGEIGRSIQQIDGVSAARVHIVLPDVGNFRRGEQKPTASVMIRAS 185

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL-GKSLSIVQAIQH 239
             +  K++ +IRHLVA+AVP L++ DVT+LDSTG+LL + +   N    +SL++ Q +Q 
Sbjct: 186 ASAGRKASASIRHLVASAVPGLEVDDVTLLDSTGQLLASGDDVTNAAMNRSLTLAQNVQQ 245

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           EI  NI+KALA FLG+DNFRS+V A++N D++Q++E VYDP+S+VERS+R  K+ Q+S+ 
Sbjct: 246 EITTNIDKALAPFLGIDNFRSSVTAQINTDSRQVQETVYDPESRVERSVRTVKEDQKSQE 305

Query: 300 SQPESAVTVEQNM-PHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLS 358
           +QP++A TVEQN+           P+S + + KKEEQ+NYEIN+K++AT  + Y LE++S
Sbjct: 306 TQPDTAATVEQNVPQAAPQGGGGGPQSSDQSAKKEEQTNYEINSKTVATVKNGYTLEKIS 365

Query: 359 IAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQL 418
           +AVVVNKGR+ +++G  ADQ KID+YLAE+ KIV++A GI+S RGD +T+T+MDFLE QL
Sbjct: 366 VAVVVNKGRIAKMVGEPADQAKIDAYLAEMQKIVTSAAGISSDRGDIVTLTAMDFLETQL 425

Query: 419 FNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKG----EV 474
            +        M++LSR+ A +IN+L F+    LV +LG+  L R    + +       E 
Sbjct: 426 LDEAASGPGVMEVLSRNSAGIINSLAFVAVAFLVVWLGVRPLVRTVTANGSAAAQLSQES 485

Query: 475 GGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHM 534
            G  +    P   A   GLM          + D      + +   N  V +  + RL  M
Sbjct: 486 AGLELPDFSPGMEAGAGGLMEGFGADFGFDSTDDLLAGGDGEGTFNRRVREGPERRLSRM 545

Query: 535 IEINEERFAKILRKW 549
           +EI+EER AKILRKW
Sbjct: 546 VEISEERAAKILRKW 560


>gi|116696304|ref|YP_841880.1| flagellar MS-ring protein [Ralstonia eutropha H16]
 gi|113530803|emb|CAJ97150.1| Flagellar M-ring protein [Ralstonia eutropha H16]
          Length = 576

 Score =  358 bits (918), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 117/563 (20%), Positives = 218/563 (38%), Gaps = 72/563 (12%)

Query: 38  AARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHL 97
               +  SP Y  LY  L   D   +  +L + N+ ++ ++ G ++ VP+  V + R+ L
Sbjct: 39  VGVLWSRSPDYKVLYSNLSERDGGAVLQSLQQMNVPYKFAEGGGAVMVPAEKVHETRLRL 98

Query: 98  AAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIV 157
           A+QGLP S   +G EL D    FG++ F +++   R LEGE+AR+I+SI+ + +ARVH+ 
Sbjct: 99  ASQGLPKSG-TAGMELMDN-QKFGISQFAEQVNYQRGLEGELARSIESIAAVQSARVHLA 156

Query: 158 MPDMGSFRKIGARPTASVMIRAINPS--VYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGK 215
           +P    F +   +PTAS++++             AI HLV+++VP L    ++++D  G 
Sbjct: 157 IPKPTLFVRERQKPTASIVLQLYPGRAIDEGQVAAISHLVSSSVPELTPKSISIVDQHGN 216

Query: 216 LLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           LL+    ER +    L  VQA++      I   L   +G DN R+ V A+++    +  +
Sbjct: 217 LLSNTGNERMLDATQLKYVQALEQNYLKRIEAILTPIVGKDNVRAQVTADVDFSIVEHTD 276

Query: 276 IVYDPDSKVERSIRLSKDAQRSETSQ---PESAVTVEQNMPHVSDRK------------- 319
             Y P+    RS   S+    S       P        N P  +                
Sbjct: 277 ESYKPNQDPTRSAIRSQQTSESTQQGVTPPGGVPGALSNQPPAAAAAPVTTPQTPRAGQA 336

Query: 320 ----------------------------VPLPRSLENTDKKEEQSNYEINTKSIATTHDN 351
                                            S  ++++++   NYE++          
Sbjct: 337 PGQAGAPAAGQPGQPGQAAQPGQGAQVANATASSGPSSNRRDSTVNYELDRSVRHVQQAP 396

Query: 352 YKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSM 411
             + RLS+AVVVN  +  +  G+   +    + LA+I  +   A G ++ RGD+I + + 
Sbjct: 397 GGVRRLSVAVVVNYRQQADAKGKLVAEPLPPALLAQIQNLTKEAMGFSADRGDSINVVNS 456

Query: 412 DFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKK 471
            F   +   +  V +     +     T+   L+  +  L V F     + R +       
Sbjct: 457 PFTAEREKAAPEVPLWKQPDMIELGKTLAGYLLLALLALFVWFKVARPVLRRYTSPPLPA 516

Query: 472 GEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRL 531
            E   ++     P        ++                          +   +     +
Sbjct: 517 PEPRDETEAVLLPPDEPANPEILRL------------------------AAKYESDLALV 552

Query: 532 LHMIEINEERFAKILRKWARSEI 554
               + +    A +++ W  ++ 
Sbjct: 553 RDAAQRDPRLVASVIKNWIANDN 575


>gi|222053602|ref|YP_002535964.1| flagellar M-ring protein FliF [Geobacter sp. FRC-32]
 gi|221562891|gb|ACM18863.1| flagellar M-ring protein FliF [Geobacter sp. FRC-32]
          Length = 522

 Score =  358 bits (917), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 130/556 (23%), Positives = 237/556 (42%), Gaps = 51/556 (9%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           + L +      SL  ++ LI+A V    ++ F A  F  N   Y  L+  L   D   I 
Sbjct: 3   EGLKKLLDPFLSLPTSKRLIVAGVAACSLLAFAALIFVANRTDYRPLFANLTTEDAGEIV 62

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L +  + ++IS +G +I VPS  V + R+ LA +GLP      G+E+FD+ N FG+T 
Sbjct: 63  KKLKDQKVAYQISADGKAILVPSDKVYELRLSLAGEGLPQGGG-IGFEIFDRKN-FGMTE 120

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV 184
           F+Q++   RAL+GE++RTI  ++G+  ARVH+V+P+   F+     PTASV+++  +   
Sbjct: 121 FVQKLNYQRALQGELSRTIAQLAGVEQARVHLVIPEKSLFKDSEKPPTASVVLKMKSNRT 180

Query: 185 Y--KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT---ANEMERNILGKSLSIVQAIQH 239
                 + + HLV++A+  +D  +VTVLDS GK+L+    ++    +        +  + 
Sbjct: 181 LRENEVQGVVHLVSSAIEGMDTENVTVLDSRGKVLSRTGPSDATGKLTSTMQETQRNYEK 240

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
            +E  +   L   +G     + V A  +    +  E  YDP++   RS + S++   +  
Sbjct: 241 NLEERLQSLLDKVVGSGRSVARVSATFDFKQVEKYEEKYDPETAAVRSEQRSEEKAGATN 300

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
                   V+ NM     R  P   +     K +E  NYE++  +         L ++S+
Sbjct: 301 I-AAGVPGVQTNM----GRTAPGAGTTGGGSKSDETLNYEVSRTTARIIEPVGSLTKVSV 355

Query: 360 AVVVNKGR-----LTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFL 414
           A++V+              ++  Q +    L +I  +V ++ G N+ RGD +T+ ++ F 
Sbjct: 356 AILVDGKYEAPAAAKAGAAKAKYQPRTPDELQKIESLVKSSVGFNAERGDQVTVANIPFQ 415

Query: 415 ENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEV 474
           E     S         I      T++  L+   G   + F  +  L R+           
Sbjct: 416 ETGDMGSAEDAWWNAPI----VMTLLKNLLIAGGFFAIIFFVIKPLMRMLPHRPP----- 466

Query: 475 GGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHM 534
                                    +     +D+     N   +    +   + L L+  
Sbjct: 467 -------------------------SFQPVQEDLEMIQLNEAHKQELALQTLNQLELIEK 501

Query: 535 IEINEERFAKILRKWA 550
           ++ +  + A+IL+ W 
Sbjct: 502 VKQDPYQVAQILQNWL 517


>gi|258592505|emb|CBE68814.1| Flagellar basal body M-ring protein [NC10 bacterium 'Dutch
           sediment']
          Length = 539

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 126/549 (22%), Positives = 226/549 (41%), Gaps = 34/549 (6%)

Query: 10  FFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSE 69
           F +    LG T   +   V    +   +   F  + P    L+ +L  SD   I   L  
Sbjct: 12  FKQVWGGLGLTGRALTVLVGGGALTALLWMVFSTHRPDMTTLFSQLNPSDAGAIVDELKS 71

Query: 70  ANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEI 129
             + +R+ D G+ I VPS++V + R+HLA +GLP      G+E+FD+    G T F+Q +
Sbjct: 72  GKVSYRVVDGGTRILVPSAVVHEIRLHLATRGLPQGGG-VGFEIFDRTT-LGTTDFVQRL 129

Query: 130 TRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVM--IRAINPSVYKS 187
              RAL+GE+ARTI  +  + AARVH+ +P    F +     TASV+  +R       + 
Sbjct: 130 NYQRALQGELARTIGQLKEVTAARVHLALPQPSVFTEQEKPATASVVLNLRPGARLTPEQ 189

Query: 188 AEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGK--SLSIVQAIQHEIEMNI 245
              I HLV+++V  L+   +TV+D++GKL+      R   G        +A++ E+E  +
Sbjct: 190 VRGIVHLVSSSVEGLNADRITVVDTSGKLIARPAEGRLGAGSTGQFEAQEAVEGELERRV 249

Query: 246 NKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESA 305
              L   LG +     V A+++  + +  E  +DP   V +S + + + Q+S T+ P + 
Sbjct: 250 RTMLEEILGPNKATVRVAAQMDFTSVERTEERFDPRG-VIKSEQRTTETQQSVTASPAAV 308

Query: 306 VTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNK 365
             V  N+P  +       +S   + K+ E   Y+++           +L+R+S+AV+V+ 
Sbjct: 309 AGVASNVPDQTATPSQSGQSTAKSTKEAETVQYDVSKVLERKVFSPGELKRVSVAVMVDG 368

Query: 366 GRLTEVLGR----SADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNS 421
                  G+         +    L +I   V  A G ++ RGD + +    F  +     
Sbjct: 369 TYKPVPDGKGGERKEYVPRKSDELEKIKVAVKNAVGFSAARGDEVEVVEFPFDTSATEKE 428

Query: 422 GTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILS 481
             +          +  +++  ++  VG LLV   GL  L R          +  G     
Sbjct: 429 RALMEEAERKAFWY--SLVKPVLMGVGVLLVLVFGLRPLIRSLKERRLPTFDTPGM---- 482

Query: 482 PPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEER 541
                            +++            +    ++          L+ +   N   
Sbjct: 483 -----------------LSMSQPGPTAIETGPDQAPALDVASDDPLRTGLMELARNNPNV 525

Query: 542 FAKILRKWA 550
            A+++R W 
Sbjct: 526 VAQLVRAWM 534


>gi|238758092|ref|ZP_04619272.1| Flagellar M-ring protein [Yersinia aldovae ATCC 35236]
 gi|238703630|gb|EEP96167.1| Flagellar M-ring protein [Yersinia aldovae ATCC 35236]
          Length = 569

 Score =  357 bits (916), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 127/583 (21%), Positives = 235/583 (40%), Gaps = 58/583 (9%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           ++   F  + T L     + L       + + +A   +  SP Y  LY  L   D   I 
Sbjct: 10  NRENTFTATLTRLRANPKIPLLIAAAAAVAIIVALMLWAKSPDYRVLYSNLSDRDGGDIV 69

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L++ NI +R +DNG ++ VP+  V + R+ LA QGLP   +  G+EL D+   FG++ 
Sbjct: 70  TQLTQLNIPYRFADNGGALLVPAEKVHETRLRLAQQGLPKGGA-VGFELLDQE-KFGISQ 127

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVM--IRAINP 182
           F ++I   RALEGE++RTI ++  ++  RVH+ MP    F +    PTASV   ++    
Sbjct: 128 FSEQINYQRALEGELSRTIGTLGPVMNVRVHLAMPKPSLFVREQKSPTASVTLALQPGRA 187

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQHEI 241
                  AI ++V+++V  L  G+VTV+D  G+LLT ++     +    L     +++  
Sbjct: 188 LDDGQINAIVYMVSSSVAGLPPGNVTVVDQMGRLLTQSDSAGRDLNAAQLKFTNEVENRF 247

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
           +  I   LA  +G  N  + V A+++   ++  +  Y P+    +    S+    SE   
Sbjct: 248 QRRIENILAPMVGNGNVHAQVTAQVDFANREQTDEEYKPNQDANQGAVRSQQVSTSEQLG 307

Query: 302 P---ESAVTVEQNMPHVSD----------------------------RKVPLPRSLENTD 330
                       N P ++                                    +  +  
Sbjct: 308 GTNVGGVPGALSNQPPIAPVAPIEAPQAAPAAGATANTANTANRPATTTAAKSSATSSNS 367

Query: 331 KKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINK 390
           + ++ +N+E+N     T      ++RLS+AVVVN G                  LA++  
Sbjct: 368 RHDQTTNFEVNRTIRHTQQQAGMVQRLSVAVVVNYGS----DKAGKPIALTKDQLAQVES 423

Query: 391 IVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTL 450
           +   A G ++ RGDT+ + +  F  +      ++              ++NA  +L+  L
Sbjct: 424 LTREAMGFSTTRGDTLNVVNTPFSASDDTGGHSLPFWQQPSFFDQ---LLNAGRYLLILL 480

Query: 451 LVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFS 510
           +   L    +R +         +    S+ +    ++A  T     + +AL   NQ   S
Sbjct: 481 VAWILWRKLVRPMIAKKQV--ADNAAASVNNIVQTAAASETAKQSKEELALRKKNQQKVS 538

Query: 511 HSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
                         +    R+  + + +    A ++R+W  ++
Sbjct: 539 A-------------EVQAQRIRELADKDPRVVALVIRQWMSND 568


>gi|152997451|ref|YP_001342286.1| flagellar MS-ring protein [Marinomonas sp. MWYL1]
 gi|150838375|gb|ABR72351.1| flagellar M-ring protein FliF [Marinomonas sp. MWYL1]
          Length = 558

 Score =  357 bits (916), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 119/561 (21%), Positives = 222/561 (39%), Gaps = 35/561 (6%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L+       L   R L L   +   I + +AA  + N P Y  +   +   + ++I   L
Sbjct: 15  LELVTGFNKLTVIRQLALMVGLAASIAIGLAAVLWSNGPDYKPVLSSITDYNADQIVEIL 74

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           S  NI F++  N  ++ V S    +AR+ LA  G+  S +  G E+ D+    G + F++
Sbjct: 75  SVNNIPFKLDQNTGALLVESDFYHQARLKLAGSGIV-SDNIVGMEIMDQEQGLGTSQFVE 133

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN--PSVY 185
                R LEGE++RTI S+  I +ARVH+ +P    F +   +P+ASV +          
Sbjct: 134 TTRYRRGLEGELSRTIASLQSIKSARVHLAIPKESVFVRDTRKPSASVFLELYPGRRLDK 193

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNI--LGKSLSIVQAIQHEIEM 243
              EAI +LVA+++  L   DVTV+D  G LLT  + +  +   GK     + ++  +  
Sbjct: 194 SQVEAIVNLVASSISQLSDKDVTVVDQRGTLLTEKDSDSELSVAGKQFDYARKVEEVLLQ 253

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            +N  L   +G   F++ V A+++    +     Y+PD    RS +  ++  RS  +   
Sbjct: 254 RVNNILGPVIGQGRFKAEVSADVDFTAVEKTNEQYNPDLLALRSEQTLRE-NRSAGTSAS 312

Query: 304 SAVTVEQNMPHVS-----------DRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNY 352
                  N P  +                   +     ++E   N+E++     T     
Sbjct: 313 GIPGALTNQPPGAVTIPEAVDENGAPIGGNTSAKNGQSREETTRNFELDRSISYTKRQQG 372

Query: 353 KLERLSIAVVVNKGRLTEVLGRS-ADQGKIDSYLAEINKIVSAATGINSRRGDTITITSM 411
            + RLS+AVVV+          +       D  L  +  +V  A G +  RGD++++ + 
Sbjct: 373 MVRRLSVAVVVDDLMSLNPDTSAIVRTPWNDDELGRLTLLVRDAVGYDPSRGDSVSVINS 432

Query: 412 DFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKK 471
            F    L +     +         F  +I   +  +  L++  + +  + +         
Sbjct: 433 PF---ALPDPEEPAIELPFYQQAWFLGLIQPTLVGIFVLILLLVVVRPILKTL------S 483

Query: 472 GEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRL 531
            +              +  T  + +D ++L S+   +   S     R            +
Sbjct: 484 EQNKIAVTEDTEAAIFSDETDEISDDQVSLVSAEDILVPGSPEKIDR--------QLNAI 535

Query: 532 LHMIEINEERFAKILRKWARS 552
             +I    ER A+++++W   
Sbjct: 536 RGLIAEEPERVAQVVKQWVME 556


>gi|119476321|ref|ZP_01616672.1| flagellar M-ring protein FliF [marine gamma proteobacterium
           HTCC2143]
 gi|119450185|gb|EAW31420.1| flagellar M-ring protein FliF [marine gamma proteobacterium
           HTCC2143]
          Length = 562

 Score =  357 bits (916), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 118/556 (21%), Positives = 223/556 (40%), Gaps = 28/556 (5%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
             F     ++G  R L L   +   + +  A   +     Y  LY  L+  D   +   L
Sbjct: 18  NDFLNGLGNIGILRQLFLMVGLAASVAMGGAIVLWSVGEEYRPLYSSLDHMDPGEVLNIL 77

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
             + ID ++ +N  ++ V +  +  AR+ LA  G+    S  G+E+ DK    G + FM+
Sbjct: 78  QSSQIDHKVDENTGALLVAADQIHDARLKLAGAGISPDGS-FGFEMLDKEQPLGTSQFME 136

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPSVY 185
                R LEGE+ RTI SI  +  ARVH+ +P   +F +   +PTASV +     +    
Sbjct: 137 SARFKRGLEGELGRTIASIQAVRGARVHLAIPKTSAFIRDVRKPTASVFLDLYGGSGINT 196

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT--ANEMERNILGKSLSIVQAIQHEIEM 243
           +   AI ++VA ++P L + +VTV+D  G LL+    + +  +  K L  V+ ++  +  
Sbjct: 197 EQVRAIANMVAFSIPELTIQNVTVVDQRGNLLSNFDADQDMAMAHKQLDYVREMEGRLVK 256

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            ++  L   LG  NFR+ + A ++    +  + +++PD    RS +  ++ +        
Sbjct: 257 RVSSILEPVLGEGNFRAEISANVDFTQVEQTDELFNPDLPAIRSEQTVEEGRGGGGVGGV 316

Query: 304 SAVTVEQNMPHVSDRKVPLP--------RSLENTDKKEEQSNYEINTKSIATTHDNYKLE 355
                  N P    +                 +T +++   NYE++     T H   +L 
Sbjct: 317 PG--ALSNQPPRDGQAPEQIVDGGAAALAESVSTSRRQSVRNYELDRTISHTRHQVGRLR 374

Query: 356 RLSIAVVVNKGRLTE-VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFL 414
           RLS+AV+V+     +   G         S L ++  +V  A G ++ RGD++ I +  F 
Sbjct: 375 RLSVAVLVDNTTNIDSETGEIVSVAIEQSELDQLAILVRDAVGFDAARGDSVNIINSAF- 433

Query: 415 ENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEV 474
                      V   ++      T+   + +    +L+  L    +R           E+
Sbjct: 434 ---AVKEAPEVVPMEEVPIWQQPTIERYIKYAGAFVLIMMLLFFVMRPAFRNLTDGSKEL 490

Query: 475 GGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHM 534
                       S      + ++ + L      + S          +   +Q    +  +
Sbjct: 491 RELEAQRALGDLSGDLGSGLADETVTLSGGESLLLSGP--------NKNYEQQLSTVRGL 542

Query: 535 IEINEERFAKILRKWA 550
           I  +  R A++++KW 
Sbjct: 543 IAEDPGRVAQVVKKWV 558


>gi|253702508|ref|YP_003023697.1| flagellar M-ring protein FliF [Geobacter sp. M21]
 gi|251777358|gb|ACT19939.1| flagellar M-ring protein FliF [Geobacter sp. M21]
          Length = 522

 Score =  357 bits (915), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 126/556 (22%), Positives = 237/556 (42%), Gaps = 48/556 (8%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           + L +  +   +L   + L++  V L  ++ F A     N   Y  L+  L   D   I 
Sbjct: 3   EGLKKLLEPFLALSSAKRLVVGGVALASLLGFAALIAVANKTDYRPLFANLTQEDAGEIV 62

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L E  + ++IS +G +I VPS  V   R+ LA+ GLP      G+E+FD+ N FG+T 
Sbjct: 63  KKLKEQKVPYQISPDGKAILVPSDNVYDLRLSLASDGLPQGGG-IGFEIFDRKN-FGMTE 120

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV 184
           F+Q++   RAL+GE+ RTI  I+G+ +ARVH+ +P+   F++     TASV+I+  +   
Sbjct: 121 FVQKLNYQRALQGELGRTIAQIAGVESARVHLALPEKALFQEQEKPATASVVIKMKSNRQ 180

Query: 185 YK--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTAN---EMERNILGKSLSIVQAIQH 239
            +    + + HLVA+++  +D   VTVLD+ GK+L+++   +    + G      +A + 
Sbjct: 181 LREGEVQGVVHLVASSIEGMDPEQVTVLDTRGKVLSSHSSNDPTSKLAGARQDTQRAFEK 240

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
             E  +   L   +G     + V A  +    +  E  YDP+S   RS + S++     +
Sbjct: 241 TEEEKLQSLLDRVVGSGKSVARVSASFDFKQVEKYEERYDPESAAVRSEQRSEEK-GGIS 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
           +    A  V+ NM     R      +     K +E  NYE++  +         L ++S+
Sbjct: 300 TTASGAPGVQTNM----GRAQGAAGTTGGGSKTDETLNYEVSRSTARIVEPVGSLSKVSV 355

Query: 360 AVVVNKGRL----TEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLE 415
           A++V+         +       Q +    + +I  +V +A G N+ RGD +T+ ++ F +
Sbjct: 356 AILVDGKYELAPGAKPDAAPKYQPRSPDEMQKIEALVKSAVGFNAERGDQVTVANIPFQD 415

Query: 416 NQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVG 475
                          ++     T+I   +  +  L + F  +  L +L  I+      + 
Sbjct: 416 TGDQVGEPPAWYDAPVVQ----TLIKNGLIGLAFLALLFYVIRPLMKLLKIEKPAHHFLP 471

Query: 476 GKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMI 535
            +       +                                ++     + + L L+  +
Sbjct: 472 IQDDAEQAQLLEM----------------------------QKVEHEKMRITQLELVEKV 503

Query: 536 EINEERFAKILRKWAR 551
           + +  + A+IL+ W  
Sbjct: 504 KQDPYQAAQILQNWLT 519


>gi|205352337|ref|YP_002226138.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205272118|emb|CAR36971.1| flagellar basal-body M-ring protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|326627387|gb|EGE33730.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 558

 Score =  357 bits (915), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 126/572 (22%), Positives = 225/572 (39%), Gaps = 54/572 (9%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +  +P Y  L+  L   D   I   L++ 
Sbjct: 14  LEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQM 73

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +R ++   +I VP+  V + R  LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 74  NIPYRFANGSGAIEVPADKVHELR--LAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVN 129

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--SA 188
             RALEGE+ARTI+++  + +ARVH+ MP    F +    P+ASV +             
Sbjct: 130 YQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQI 189

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEIEMNINK 247
            A+ HLV++AV  L  G+VT++D +G LLT +    R++    L     ++  I+  I  
Sbjct: 190 SAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEA 249

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PES 304
            L+  +G  N  + V A+L+   +   E  Y P+    ++   S+    SE      P  
Sbjct: 250 ILSPIVGNGNVHAQVTAQLDFANKDQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGG 309

Query: 305 AVTVEQNMP---------------------HVSDRKVPLPRSLENTDKKEEQSNYEINTK 343
                 N P                       +        +     ++ E SNYE++  
Sbjct: 310 VPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNSAGPRNTQRNETSNYEVDRT 369

Query: 344 SIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRG 403
              T  +   +ERLS+AVVVN   L +              + +I  +   A G + +RG
Sbjct: 370 IRHTKMNVGDIERLSVAVVVNYKTLADGK----PLPLTADQMKQIEDLTREAMGFSDKRG 425

Query: 404 DTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL 463
           DT+ + +  F                         ++ A  +L+  ++   L   A+R  
Sbjct: 426 DTLNVVNSPFSAVDNTGGELP----FWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVRPQ 481

Query: 464 HNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYV 523
                 +      ++ +                +       ++D     R    R+ + V
Sbjct: 482 LTRRVEEAKAAQEQAQVR------------QETEEAVEVRLSKDEQLQQRRANQRLGAEV 529

Query: 524 SKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
             Q   R+  M + +    A ++R+W  ++ E
Sbjct: 530 MSQ---RIREMSDNDPRVVALVIRQWMSNDHE 558


>gi|91978309|ref|YP_570968.1| flagellar MS-ring protein [Rhodopseudomonas palustris BisB5]
 gi|91684765|gb|ABE41067.1| flagellar M-ring protein FliF [Rhodopseudomonas palustris BisB5]
          Length = 532

 Score =  356 bits (914), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 139/551 (25%), Positives = 232/551 (42%), Gaps = 26/551 (4%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           +         LG  R++ + +V +  +  F      V+ P    LY  L V D + I   
Sbjct: 1   MQSLLGFLKGLGAARVMAMIAVTVALLGFFAFVIMRVSQPQMTTLYTDLSVEDSSSIIKE 60

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L    I F + + G+++ VP   V + R+ LA           GYE+FDK ++ G TSF+
Sbjct: 61  LERQAIPFEMRNEGTTLMVPKDKVTRLRMKLAEG-GLPKGGGVGYEIFDKSDALGTTSFV 119

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           Q I  +RALEGE+ARTI++I  I  ARVH+V+P+   F +    P+AS+++R       +
Sbjct: 120 QNINHLRALEGELARTIRAIDRIQQARVHLVLPERPLFSRETPEPSASIVLRVRGALEPQ 179

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA--NEMERNILGKSLSIVQAIQHEIEMN 244
              AIRHLVA+AV  L    V+++D  G+LL                    + +  +   
Sbjct: 180 QVRAIRHLVASAVNGLKPQRVSIVDEGGQLLADGSASANAADGAAGDERRTSFEKRMRNE 239

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPES 304
           I   +++ +G    R  V A+ + +        +DP+ +V RS +  ++  +S+TS  + 
Sbjct: 240 IEGIVSSVVGSGRARVQVTADFDYNKITQTSDKFDPEGRVLRSSQTREE--QSQTSAADG 297

Query: 305 AVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVN 364
            VTV   +P    +    PR  + + K EE +NYEI+  +     +  ++ RLS+AV+V+
Sbjct: 298 QVTVNNELPGNQGQAGTGPR--DQSKKSEETNNYEISRITKTEVTEAGRVNRLSVAVLVD 355

Query: 365 KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTV 424
                   G      +    L  I  +V +A G + +RGD I + ++ F E         
Sbjct: 356 GIYTKNEKGELVYAERPKEQLDRIAALVRSAIGFDQKRGDQIEVVNLKFAEAPQVEKLPE 415

Query: 425 QV---SFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILS 481
           Q                +I   V LV  L+V F+ +  L +     D      G  ++  
Sbjct: 416 QAGLLGMFQFTKDDIMNMIQLGVMLVLGLVVLFMVIRPLVKRVLASDPGPEGPGLPALT- 474

Query: 482 PPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEER 541
                          D              S    +++   V  QS  R+  + + N   
Sbjct: 475 ---------------DGSVPQIGADGQPQPSMIDIAQVQGQVHAQSVHRVGELADRNPNE 519

Query: 542 FAKILRKWARS 552
            A I+R+W   
Sbjct: 520 TAAIVRQWLAE 530


>gi|268589960|ref|ZP_06124181.1| flagellar M-ring protein FliF [Providencia rettgeri DSM 1131]
 gi|291314677|gb|EFE55130.1| flagellar M-ring protein FliF [Providencia rettgeri DSM 1131]
          Length = 561

 Score =  356 bits (914), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 115/533 (21%), Positives = 222/533 (41%), Gaps = 36/533 (6%)

Query: 39  ARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLA 98
              ++ SP Y  L   L   D   I   L++ N+ ++I+DNGS+I VP+  V + R+ LA
Sbjct: 44  LLLWLRSPDYRVLLSNLSAKDGGDIVGQLTQMNVPYQIADNGSAILVPADKVHELRLKLA 103

Query: 99  AQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVM 158
             GLP    N+G+EL DK   FG++ F ++I   RALEGE++RTI+S+S + +ARVH+ +
Sbjct: 104 QSGLPK-GGNTGFELLDKEQ-FGISQFSEQINYQRALEGELSRTIESLSPVQSARVHLAI 161

Query: 159 PDMGSFRKIGARPTASVMIR--AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKL 216
           P    F +    PTASV +              AI H+V+++V  L   +V ++D  G+L
Sbjct: 162 PKPTLFVREQKLPTASVTVGLLPGRMLDEGQISAIVHMVSSSVTGLTASNVIIVDQAGRL 221

Query: 217 LTANEMERNILGK-SLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           LT N+  +       + + + ++  ++  I   L+  +G  N  + V A+++    +   
Sbjct: 222 LTNNDNSQQSANSAQIKMTKEMESHLKQRIEDILSPLVGRANIHAQVTAQMDFSKVEQTS 281

Query: 276 IVYDPDSKVERSIRLSKDAQRS---ETSQPESAVTVEQNMPHVSD-------------RK 319
             Y P+   + +   S+   +S                N P  +               +
Sbjct: 282 EEYKPNQTPDSAAIRSRQNSQSMQNNNGGTGGVPGALSNQPVSAPSAPIETNKDNKDGAQ 341

Query: 320 VPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQG 379
               R+  +  + +E +NYE++ K   T      ++RLS+AV+VN        G    + 
Sbjct: 342 TANNRNSVSNSQSDETTNYEVDRKISHTQRQIGVVDRLSVAVIVNYHSQDGENG-PEMKP 400

Query: 380 KIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATV 439
                L +I  +   A G ++ RGD++ IT+  F       +   +   +    +  A +
Sbjct: 401 LPPEMLQQIEALTREAMGFSTARGDSLNITNSLFTN----EAPVEEAPSLLESPQFIAQL 456

Query: 440 INALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNI 499
           ++    L+  ++  F+    ++         +       +     + + +      ++ +
Sbjct: 457 LDYGKILLIAIIAWFMWRFGIKPQWVKYRKAQQAQAEAEVFVATQLKTPLVVDEAIDEEM 516

Query: 500 ALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARS 552
              +  +                       R+  M E + +  A ++R+W   
Sbjct: 517 DEQTRRRLTRQRVSAEIQS----------QRIREMAEKDPQIVAMVIRQWLGK 559


>gi|30250023|ref|NP_842093.1| fliF; flagellar M-ring transmembrane protein [Nitrosomonas europaea
           ATCC 19718]
 gi|30139130|emb|CAD85994.1| fliF; flagellar M-ring transmembrane protein [Nitrosomonas europaea
           ATCC 19718]
          Length = 548

 Score =  356 bits (914), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 118/566 (20%), Positives = 214/566 (37%), Gaps = 46/566 (8%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
            +          L   + L L       I L      +  SP Y  LY  L   +   I 
Sbjct: 12  KKTFSQLDKIKQLPTQKKLGLMVAAAAVIALIAGTWLWSQSPDYRVLYASLSDQEGGAII 71

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
            AL + N+ ++ S++G SI +P+S V + R+ LA QGLP   + SG+E+  +   FG + 
Sbjct: 72  EALQKMNVPYQFSESGGSILIPASQVHEVRLRLAGQGLPK-GNLSGFEIL-ENQKFGSSQ 129

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP-- 182
           F++++   RALEGE++R+IQS+S +  ARVH+ +     F +   +P  SV++       
Sbjct: 130 FLEQVNYQRALEGELSRSIQSLSAVQGARVHLAIAKPSVFTRERPQPRVSVLLNLHPGRM 189

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM---ERNILGKSLSIVQAIQH 239
              +   AI HL+++++P++ + +VTV+D  G LL+  +    E  +    L  VQ ++ 
Sbjct: 190 LSTEQVSAIVHLISSSIPDMPVKNVTVVDQQGNLLSGQKDNQAETGLDPGQLKYVQDMEQ 249

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERS---IRLSKDAQR 296
                I   L    G DN  + V A+++    +  E +Y P++    +       +    
Sbjct: 250 NFVRRIEAILTPITGEDNVHAQVTADVDFSRIERAEEIYKPNNNPAEAAAVRSQQQSESV 309

Query: 297 SETSQPESAVTVEQNMPHVSDRKV--------PLPRSLENTDKKEEQSNYEINTKSIATT 348
           S +           N P                  ++     ++E  +NYE++     T 
Sbjct: 310 SISQPEGGVPGALSNRPPAPAEAPIEAKQSSEAAAKTTPTDTRRESTTNYEVDKTISHTR 369

Query: 349 HDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITI 408
               ++ RLS AVV+N     +  G  A++      + +I  +V    G +  RGDT+T+
Sbjct: 370 QATGRINRLSAAVVINYRTKLDTEGNPANEPLSGEEIEKITALVKQTIGFDETRGDTLTV 429

Query: 409 TSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDD 468
           T+  F                D          +    L+   +V F      R       
Sbjct: 430 TNSQFNLKGDSLEELPPWKDPDT----VLLAKDIGKQLLIAAIVLFFLQKIFRPFLR--- 482

Query: 469 AKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSD 528
                                     P        + ++   HS    S +     +++ 
Sbjct: 483 ---------------------NLLPPPPPPPVPALAVKNGLEHSEAEVSTVRVVTLEENL 521

Query: 529 LRLLHMIEINEERFAKILRKWARSEI 554
            +   +        A +++ W     
Sbjct: 522 EKARLLAVTEPAIVANVVKGWVSGNE 547


>gi|197104328|ref|YP_002129705.1| flagellar M-ring protein FliF [Phenylobacterium zucineum HLK1]
 gi|196477748|gb|ACG77276.1| flagellar M-ring protein FliF [Phenylobacterium zucineum HLK1]
          Length = 548

 Score =  356 bits (914), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 131/551 (23%), Positives = 230/551 (41%), Gaps = 10/551 (1%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           + Q   +    G  R+  +  +      +  A    +  P    LY  L++ +   I+ A
Sbjct: 1   MNQLLAAIQRFGIGRLAAILGIGAGLAAVLFAMTMGLGEPK-ALLYSNLDLKEAGSITQA 59

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L +A I + +  +GS+I V    V   R+ L+++GLP++ S  GYE+FD   + G T F+
Sbjct: 60  LDQAGIKYEVKGDGSTILVGRDKVAATRLMLSSRGLPTAGS-VGYEIFDDAKALGQTDFV 118

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS-VY 185
           Q++ R RALEGE+ARTI+S+ GI +ARVH+V+P    F++   +P+ASV I     +   
Sbjct: 119 QQLNRQRALEGELARTIRSLDGITSARVHLVLPKRQLFQEEAEQPSASVNIGVGGRAPSP 178

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNI 245
           +   AI++L+A AVPNL    VTV+D   K L+  +    +  ++ S    ++  I   +
Sbjct: 179 EQVRAIQNLIAGAVPNLRPDRVTVVDQHAKTLSGGDTG--MAAEADSRKSEVEQRIAKQV 236

Query: 246 NKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESA 305
              +   +G    R  V AEL +    +++  +DPD +V RS   + +  R         
Sbjct: 237 KNLIEGVVGPGKARVNVSAELELARVTVQQETFDPDGQVIRSESTTDENSRENQEDGAGQ 296

Query: 306 VTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNK 365
             V  N+P  +            + ++E  +NYEI+        +  +++RLS+AV V+ 
Sbjct: 297 AGVAGNLPGAAALGGGGLVGS-QSGRQESTTNYEISKTVRTEVQEPGQVKRLSVAVAVDG 355

Query: 366 GRLTEVLGRS-ADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTV 424
                  G+  A   +    +  I ++V  A G N  RGD +++ ++ F           
Sbjct: 356 VTAIGADGQPGAYTPRTAEEMQRIEQLVRTAVGFNQDRGDQVSVINVRFPTPDTVGGVEA 415

Query: 425 QVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPP 484
               M          +   V  +  +L+       L +           +          
Sbjct: 416 ANPLMGFDKNDIMRAVEIGVMAIVGILMLIFVARPLLKSATGGGGGGLPMMMGGPQVTRV 475

Query: 485 ISSAVTTGLM---PNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEER 541
           +++A    +                     S+   +RI   V   S  R+   +E + E 
Sbjct: 476 VTTADGQPMQIAADGTAQLALPGPGHTELESKIDMARIEGQVKASSVKRVAEFVEKHPEE 535

Query: 542 FAKILRKWARS 552
              ILR W   
Sbjct: 536 SVAILRSWLHE 546


>gi|319944162|ref|ZP_08018438.1| flagellar basal-body M-ring protein FliF [Lautropia mirabilis ATCC
           51599]
 gi|319742457|gb|EFV94868.1| flagellar basal-body M-ring protein FliF [Lautropia mirabilis ATCC
           51599]
          Length = 574

 Score =  356 bits (914), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 110/561 (19%), Positives = 219/561 (39%), Gaps = 40/561 (7%)

Query: 14  GTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANID 73
              +     +   + ++    + ++A  +   P +  LY  L   +   +   L + N+ 
Sbjct: 23  FAQMPAATKIKAGAGVIALGAVAVSAWLWSQQPDWKVLYNNLPDREGGAVIAQLVQMNVP 82

Query: 74  FRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVR 133
           ++ ++ G +I VP++MV  AR+ LAAQGLP+S   +GYEL +K   FG T F + +   R
Sbjct: 83  YKYTEGGGAIMVPANMVNDARLRLAAQGLPASD-TTGYELLEK-QRFGTTQFQERLNFQR 140

Query: 134 ALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--SAEAI 191
            LEGE+AR+IQS++ +  ARVH+ MP    F +   +P+ASVM+        +    + I
Sbjct: 141 GLEGELARSIQSLAAVKQARVHLAMPVQSGFLREQQKPSASVMLTLYPGRTLERGQVQGI 200

Query: 192 RHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEIEMNINKALA 250
             LVA++VP++    V+V+D  GKLL+  +     +    ++    I+  +   I+  LA
Sbjct: 201 LALVASSVPDMSPKQVSVVDQYGKLLSDLDGDGSEMNTAQINYRNRIESTLTRRIDDLLA 260

Query: 251 AFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQ-----RSETSQPESA 305
             +G  N R+ V A+++    +     Y P+     +   S+           +      
Sbjct: 261 PIVGDGNIRAQVAADIDFTQSEATAETYAPNQNPGAAAMRSQQTMASRDGSGASDAAGGV 320

Query: 306 VTVEQNMPHVS---------------DRKVPLPRSLENTDKKEEQSNYEINTKSIATTHD 350
                N P  +                           + ++E  +NYE++     T + 
Sbjct: 321 PGALSNQPPATVSAPINGAAQATRAAGSASSADGGTGVSTRQESVTNYEVDRTVKVTRNQ 380

Query: 351 NYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITS 410
              + RLS+AV+VN+ +     G+          +  I  +V  A G ++ RGD++ + +
Sbjct: 381 TGTIRRLSVAVLVNQKQTKGDDGKEVSTPLTPLEMQSIEALVKQAVGFSAERGDSVQVVN 440

Query: 411 MDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAK 470
             F +        V +            +     F++  L++  + +    +        
Sbjct: 441 AAFTKRPEVVDPEVPLWKDPETVSLAKDLGKQFGFVLLALIILMMFIRPALQAMKKPAPA 500

Query: 471 KGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLR 530
            G      +     + S   +       + ++       + +++                
Sbjct: 501 AGNNLDAKVDEQLELPSPEGSTKGGVQRLEVNPEQGMGMTIAQHNAL------------- 547

Query: 531 LLHMIEINEERFAKILRKWAR 551
              +   +    A ++R W  
Sbjct: 548 --QLARTDPTAVATVVRNWVN 566


>gi|167835057|ref|ZP_02461940.1| flagellar MS-ring protein [Burkholderia thailandensis MSMB43]
          Length = 486

 Score =  356 bits (914), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 116/442 (26%), Positives = 194/442 (43%), Gaps = 15/442 (3%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 46  WSRAPDYRVLYSNLSDRDGGAIITALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 105

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++SI+ + AARVH+ +P  
Sbjct: 106 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESINAVRAARVHLAIPKP 163

Query: 162 GSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++              A+  +V+++VP++   +VT++D  G LLT 
Sbjct: 164 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAVTRMVSSSVPDMPAKNVTIVDQDGNLLTQ 223

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N R+ V A+++    +     Y 
Sbjct: 224 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARAQVSADVDFSKIEQTSESYG 283

Query: 280 PDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDR--------KVPLPRSLEN 328
           P+   ++S   S+    +     S          N P             +   P +   
Sbjct: 284 PNGTPQQSAIRSQQTSTATELAQSGASGVPGALSNTPPQPASAPIVASNGQPAGPAATPV 343

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEI 388
           +D+K+  +NYE++            ++RLS+AVVVN     +  GR   Q      LA++
Sbjct: 344 SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPAADAKGRVTMQPLAADKLAQV 403

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  A G + +RGD++ + +  F       +        D++           V    
Sbjct: 404 QQLVKDAMGYDEKRGDSVNVVNSAFSAAADPFANLPWWRQPDMIELGKDIAKWLGVAAAA 463

Query: 449 TLLVTFLGLHALRRLHNIDDAK 470
             L       ALRR        
Sbjct: 464 AALYFMFVRPALRRAFPPPAQP 485


>gi|156933442|ref|YP_001437358.1| flagellar MS-ring protein [Cronobacter sakazakii ATCC BAA-894]
 gi|156531696|gb|ABU76522.1| hypothetical protein ESA_01260 [Cronobacter sakazakii ATCC BAA-894]
          Length = 565

 Score =  356 bits (913), Expect = 6e-96,   Method: Composition-based stats.
 Identities = 132/576 (22%), Positives = 231/576 (40%), Gaps = 57/576 (9%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +   P Y  LY  L   D   I   L++ 
Sbjct: 15  VEWLNRLRANPKIPLMVAGAAAVAIIVALVLWAKQPEYRVLYSNLSDQDGGAIVTQLTQM 74

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +  +DNG+SI VP+  V   R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 75  NIPYNFADNGASIMVPAEKVYDLRLRLAQQGLPKGGA-VGFELMDQE-KFGISQFSEQVN 132

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVM--IRAINPSVYKSA 188
             RALEGE+ARTI+++  +  ARVH+ MP    F +    P+ASV   ++          
Sbjct: 133 YQRALEGELARTIETLGPVKNARVHLAMPKPSLFVREQKSPSASVTLNLQPGRALDDGQV 192

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQHEIEMNINK 247
            AI H+V++AV  L  G+VT++D TG+LLT +      +    L     ++  I+  I  
Sbjct: 193 AAIVHMVSSAVAGLPPGNVTLVDQTGRLLTQSGTGARDLNDAQLKYASDVEGRIQRRIES 252

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PES 304
            LA  +G  N  + V A+++   ++  E  Y P+S   +    S+    ++      P  
Sbjct: 253 ILAPIVGTGNVHAQVTAQIDFSNKEQTEEQYRPNSDPSQMAVRSRQLNTNDQVGGAYPGG 312

Query: 305 AVTVEQNMPHV--------------------------SDRKVPLPRSLENTDKKEEQSNY 338
                 N P                                     S  ++ +++E +NY
Sbjct: 313 VPGALSNQPAPANSAPIDAPAGQNNGQNANGQNAQRTQSTSTAGASSGPHSSQRDETTNY 372

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGI 398
           E++     T  +   ++RLS+AVVVN  +L    G           L +I  +   A G 
Sbjct: 373 EVDRTIRHTKMNVGDVQRLSVAVVVNYRQL----GNGKPLALTAEQLKQIEDLTREAMGY 428

Query: 399 NSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLH 458
           + +RGDT+ + +  F  +                      +++A  +LV  ++   L   
Sbjct: 429 SDKRGDTLNVVNSQFTASDESGGELP----FWKQQAFIDQLLSAGRWLVVLIVAWLLWRK 484

Query: 459 ALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSR 518
           A+R        +   V                      +       ++D  +  R    R
Sbjct: 485 AVRPQLQRRAEEVKRVQEMQQQRK------------EVEESVEVRLSKDEQTQQRRANQR 532

Query: 519 INSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
           +++ V  Q   R+  M + +    A ++R+W  +E+
Sbjct: 533 LSAEVMSQ---RIREMSDNDPRVVALVIRQWMSNEL 565


>gi|167892353|ref|ZP_02479755.1| flagellar MS-ring protein [Burkholderia pseudomallei 7894]
          Length = 495

 Score =  356 bits (913), Expect = 6e-96,   Method: Composition-based stats.
 Identities = 122/469 (26%), Positives = 202/469 (43%), Gaps = 15/469 (3%)

Query: 13  SGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANI 72
             + +     L       + I   +A   +  +P Y  LY  L   D   I  AL +AN+
Sbjct: 29  GLSRMKTNPRLPFLIGAALAIAAIVALVLWSRAPDYRVLYSNLSDRDGGAIIAALQQANV 88

Query: 73  DFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRV 132
            ++ +D G +I VP++ V + R+ LAA GLP   S  G+EL D    FG++ F +++   
Sbjct: 89  PYKFADAGGAILVPANQVHETRLKLAAMGLPKGGS-VGFELMDN-QKFGISQFAEQVNYQ 146

Query: 133 RALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP--SVYKSAEA 190
           RALEGE+ RT++SI+ + AARVH+ +P    F +    P+ASV++              A
Sbjct: 147 RALEGELQRTVESINAVRAARVHLAIPKPSVFVRDREAPSASVLVDLYPGRVLDEGQVLA 206

Query: 191 IRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALA 250
           +  +V+++VP++   +VT++D  G LLT       +    L  VQ I+   +  I+  LA
Sbjct: 207 VTRMVSSSVPDMPAKNVTIVDQDGNLLTQTASATGLDASQLKYVQQIERNTQKRIDAILA 266

Query: 251 AFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE---TSQPESAVT 307
              G  N RS V A+++    +     Y P+   ++S   S+    S     S       
Sbjct: 267 PIFGAGNARSQVSADVDFSKIEQTSESYGPNGTPQQSAIRSQQTSSSTELAQSGASGVPG 326

Query: 308 VEQNMPHVSDR--------KVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
              N P             +   P +   +D+K+  +NYE++            ++RLS+
Sbjct: 327 ALSNTPPQPASAPIVASNGQPAGPAATPVSDRKDSTTNYELDKTVRHVEQSMGTIKRLSV 386

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AVVVN    T+  GR   Q      LA++ ++V  A G + +RGD++ + +  F      
Sbjct: 387 AVVVNYQPSTDAKGRVTMQPLAADKLAQVQQLVKDAMGYDEKRGDSVNVVNSAFSAAADP 446

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDD 468
            +        D++           V      L       ALRR      
Sbjct: 447 FANLPWWRQPDMIELGKDIAKWLGVAAAAAALYFMFVRPALRRAFPPPA 495


>gi|240137205|ref|YP_002961674.1| Flagellar M-ring protein FliF [Methylobacterium extorquens AM1]
 gi|240007171|gb|ACS38397.1| Flagellar M-ring protein FliF [Methylobacterium extorquens AM1]
          Length = 559

 Score =  356 bits (913), Expect = 6e-96,   Method: Composition-based stats.
 Identities = 190/560 (33%), Positives = 308/560 (55%), Gaps = 7/560 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M   +Q  + + +   LG  R++ L  V L+  +      ++++ P  + LY  L   DV
Sbjct: 1   MFGREQAERLWSNIVDLGARRLIALGLVGLLVFLGVGVGAYYLSRPAQEMLYTGLSREDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           +RI   L +  I F +S +G+++ V      +AR+ LA +GLP SS  SGYELF+ + S 
Sbjct: 61  SRIGGVLKDNGIPFDVSSDGTAVLVSFGHTAQARMLLAEKGLPQSS-KSGYELFNDLGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           G+TSFMQE+TRVRALEGEIARTIQ + G+ AARVH+V+PD GSFR+     +ASV++R  
Sbjct: 120 GMTSFMQEVTRVRALEGEIARTIQGMKGVRAARVHLVLPDRGSFRRDQQPASASVVVRTE 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNI-LGKSLSIVQAIQH 239
                  A+AIR LVA+A+P +    VTV+ S G +L A +       GK  ++ +++  
Sbjct: 180 PADDTSGAQAIRQLVASAIPGMKPDRVTVIGSEGTVLLAGDDAGTAPTGKMATLEKSVSR 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           E++ NI + LA +LGV NF  +V  +LN D     E +++PD +VERS+R  ++++ ++ 
Sbjct: 240 EMQDNIRRTLAPYLGVGNFEISVATQLNTDKTSTNETIFNPDQRVERSVRSVRESENAQN 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
              +   + ++N+P    R     +S   + KKE+ +NYEI+ K++ T  D Y + RLS+
Sbjct: 300 RNSQRPTSAQENLPDQRTRSDGNDQSSNESSKKEDLTNYEISQKTVQTVSDGYAIRRLSV 359

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AV+VN+ RLT + G   D+  +D  +AEI ++V +A G +  RGDTI + ++ F+ +   
Sbjct: 360 AVLVNRSRLTALAG-PDDKASLDKQIAEIEELVGSAAGFSKERGDTIKVAAVGFVNDGQP 418

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHA-LRRLHNIDDAKKGEVGGKS 478
                 +S  D++ +   T+INA   LV   L+ + GL   LR +    +  + EV   +
Sbjct: 419 MEPVPPLSLTDVMMKQSGTLINAATILVVAGLLIWFGLRPALRAILATPETAQSEVAALA 478

Query: 479 ILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSR---NLQSRINSYVSKQSDLRLLHMI 535
                P  +A  T  +     AL  S +     S     L   +   +++    RL  +I
Sbjct: 479 GPEGAPALAADGTMALAAPGAALPGSGEAAKLPSPGVAGLLEELEDKMARSPQKRLEQLI 538

Query: 536 EINEERFAKILRKWARSEIE 555
           +I+EE+ A +L++W   E  
Sbjct: 539 DIDEEQVAAVLKRWLMREEA 558


>gi|220925883|ref|YP_002501185.1| flagellar MS-ring protein [Methylobacterium nodulans ORS 2060]
 gi|219950490|gb|ACL60882.1| flagellar M-ring protein FliF [Methylobacterium nodulans ORS 2060]
          Length = 541

 Score =  356 bits (912), Expect = 6e-96,   Method: Composition-based stats.
 Identities = 134/551 (24%), Positives = 242/551 (43%), Gaps = 16/551 (2%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           +          G  R+  + +V L  +  F      V+ P    LY  L + D + +   
Sbjct: 1   MKPVLDLVAKFGPARLAAMGAVTLTLVGFFAFVILRVSRPEMGVLYADLSMQDASAVIRD 60

Query: 67  LSEANIDFRISDN-GSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSF 125
           L    + +      G +I  P + + + R+ LA +GLPS+    GYE+FDK ++F  T+F
Sbjct: 61  LDARGLRYETRGEMGQTILAPRADLARLRMDLAGKGLPSAGG-VGYEIFDKGDAFSSTTF 119

Query: 126 MQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVY 185
           +Q +  +RALEGE+AR+I++I  + AAR+H+V+P+   F +    P+A+++++       
Sbjct: 120 VQNVNHLRALEGELARSIRAIGRVQAARIHLVIPEKRLFARDREPPSAAIVLKLSGDLDP 179

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGK--SLSIVQAIQHEIEM 243
               A+RHLVA++V  L    ++++D  G+LL       +  G+         ++H +  
Sbjct: 180 GQVRAVRHLVASSVEGLKPDRISIVDERGRLLADGAKPEDAQGRLGLDERQANLEHRLRA 239

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            +   +A  +G    R  V AEL+ +  + R   +DP+S+V RS +   + Q+S+     
Sbjct: 240 QVEGIVAGIVGSGRARVQVAAELDANRIESRSETFDPESRVVRSTQTRSETQQSQGPGET 299

Query: 304 SAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVV 363
                  N    +        + E ++K EE +NYEI+  +    ++  ++ RLS+AVV+
Sbjct: 300 GV--SVGNELPGARDPAQQNGTREASNKNEETTNYEISRVTRTEINEGGRIRRLSVAVVI 357

Query: 364 NKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGT 423
           +        GR     +    L  I  +V  A G +  RGD I + ++ F E  +     
Sbjct: 358 DGTYTPGPDGRPVYAPRPQDELDRITALVRTAVGYDKARGDQIEVVNLRFAEGPVPAEIP 417

Query: 424 VQ--VSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILS 481
            +  ++           +    V  + TL+V    +  L R     DA   E+    I  
Sbjct: 418 EEGLLASFKPTKEDVLRLAELGVLALLTLVVVLAVVRPLLRRVIAVDAPPAELVAAGIPV 477

Query: 482 PPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEER 541
            P        G +P    A D+   D  +      +RIN  +  ++  R+  ++  N   
Sbjct: 478 LP--------GALPGAAPAEDAPPPDSPAKHLVDFARINGKLQAETIERVADIVRQNPAE 529

Query: 542 FAKILRKWARS 552
            A++LR W   
Sbjct: 530 TAEVLRNWIND 540


>gi|306841269|ref|ZP_07473980.1| flagellar M-ring protein FliF [Brucella sp. BO2]
 gi|306288671|gb|EFM60002.1| flagellar M-ring protein FliF [Brucella sp. BO2]
          Length = 542

 Score =  356 bits (912), Expect = 8e-96,   Method: Composition-based stats.
 Identities = 203/531 (38%), Positives = 307/531 (57%), Gaps = 4/531 (0%)

Query: 32  PIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVG 91
            +   +    ++  P Y+ LYV L   DVNR+ +AL EA I F +  +GSSI VP     
Sbjct: 1   MMGAILYTSIYLGRPSYETLYVGLSRDDVNRMGLALGEAGIPFDVKSDGSSILVPIGKAE 60

Query: 92  KARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVA 151
            AR++LA +GLP+S+ N+GYELFD + S GLTSFMQEITRVRALEGEIARTIQ+I G+ A
Sbjct: 61  NARMYLAEKGLPTSN-NAGYELFDNMGSLGLTSFMQEITRVRALEGEIARTIQAIRGVKA 119

Query: 152 ARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLD 211
           ARVHIV+ + GSFR+   +P+ASV+IRA      +SA++IR LVAAAVP+LD   VTVLD
Sbjct: 120 ARVHIVLAEKGSFRRGDQKPSASVVIRAEGGFSAESAQSIRQLVAAAVPSLDASSVTVLD 179

Query: 212 STGKLLTANEMERNILG-KSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDT 270
           + G LL +     N     + S+ Q +   ++ +I KALA +LG+ +F+++V A L+ D 
Sbjct: 180 TNGHLLASAGEGANGAALMTASLEQQVASHVDDSIRKALAPYLGLGHFQTSVQAALDTDR 239

Query: 271 QQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTD 330
           +Q +E  YDP+S+VERS+R+ +++  S  ++ ++A  VEQN+P    +      S E TD
Sbjct: 240 RQTKETTYDPESRVERSVRVVRESGDSRNNRNDNATGVEQNIPQEQIQNRNGESSTEKTD 299

Query: 331 KKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQG-KIDSYLAEIN 389
           ++EE +NYE+N+K+++T  D Y ++RLSIAVV+++ RL +  G +      +D  + +I 
Sbjct: 300 RREELTNYEVNSKTVSTVSDGYSIKRLSIAVVIDQARLLQTAGTTPPPANFVDQQITKIR 359

Query: 390 KIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGT 449
            +V+ A G+N+ RGD I +T+++FL+    +   V   + D L R   +  NAL  L   
Sbjct: 360 DLVATAAGLNANRGDVINVTAVNFLDPAGADMEPVSAPWTDTLLRQSGSYANALAILAAV 419

Query: 450 LLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIF 509
            L+ + GL  L R  N+  A       ++     P        +       +        
Sbjct: 420 GLLIWFGLRPLLRDQNVKPAGTEVAIREAGEVATPNFIGSAESVGEGAQAVIGGPA-AYA 478

Query: 510 SHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIEDRYTQ 560
              +   S +   +   + LRL  MIE++EER A +L++W       R   
Sbjct: 479 DQMKTSLSDLRQRMRMPAKLRLEQMIEMDEERVAAVLKQWIHETASGREAD 529


>gi|163850071|ref|YP_001638114.1| flagellar MS-ring protein [Methylobacterium extorquens PA1]
 gi|163661676|gb|ABY29043.1| flagellar M-ring protein FliF [Methylobacterium extorquens PA1]
          Length = 559

 Score =  355 bits (911), Expect = 8e-96,   Method: Composition-based stats.
 Identities = 189/560 (33%), Positives = 308/560 (55%), Gaps = 7/560 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M   +Q  + + +   LG  R++ L  V L+  +      ++++ P  + LY  L   DV
Sbjct: 1   MFGREQAERLWSNIVDLGARRLIALGLVGLLVFLGVGVGAYYLSRPAQEMLYTGLSREDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           +RI   L +  I F +S +G+++ V      +AR+ LA +GLP SS  SGYELF+ + S 
Sbjct: 61  SRIGGVLKDNGIPFDVSSDGTAVLVSFGHTAQARMLLAEKGLPQSS-KSGYELFNDLGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           G+TSFMQE+TRVRALEGEIARTIQ + G+ AARVH+V+PD GSFR+     +ASV++R  
Sbjct: 120 GMTSFMQEVTRVRALEGEIARTIQGMKGVRAARVHLVLPDRGSFRRDQQPASASVVVRTE 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNI-LGKSLSIVQAIQH 239
                  A+AIR LVA+A+P +    VTV+ S G +L A +       GK  ++ +++  
Sbjct: 180 PADDTSGAQAIRQLVASAIPGMKPDRVTVIGSEGTVLLAGDDAGTAPTGKMATLEKSVSR 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           E++ NI + LA +LGV NF  +V  +LN D     E +++PD +VERS+R  ++++ ++ 
Sbjct: 240 EMQDNIRRTLAPYLGVGNFEISVATQLNTDKTSTNETIFNPDQRVERSVRSVRESENAQN 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
              +   + ++N+P    R     +S   + KKE+ +NYEI+ K++ T  D Y + RLS+
Sbjct: 300 RNSQRPTSAQENLPDQRTRSDGNDQSSNESSKKEDLTNYEISQKTVQTVSDGYAIRRLSV 359

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AV+VN+ RLT + G   D+  +D  +AEI ++V +A G +  RGDTI + ++ F+ +   
Sbjct: 360 AVLVNRSRLTALAG-PDDKASLDKQIAEIEELVGSAAGFSKERGDTIKVAAVGFVNDGQP 418

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHA-LRRLHNIDDAKKGEVGGKS 478
                 +S  D++ +   T+INA   LV   L+ + GL   LR +    +  + EV   +
Sbjct: 419 MEPVPPLSLTDVMMKQSGTLINAATILVVAGLLIWFGLRPALRAILATPETAQSEVAALA 478

Query: 479 ILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSR---NLQSRINSYVSKQSDLRLLHMI 535
                P  +A  T  +     AL  S +     +     L   +   +++    RL  +I
Sbjct: 479 GPEGAPALAADGTMALAAPGAALPGSGEAAKLPAPGIAGLLEELEDKMARSPQKRLEQLI 538

Query: 536 EINEERFAKILRKWARSEIE 555
           +I+EE+ A +L++W   E  
Sbjct: 539 DIDEEQVAAVLKRWLMREEA 558


>gi|167917106|ref|ZP_02504197.1| flagellar MS-ring protein [Burkholderia pseudomallei BCC215]
          Length = 490

 Score =  355 bits (911), Expect = 9e-96,   Method: Composition-based stats.
 Identities = 122/463 (26%), Positives = 202/463 (43%), Gaps = 15/463 (3%)

Query: 13  SGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANI 72
             + +     L       + I   +A   +  +P Y  LY  L   D   I  AL +AN+
Sbjct: 27  GLSRMKTNPRLPFLIGAALAIAAIVALVLWSRAPDYRVLYSNLSDRDGGAIIAALQQANV 86

Query: 73  DFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRV 132
            ++ +D G +I VP++ V + R+ LAA GLP   S  G+EL D    FG++ F +++   
Sbjct: 87  PYKFADAGGAILVPANQVHETRLKLAAMGLPKGGS-VGFELMDN-QKFGISQFAEQVNYQ 144

Query: 133 RALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP--SVYKSAEA 190
           RALEGE+ RT++SI+ + AARVH+ +P    F +    P+ASV++              A
Sbjct: 145 RALEGELQRTVESINAVRAARVHLAIPKPSVFVRDREAPSASVLVDLYPGRVLDEGQVLA 204

Query: 191 IRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALA 250
           +  +V+++VP++   +VT++D  G LLT       +    L  VQ I+   +  I+  LA
Sbjct: 205 VTRMVSSSVPDMPAKNVTIVDQDGNLLTQTASATGLDASQLKYVQQIERNTQKRIDAILA 264

Query: 251 AFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE---TSQPESAVT 307
              G  N RS V A+++    +     Y P+   ++S   S+    S     S       
Sbjct: 265 PIFGAGNARSQVSADVDFSKIEQTSESYGPNGTPQQSAIRSQQTSSSTELAQSGASGVPG 324

Query: 308 VEQNMPHVSDR--------KVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
              N P             +   P +   +D+K+  +NYE++            ++RLS+
Sbjct: 325 ALSNTPPQPASAPIVASNGQPAGPAATPVSDRKDSTTNYELDKTVRHVEQSMGTIKRLSV 384

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AVVVN    T+  GR   Q      LA++ ++V  A G + +RGD++ + +  F      
Sbjct: 385 AVVVNYQPSTDAKGRVTMQPLAADKLAQVQQLVKDAMGYDEKRGDSVNVVNSAFSAAADP 444

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRR 462
            +        D++           V      L       ALRR
Sbjct: 445 FANLPWWRQPDMIELGKDIAKWLGVAAAAAALYFMFVRPALRR 487


>gi|167822258|ref|ZP_02453729.1| flagellar MS-ring protein [Burkholderia pseudomallei 9]
          Length = 488

 Score =  355 bits (911), Expect = 9e-96,   Method: Composition-based stats.
 Identities = 122/463 (26%), Positives = 202/463 (43%), Gaps = 15/463 (3%)

Query: 13  SGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANI 72
             + +     L       + I   +A   +  +P Y  LY  L   D   I  AL +AN+
Sbjct: 25  GLSRMKTNPRLPFLIGAALAIAAIVALVLWSRAPDYRVLYSNLSDRDGGAIIAALQQANV 84

Query: 73  DFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRV 132
            ++ +D G +I VP++ V + R+ LAA GLP   S  G+EL D    FG++ F +++   
Sbjct: 85  PYKFADAGGAILVPANQVHETRLKLAAMGLPKGGS-VGFELMDN-QKFGISQFAEQVNYQ 142

Query: 133 RALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP--SVYKSAEA 190
           RALEGE+ RT++SI+ + AARVH+ +P    F +    P+ASV++              A
Sbjct: 143 RALEGELQRTVESINAVRAARVHLAIPKPSVFVRDREAPSASVLVDLYPGRVLDEGQVLA 202

Query: 191 IRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALA 250
           +  +V+++VP++   +VT++D  G LLT       +    L  VQ I+   +  I+  LA
Sbjct: 203 VTRMVSSSVPDMPAKNVTIVDQDGNLLTQTASATGLDASQLKYVQQIERNTQKRIDAILA 262

Query: 251 AFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE---TSQPESAVT 307
              G  N RS V A+++    +     Y P+   ++S   S+    S     S       
Sbjct: 263 PIFGAGNARSQVSADVDFSKIEQTSESYGPNGTPQQSAIRSQQTSSSTELAQSGASGVPG 322

Query: 308 VEQNMPHVSDR--------KVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
              N P             +   P +   +D+K+  +NYE++            ++RLS+
Sbjct: 323 ALSNTPPQPASAPIVASNGQPAGPAATPVSDRKDSTTNYELDKTVRHVEQSMGTIKRLSV 382

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AVVVN    T+  GR   Q      LA++ ++V  A G + +RGD++ + +  F      
Sbjct: 383 AVVVNYQPSTDAKGRVTMQPLAADKLAQVQQLVKDAMGYDEKRGDSVNVVNSAFSAAADP 442

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRR 462
            +        D++           V      L       ALRR
Sbjct: 443 FANLPWWRQPDMIELGKDIAKWLGVAAAAAALYFMFVRPALRR 485


>gi|218528674|ref|YP_002419490.1| flagellar MS-ring protein [Methylobacterium chloromethanicum CM4]
 gi|218520977|gb|ACK81562.1| flagellar M-ring protein FliF [Methylobacterium chloromethanicum
           CM4]
          Length = 559

 Score =  355 bits (911), Expect = 9e-96,   Method: Composition-based stats.
 Identities = 189/560 (33%), Positives = 308/560 (55%), Gaps = 7/560 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M   +Q  + + +   LG  R++ L  V L+  +      ++++ P  + LY  L   DV
Sbjct: 1   MFGREQAERLWSNIVDLGARRLIALGLVGLLVFLGVGVGAYYLSRPAQEMLYTGLSREDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           +RI   L +  I F +S +G+++ V      +AR+ LA +GLP SS  SGYELF+ + S 
Sbjct: 61  SRIGGVLKDNGIPFDVSSDGTAVLVSFGHTAQARMLLAEKGLPQSS-KSGYELFNDLGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           G+TSFMQE+TRVRALEGEIARTIQ + G+ AARVH+V+PD GSFR+     +ASV++R  
Sbjct: 120 GMTSFMQEVTRVRALEGEIARTIQGMKGVRAARVHLVLPDRGSFRRDQQPASASVVVRTE 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNI-LGKSLSIVQAIQH 239
                  A+AIR LVA+A+P +    VTV+ S G +L A +       GK  ++ +++  
Sbjct: 180 PADDTSGAQAIRQLVASAIPGMKPDRVTVIGSEGTVLLAGDDAGTAPTGKMATLEKSVSR 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           E++ NI + LA +LGV NF  +V  +LN D     E +++PD +VERS+R  ++++ ++ 
Sbjct: 240 EMQDNIRRTLAPYLGVGNFEISVATQLNTDKTSTNETIFNPDQRVERSVRSVRESENAQN 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
              +   + ++N+P    R     +S   + KKE+ +NYEI+ K++ T  D Y + RLS+
Sbjct: 300 RNSQRPTSAQENLPDQRTRSDGNDQSSNESSKKEDLTNYEISQKTVQTVSDGYAIRRLSV 359

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AV+VN+ RLT + G   D+  +D  +AEI ++V +A G +  RGDTI + ++ F+ +   
Sbjct: 360 AVLVNRSRLTALAG-PDDKASLDKQIAEIEELVGSAAGFSKERGDTIKVAAVGFVNDGQP 418

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHA-LRRLHNIDDAKKGEVGGKS 478
                 +S  D++ +   T+INA   LV   L+ + GL   LR +    +  + EV   +
Sbjct: 419 MEPVPPLSLTDVMMKQSGTLINAATILVVAGLLIWFGLRPALRAILATPETAQSEVAALA 478

Query: 479 ILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSR---NLQSRINSYVSKQSDLRLLHMI 535
                P  +A  T  +     AL  S +     +     L   +   +++    RL  +I
Sbjct: 479 GPEGAPALAADGTMALAAPGAALPGSGEAAKLPAPGVAGLLEELEDKMARSPQKRLEQLI 538

Query: 536 EINEERFAKILRKWARSEIE 555
           +I+EE+ A +L++W   E  
Sbjct: 539 DIDEEQVAAVLKRWLMREEA 558


>gi|260222430|emb|CBA31986.1| hypothetical protein Csp_D29860 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 579

 Score =  355 bits (911), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 125/564 (22%), Positives = 225/564 (39%), Gaps = 37/564 (6%)

Query: 10  FFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSE 69
             +  T+L + + + LA  I + + + +          +  LY  L   D   +   L+ 
Sbjct: 30  LGQRLTALDQGQRIRLALGIALFVAIAVVGLVMGRQAEWRVLYSNLADKDGGAVIAQLTT 89

Query: 70  ANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEI 129
            N+ ++ ++ G +I VP+  V   R+ LA+QGLP   S SG+E+  + N FG+T F + +
Sbjct: 90  MNVPYKYTEGGGAILVPADRVHDVRLKLASQGLPK-GSVSGFEMM-EANRFGMTQFQERL 147

Query: 130 TRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--S 187
           T  R LEGE+ R+IQ++S + +ARVH+ +P+   F +   +P+ASV++            
Sbjct: 148 TFQRGLEGELTRSIQALSSVSSARVHLALPNQNGFFREQQKPSASVLLSLHPGRALDKGQ 207

Query: 188 AEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA-NEMERNILGKSLSIVQAIQHEIEMNIN 246
              I HLVA++VP ++   V+VLD TGKLL+A  +    +  + L  VQ I+      I 
Sbjct: 208 LAGIVHLVASSVPEMNPSAVSVLDDTGKLLSANPDAAAGVDAEQLQYVQQIEQLYSRRIL 267

Query: 247 KALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKV----ERSIRLSKDAQRSETSQP 302
             L   +G  N ++ V AEL+    +     + P+        RS +L +    ++ + P
Sbjct: 268 DMLEPLVGKQNVKAQVTAELDFSQTESTTESHKPNQTPDSGAVRSQQLVESTNGTQPTPP 327

Query: 303 ESAVTVEQNMPHVSDRKVPLPR-------------SLENTDKKEEQSNYEINTKSIATTH 349
                   N P          +             S  ++ KKE   NYE++     T  
Sbjct: 328 AGVPGATTNQPPAQPAAPINGQPQTLAANGQTAAGSTNSSSKKESIINYEVDKTIRVTKG 387

Query: 350 DNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITIT 409
               ++R++ AVV+N   +T+  G +      ++ L ++  +V    G N  RGD++ + 
Sbjct: 388 AVGAIKRINAAVVLNNQSVTDAKGVTTSVALTEAQLEKMTALVRETVGFNQDRGDSVNVV 447

Query: 410 SMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA 469
           +  F   +        V     +     ++   L  L    LV    +    +       
Sbjct: 448 NAPF-APEKAEVNDTPVWRQPEVQELARSLAWPLGTLGLAALVLLGVIRPAMKALTQP-- 504

Query: 470 KKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDL 529
                        P         +   D I  D   +   +   +      +   +    
Sbjct: 505 ------------APVAEPLENNDVAQLDAIENDQPERPQLTGPSSANEAQQASPGELRLE 552

Query: 530 RLLHMIEINEERFAKILRKWARSE 553
               +   N    A I++ W   E
Sbjct: 553 DARKLTRDNPAAVANIVKAWMNGE 576


>gi|254294565|ref|YP_003060588.1| flagellar M-ring protein FliF [Hirschia baltica ATCC 49814]
 gi|254043096|gb|ACT59891.1| flagellar M-ring protein FliF [Hirschia baltica ATCC 49814]
          Length = 568

 Score =  355 bits (911), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 145/563 (25%), Positives = 262/563 (46%), Gaps = 15/563 (2%)

Query: 4   LDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           + + +   K  T+ G+ RI+  A +++  +   +             LY  L++++   I
Sbjct: 1   MAETVSIIKKITNGGQMRIIA-ALMVVALVGAGLGFIMLRGGADEALLYSGLDLTESAEI 59

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
           S  L +ANI + I  +G+SI V    V  AR+ L+ +GLP+  +  GYE+FDK  + G T
Sbjct: 60  SGRLDQANISYTIRGDGASIFVNRDQVLDARMMLSEEGLPTRGA-MGYEIFDKSEALGTT 118

Query: 124 SFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR-AINP 182
           SF+Q I RVRALEGE+ARTI S+  I  +RVH+V+P+   F +    P+ASV+I  A   
Sbjct: 119 SFVQNINRVRALEGELARTISSLDNIRGSRVHLVLPERRLFERGTQTPSASVVISVAGRG 178

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA---NEMERNILGKSLSIVQAIQH 239
            +     AIR+L+A +VPNL++  +T+LD  G+LL A   N       G +      I+ 
Sbjct: 179 MLPSQVRAIRNLIAGSVPNLEVNRITLLDDKGRLLAAGAENSENGFSGGSADERQTGIED 238

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           +I   +   + +  G    R  V A+++ +       ++DP+ +V RS   ++D+ R  +
Sbjct: 239 QIRNKVLSVVESVTGPGAARVQVAADIDFNRITQSSEIFDPEGRVIRSSTTTEDSSRESS 298

Query: 300 SQPESAVTVEQNMP-HVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLS 358
           ++P  AVT E N+P   +      P S   T+  +E +NYEI+  +     +  ++ ++S
Sbjct: 299 TEPAGAVTAENNIPAGTAADGPADPTSQAETNHLQETTNYEISKTTKTEITEGGRIRKIS 358

Query: 359 IAVVVNKGRLTEVLG-RSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQ 417
           +AV ++  R+       +    +    +A I  +V +A G +  RGD + + ++ F+  +
Sbjct: 359 VAVALDDVRVPGADETEATFAPRTPEEIANIKTLVRSAVGYDEARGDIVEVVNVSFMRPE 418

Query: 418 -LFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGG 476
              N        + +       +       VG +L+    L  L +      A+ G+   
Sbjct: 419 SSVNLAIEDPGMLGLTKNDIMRISELAALFVGAVLLIIFVLRPLVKGLMSPSAESGDSFY 478

Query: 477 KSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQ------SRINSYVSKQSDLR 530
                 P  S      +  ++N+ L  S                  +RI+  V+  S  +
Sbjct: 479 VGEAKLPGGSGNAAQKVTLSENLVLPGSGDGGNGQITEDDQFGLDVARISGKVNASSVKK 538

Query: 531 LLHMIEINEERFAKILRKWARSE 553
           +  ++E + +   +I+R W   +
Sbjct: 539 ISEVVESHPDESIQIIRAWLSED 561


>gi|167579440|ref|ZP_02372314.1| flagellar MS-ring protein [Burkholderia thailandensis TXDOH]
          Length = 518

 Score =  355 bits (910), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 120/443 (27%), Positives = 195/443 (44%), Gaps = 15/443 (3%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LAA G
Sbjct: 78  WSRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLAAMG 137

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG++ F +++   RALEGE+ RT++S++ + AARVH+ +P  
Sbjct: 138 LPKGGS-VGFELMDN-QKFGISQFAEQVNYQRALEGELQRTVESVNAVRAARVHLAIPKP 195

Query: 162 GSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    P+ASV++              AI  LV+++VP++   +VT++D  G LLT 
Sbjct: 196 SVFVRDREAPSASVLVDLYPGRVLDEGQVLAITRLVSSSVPDMPAKNVTIVDQDGNLLTQ 255

Query: 220 NEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYD 279
                 +    L  VQ I+   +  I+  LA   G  N RS V A+++    +     Y 
Sbjct: 256 TASATGLDASQLKYVQQIERNTQKRIDAILAPIFGAGNARSQVSADVDFSKIEQTSESYA 315

Query: 280 PDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDR--------KVPLPRSLEN 328
           P+   ++S   S+    S     S          N P             +   P +   
Sbjct: 316 PNGTPQQSAIRSQQTSTSTELAQSGASGVPGALSNTPPQPASAPIVASNGQPAAPAATPV 375

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEI 388
           +D+K+  +NYE++            ++RLS+AVVVN    T+  GR   Q      LA++
Sbjct: 376 SDRKDSTTNYELDKTVRHVEQSMGTIKRLSVAVVVNYQPSTDAKGRVTMQPLTADKLAQV 435

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  A G + +RGD++ + +  F       +        D++           V    
Sbjct: 436 QQLVKDAMGYDEKRGDSVNVVNSAFSAAADPFANLPWWRQPDMIELGKDIAKWLGVAAAA 495

Query: 449 TLLVTFLGLHALRRLHNIDDAKK 471
             L       ALRR         
Sbjct: 496 AALYFMFVRPALRRAFPPPAEPA 518


>gi|74317618|ref|YP_315358.1| flagellar MS-ring protein [Thiobacillus denitrificans ATCC 25259]
 gi|74057113|gb|AAZ97553.1| flagellar M-ring protein FliF [Thiobacillus denitrificans ATCC
           25259]
          Length = 548

 Score =  355 bits (910), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 119/560 (21%), Positives = 217/560 (38%), Gaps = 46/560 (8%)

Query: 14  GTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANID 73
            T     R ++L   +   + +  A   +   P Y  L+      D   I   L + N+ 
Sbjct: 16  FTRTAGGRKILLMLGVAASVAVMAAVWMWGQQPEYRVLFSNFSDRDGGAIVAELEKMNVP 75

Query: 74  FRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVR 133
           ++ ++ G ++ VP+  V  AR+ LA+QGLP    N G+EL  +    G + F++++   R
Sbjct: 76  YKYAEGGGAVLVPADRVHDARLKLASQGLPK-GGNVGFELM-ENQRLGASQFVEQVNFQR 133

Query: 134 ALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN--PSVYKSAEAI 191
           A+EGE+AR+I+S+S + AARVH+ +P    F     +PTASV++          +   AI
Sbjct: 134 AMEGELARSIESVSAVQAARVHLALPKDSIFVSEQKQPTASVLLNLHPGRALDPQQVSAI 193

Query: 192 RHLVAAAVPNLDMGDVTVLDSTGKLLTANEME---RNILGKSLSIVQAIQHEIEMNINKA 248
            HLVA++VP L   +VTV+D  G LL+          +    +  VQ +Q ++   I   
Sbjct: 194 VHLVASSVPELATKNVTVVDQNGNLLSDAGKAPRVNGMDPSQIKYVQELQQDVVQRIESI 253

Query: 249 LAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRS--ETSQPESAV 306
           +   +G  N R+   A+++    +     Y P+   +     S+    S   ++ P    
Sbjct: 254 ITPIVGPGNVRAEATADVDFSRSEQAVESYKPNQTPDAMAIRSQQTSESLNGSANPAGVP 313

Query: 307 TVEQNMPHVSDRKVPL------------PRSLENTDKKEEQSNYEINTKSIATTHDNYKL 354
               N P                           + +K+   NYE++            L
Sbjct: 314 GALINQPPAPATAPITVPGQATPAPAAAAAQPATSTRKDATVNYEVDKTIQYVQQAGGGL 373

Query: 355 ERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFL 414
           +RLS+ VVVN  +  +  G+ A +   ++   +I  +V  A G N  RGDT+ + +  F 
Sbjct: 374 KRLSVGVVVNYKKTVDKAGKVAMKPLSEAEKTQITNLVKEAMGYNQARGDTVNVVNSPFA 433

Query: 415 ENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEV 474
             Q  +            + +F    N   +L+  + +  L L   + L      ++   
Sbjct: 434 SAQEEDLPQPPFWKQPEYAEYFDIARNVGKYLLMGIALLLLYLKVAKPLLKKMSEQQALA 493

Query: 475 GGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHM 534
                L    +++     L                               +++  R   +
Sbjct: 494 APNHPLHLEQLATDERAALPGQ-------------------------RNYQENLSRAQRL 528

Query: 535 IEINEERFAKILRKWARSEI 554
              +    A I++ W  +  
Sbjct: 529 ANEDPRVVANIVKTWVANND 548


>gi|254496581|ref|ZP_05109449.1| flagellar MS-ring protein [Legionella drancourtii LLAP12]
 gi|254354205|gb|EET12872.1| flagellar MS-ring protein [Legionella drancourtii LLAP12]
          Length = 547

 Score =  355 bits (910), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 117/573 (20%), Positives = 233/573 (40%), Gaps = 52/573 (9%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           MA+ D          SL   R + L   +   + + +A   +   P+Y  LY ++   D 
Sbjct: 1   MALADNASMVAAKFASLSIPRQIGLLIGLAASVAVGLAVVLWSRDPNYVPLYTQMNTRDA 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             +  AL    I+F+I +N S+I +PS+ +   R+ LAA+GLP     +  ELF   N+F
Sbjct: 61  AEVVSALERNGIEFKIDNNNSTILIPSANLQSTRLKLAAEGLPRD-PVASEELFSSGNAF 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
             + FM+     +ALE E+ARTI   + I AARVH+ +P   +F +   +P+ASV I   
Sbjct: 120 NSSQFMENARYKQALEAELARTISKFNDIKAARVHLAIPRESAFVRDIHQPSASVFIDVY 179

Query: 181 NPSVYK--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKS--LSIVQA 236
           +    K  +  AI +LVA+++PNL    VTV+D  G+LL     +         L   Q 
Sbjct: 180 SGLELKKHTVSAIVNLVASSIPNLSASRVTVVDQDGQLLNEGSGQTLFTDTERFLDYRQN 239

Query: 237 IQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQR 296
           ++ +    I   L   LG    R+ V A+++  + +  + +++P+    RS +  ++   
Sbjct: 240 LEQQYAQKIQDILTPLLGYGRVRAKVSADIDFTSYEQTQEMFNPELPSLRSEQTMQEKHN 299

Query: 297 SETSQPESAVTVEQNMPHVSDRKVP------------------LPRSLENTDKKEEQSNY 338
           + +           N P  +                          +  +  + +   N+
Sbjct: 300 AAS-DAIGVPGTLSNTPQPNPSLNNKNPAAPNAQQQQQPAQSSSDANQSSDTRTQSTKNF 358

Query: 339 EINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGR-SADQGKIDSYLAEINKIVSAATG 397
           E++     T +    ++RLS+AV+V+   + +   +    +      + +I  +V+ A G
Sbjct: 359 ELDKTISHTKNQPGTIKRLSVAVLVDNPAIMDTKTKTMIKKALTAKEIDQIKLLVADAIG 418

Query: 398 INSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGL 457
           +NS+RGD++ + + DF++         +  +       F +++  +   +  L + F  L
Sbjct: 419 LNSQRGDSLNVINSDFVKPDPIAPIPEERFWQ---KDIFWSIVKQVAGALFVLAMIFGVL 475

Query: 458 HALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQS 517
             + +    +                          +       D+             +
Sbjct: 476 RPMLKTLASNK------------------------GVGEGAYLEDTDEPQGDLTYDGTIA 511

Query: 518 RINSYVSKQSDLRLLHMIEINEERFAKILRKWA 550
             ++   +     L  +++   +R A++++ W 
Sbjct: 512 IKDANDYESQLNLLRQVVDKEPKRVAQVVKTWV 544


>gi|253990094|ref|YP_003041450.1| flagellar MS-ring protein [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253781544|emb|CAQ84707.1| flagellar basal-body m-ring protein [Photorhabdus asymbiotica]
          Length = 567

 Score =  355 bits (910), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 130/584 (22%), Positives = 236/584 (40%), Gaps = 56/584 (9%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
            I +Q   F      +     + L       I + +A   ++ SP Y  LY  L   D  
Sbjct: 7   DIENQTNGFSTIINRIKADPKVPLLVAGSAAIAIVIALFLWLRSPDYRVLYSNLSDKDGG 66

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
            I   L++ NI +R ++NGS+I +P+  V + R+ LA QGLP   + +G+EL DK   FG
Sbjct: 67  EIVTQLTQLNIPYRFAENGSAIMIPAGQVHETRLRLAQQGLPKGGA-AGFELLDKE-KFG 124

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA-- 179
           ++ F +++   RALEGE++RTI+S+  +  ARVH+ +P    F +    P+ASV +    
Sbjct: 125 ISQFSEQVNYQRALEGELSRTIESLGPVQNARVHLALPKPSLFVREQKSPSASVTVGLLQ 184

Query: 180 INPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM-ERNILGKSLSIVQAIQ 238
                     AI H+V+++V  L   +VT++D  G+LLT  +   R++    L  +Q ++
Sbjct: 185 GRTLDEGQINAIVHMVSSSVAGLPPSNVTIVDQAGRLLTQADATGRDLNTSQLKYIQEVE 244

Query: 239 HEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DAQ 295
           +  +  I   L   +G  N  + V A+++   ++     Y P+    ++   SK   +++
Sbjct: 245 NRFQQRIEAILTPVVGRGNVHAQVTAQVDFSRREETAEEYKPNQPPNQAAVRSKQLSESE 304

Query: 296 RSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKK----------------------- 332
           +S             N P           + + ++K                        
Sbjct: 305 QSGGPLVGGIPGALSNQPSPPPSAPIEKPNTKESNKSDKSDKKTSSSGNSNERMVNNNRN 364

Query: 333 ---EEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEIN 389
              +E +NYE++            +ERLS+AVVVN   +    G    Q      LA+I 
Sbjct: 365 NRRDETTNYEVDRTIRHVQQQAGGVERLSVAVVVNYVTVEGKNGPET-QALTPEQLAKIE 423

Query: 390 KIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGT 449
            +   A G +  RGD++ + +  F E++             +L + F             
Sbjct: 424 ALTREAMGFSKERGDSLNVVNTPFTESKENIEVIPVWQNPILLEKAFDFG---------- 473

Query: 450 LLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIF 509
                     L  +       +  V  +         +A+             S+  D  
Sbjct: 474 --------RYLLLILVAWLLWRKMVVPQLAKKRAAEKAALEAQKAQKKQATESSAEMDER 525

Query: 510 SHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
           +  R  + R+++ +  Q   R+  + E +    A ++R+W  +E
Sbjct: 526 TRQRLTRQRVSAEIQSQ---RIRELAEKDPRVVALVIRQWMSNE 566


>gi|37525871|ref|NP_929215.1| flagellar MS-ring protein [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36785300|emb|CAE14241.1| flagellar basal-body M-ring protein [Photorhabdus luminescens
           subsp. laumondii TTO1]
          Length = 567

 Score =  355 bits (910), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 127/584 (21%), Positives = 240/584 (41%), Gaps = 56/584 (9%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
            + +Q   F      +     + L       + + +A   ++ SP Y  LY  L   D  
Sbjct: 7   DVENQTKGFSAIINQIKADPKVPLLVAGSAAVAIVIALFLWLRSPDYRVLYSNLSDKDGG 66

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
            I   L++ NI +R ++NG++I +P+  V + R+ LA QGLP   + +G+EL DK   FG
Sbjct: 67  DIVTQLTQLNIPYRFAENGAAIMIPAEQVHETRLRLAQQGLPKGGA-AGFELLDKE-KFG 124

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA-- 179
           ++ F +++   RALEGE++RTI+S+  +  ARVH+ +P    F +    P+ASV +    
Sbjct: 125 ISQFSEQVNYQRALEGELSRTIESLGPVQNARVHLALPKPSLFVREQKSPSASVTVGLLQ 184

Query: 180 INPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM-ERNILGKSLSIVQAIQ 238
                     AI H+V+++V  L  G+VT++D TG+LLT  +   R++    L  +Q ++
Sbjct: 185 GRTLDEGQINAIVHMVSSSVAGLPPGNVTIVDQTGRLLTQADATGRDLNTSQLKYIQEVE 244

Query: 239 HEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSK---DAQ 295
           +  +  I   L   +G  N  + V A+++   ++     Y P+    ++   SK   +++
Sbjct: 245 NRFQHRIETILTPVVGRGNVHAQVTAQVDFSRREETAEEYKPNQPPNQAAVRSKQLSESE 304

Query: 296 RSETSQPESAVTVEQNMPHVSDRKVPLPRSLEN--------------------------T 329
           +S   Q         N P           + +                            
Sbjct: 305 QSGGPQVGGIPGALSNQPSSPPSAPIDKPNTKENNKNDKSDKKASSAGNSNERTVNSNRN 364

Query: 330 DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEIN 389
           ++++E +NYE++            +ERLS+AVVVN   +    G    Q      L +I 
Sbjct: 365 NRRDETTNYEVDRTIRHVQQQAGGVERLSVAVVVNYVTVEGKNGPET-QALTPEQLTKIE 423

Query: 390 KIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGT 449
            +   A G +  RGD++ + +  F E++             +L + F             
Sbjct: 424 ALTREAMGFSKERGDSLNVVNTPFTESKENIEVIPVWQNPVLLEKAFDFG---------- 473

Query: 450 LLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIF 509
                     L  +       +  V  +         +A+    +    +   S+  D  
Sbjct: 474 --------RYLLLILVAWLLWRKMVVPQLAKKRAAEKAALDAQKVQKRQVTESSAEMDEK 525

Query: 510 SHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
           +  +  + R+++ +  Q   R+  + E +    A ++R+W  +E
Sbjct: 526 TRQKLTRQRVSAEIQSQ---RIRELAEKDPRVVALVIRQWMSNE 566


>gi|167900849|ref|ZP_02488054.1| flagellar MS-ring protein [Burkholderia pseudomallei NCTC 13177]
          Length = 500

 Score =  354 bits (908), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 122/463 (26%), Positives = 202/463 (43%), Gaps = 15/463 (3%)

Query: 13  SGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANI 72
             + +     L       + I   +A   +  +P Y  LY  L   D   I  AL +AN+
Sbjct: 27  GLSRMKTNPRLPFLIGAALAIAAIVALVLWSRAPDYRVLYSNLSDRDGGAIIAALQQANV 86

Query: 73  DFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRV 132
            ++ +D G +I VP++ V + R+ LAA GLP   S  G+EL D    FG++ F +++   
Sbjct: 87  PYKFADAGGAILVPANQVHETRLKLAAMGLPKGGS-VGFELMDN-QKFGISQFAEQVNYQ 144

Query: 133 RALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP--SVYKSAEA 190
           RALEGE+ RT++SI+ + AARVH+ +P    F +    P+ASV++              A
Sbjct: 145 RALEGELQRTVESINAVRAARVHLAIPKPSVFVRDREAPSASVLVDLYPGRVLDEGQVLA 204

Query: 191 IRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALA 250
           +  +V+++VP++   +VT++D  G LLT       +    L  VQ I+   +  I+  LA
Sbjct: 205 VTRMVSSSVPDMPAKNVTIVDQDGNLLTQTASATGLDASQLKYVQQIERNTQKRIDAILA 264

Query: 251 AFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE---TSQPESAVT 307
              G  N RS V A+++    +     Y P+   ++S   S+    S     S       
Sbjct: 265 PIFGAGNARSQVSADVDFSKIEQTSESYGPNGTPQQSAIRSQQTSSSTELAQSGASGVPG 324

Query: 308 VEQNMPHVSDR--------KVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
              N P             +   P +   +D+K+  +NYE++            ++RLS+
Sbjct: 325 ALSNTPPQPASAPIVASNGQPAGPAATPVSDRKDSTTNYELDKTVRHVEQSMGTIKRLSV 384

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AVVVN    T+  GR   Q      LA++ ++V  A G + +RGD++ + +  F      
Sbjct: 385 AVVVNYQPSTDAKGRVTMQPLAADKLAQVQQLVKDAMGYDEKRGDSVNVVNSAFSAAADP 444

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRR 462
            +        D++           V      L       ALRR
Sbjct: 445 FANLPWWRQPDMIELGKDIAKWLGVAAAAAALYFMFVRPALRR 487


>gi|170743231|ref|YP_001771886.1| flagellar MS-ring protein [Methylobacterium sp. 4-46]
 gi|168197505|gb|ACA19452.1| flagellar M-ring protein FliF [Methylobacterium sp. 4-46]
          Length = 539

 Score =  354 bits (908), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 123/549 (22%), Positives = 234/549 (42%), Gaps = 14/549 (2%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           +          G  R+  + +V LV +  F      V+ P    LY  L + D   +   
Sbjct: 1   MQPVLDLMAKFGPARLAAMGAVTLVLVGFFAFVILRVSRPELGVLYADLSLQDAGAVIRD 60

Query: 67  LSEANIDFRISDN-GSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSF 125
           L    I +    + G +I  P + + + R+ LA +GLPS+    GYELFDK ++F  T+F
Sbjct: 61  LEARGIRYETRGDLGQTILAPRADLPRLRMDLAGKGLPSAGG-VGYELFDKGDAFSTTTF 119

Query: 126 MQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVY 185
           +Q +  +RA EGE+AR+I++I  + AARVH+V+P+   F +    P+A+++++       
Sbjct: 120 VQNVNHLRAQEGELARSIRAIGRVQAARVHLVIPEKRLFNRDRELPSAAIVLKLAGDLDP 179

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE--MERNILGKSLSIVQAIQHEIEM 243
               A+RHLVA++V  L    ++++D  G+LL       +   +        +++  +  
Sbjct: 180 GQVRAVRHLVASSVEGLKPERISIVDERGRLLADGAGRDDAQAVLGLDERQASLEQRLRA 239

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            +   +A  +G    R  V AEL+    + R   +DP+S+V RS +   +   S+     
Sbjct: 240 QVEGIVAGIVGAGRARVQVAAELDPSRIESRSESFDPESRVVRSSQTRSETSASQGPGET 299

Query: 304 SAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVV 363
                  N    +        + E ++K EE +NYEI+  +    ++  +++RLS+AVV+
Sbjct: 300 GV--SVGNELPGARETAQANGTRETSNKNEETTNYEISRVTRTEVNEGGRIKRLSVAVVI 357

Query: 364 NKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGT 423
           +        G+     +    L  I  +V  A G +  RGD + + ++ F +  +     
Sbjct: 358 DGSYQPGPDGKPVYAPRSQEELDRITALVRTAVGYDKGRGDQVEVANLRFADTAVPAELP 417

Query: 424 VQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPP 483
            +     +L      V+  +   V  LL   + L  +R L       +            
Sbjct: 418 EEGLLASLLKPTKEEVLRLVELAVLALLTLVVVLAVMRPLLRRVLPAEAPPEPALAAVAV 477

Query: 484 PISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFA 543
             ++       P        +  +  +      ++IN  +  ++  R+  ++  N    A
Sbjct: 478 LPAAGAEGEGAP--------ALPESPARQLVEFAKINGKIQAETIARVAEIVRQNPVETA 529

Query: 544 KILRKWARS 552
           ++LR W + 
Sbjct: 530 EVLRGWIQD 538


>gi|254559216|ref|YP_003066311.1| flagellar M-ring protein FliF [Methylobacterium extorquens DM4]
 gi|254266494|emb|CAX22258.1| Flagellar M-ring protein FliF [Methylobacterium extorquens DM4]
          Length = 559

 Score =  354 bits (907), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 190/560 (33%), Positives = 311/560 (55%), Gaps = 7/560 (1%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M   +Q  + + +   LG  R++ L  V L+  +      ++++ P  + LY  L   DV
Sbjct: 1   MFGREQAERLWSNIVDLGARRLIALGLVGLLVFLGVGVGAYYLSRPAQEMLYTGLSREDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           +RI   L +  I F +S +G+++ V      +AR+ LA +GLP SS  SGYELF+ + S 
Sbjct: 61  SRIGGVLKDNGIPFDVSSDGAAVLVSFGHTAQARMLLAEKGLPQSS-KSGYELFNDLGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           G+TSFMQE+TRVRALEGEIARTIQ + G+ AARVH+V+PD GSFR+     +ASV++R  
Sbjct: 120 GMTSFMQEVTRVRALEGEIARTIQGMKGVRAARVHLVLPDRGSFRRDQQPASASVVVRTE 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNI-LGKSLSIVQAIQH 239
                  A+AIR LVA+A+P +    VTV+ S G +L A +       GK  ++ +++  
Sbjct: 180 PADDTSGAQAIRQLVASAIPGMKPDRVTVIGSEGTVLLAGDDAGTAPTGKMATLEKSVSR 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
           E++ NI + LA +LGV NF  +V  +LN D     E +++PD +VERS+R  ++++ ++ 
Sbjct: 240 EMQDNIRRTLAPYLGVGNFEISVATQLNTDKTSTNETIFNPDQRVERSVRSVRESENAQN 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
              +   + ++N+P    R     +S   + KKE+ +NYEI+ K++ T  D Y + RLS+
Sbjct: 300 RNSQRPTSAQENLPDQRTRSDGNDQSSNESSKKEDLTNYEISQKTVQTVSDGYAIRRLSV 359

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AV+VN+ RLT + G   D+  +D  +AEI ++V +A G +  RGDTI + ++ F+ +   
Sbjct: 360 AVLVNRSRLTALAG-PDDKASLDKQIAEIEELVGSAAGFSKERGDTIKVAAVGFVNDGQP 418

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHA-LRRLHNIDDAKKGEVGGKS 478
                 +S  D++ +   T+INA   LV   L+ + GL   LR +    +  + EV   +
Sbjct: 419 MEPVPPLSLTDVMMKQSGTLINAATILVVAGLLIWFGLRPALRAILATPETAQSEVAALA 478

Query: 479 ILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSR---NLQSRINSYVSKQSDLRLLHMI 535
            L   P+ +A  T  +     AL  S++     +     L   +   +++    RL  +I
Sbjct: 479 GLEGAPVLAADGTMALAAPGAALPGSSEAAKLPAPGVAGLLEELEDKMARSPQKRLEQLI 538

Query: 536 EINEERFAKILRKWARSEIE 555
           +I+EE+ A +L++W   E  
Sbjct: 539 DIDEEQVAAVLKRWLMREEA 558


>gi|71906412|ref|YP_283999.1| flagellar MS-ring protein [Dechloromonas aromatica RCB]
 gi|71846033|gb|AAZ45529.1| Flagellar FliF M-ring protein [Dechloromonas aromatica RCB]
          Length = 584

 Score =  354 bits (907), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 126/584 (21%), Positives = 231/584 (39%), Gaps = 58/584 (9%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           + + +  ++   LG  + ++    I   I + + A  +   P +  L+  L   D   I+
Sbjct: 16  NPVDRLREAFNRLGSQQKIVFMVAIAALIAIIVGAILWSRQPDWKVLFSNLTEKDGGSIA 75

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L + NI  R S++G ++ VPS  V + R+ LA+QGLP      G+EL  +   FG++ 
Sbjct: 76  AILEQQNIPHRYSNSG-ALLVPSDRVHEVRLKLASQGLPRGGM-VGFELM-ENQKFGVSQ 132

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV 184
           F +++   R LEGE+ARTIQSI  + +ARVH+ +P    F +   +PTASVM+       
Sbjct: 133 FAEQVNYQRGLEGELARTIQSIGSVQSARVHLAIPKPSVFVREEQKPTASVMLNLYPGRT 192

Query: 185 YK--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM---ERNILGKSLSIVQAIQH 239
                   I HLV+++VP L   +VTVLD +G LL+  +    E  +    +  V  +++
Sbjct: 193 LDGGQIAGITHLVSSSVPQLPASNVTVLDQSGALLSQLKSKLTEAGLDPTQIKYVHDVEN 252

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
            I   I++ L+  LG DNF+  V A+++    +     Y P++  E +   S+    +  
Sbjct: 253 SIIKRIDEILSPLLGADNFKVQVAADIDFSQTEQTAESYRPNNTPESTSIRSQQNNETAN 312

Query: 300 --SQPESAVTVEQNMPHVSDRKVPLPRSLEN----------------------------- 328
                        N P V         +                                
Sbjct: 313 VNQAAGGVPGALTNQPPVPATAPLTQPATGTTPGQPAKPGEPQGKIDAAGVTAPLNAAGQ 372

Query: 329 --TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLA 386
             +  K    NYE++     T      + RLS AVVVN  +  +  G+   +   D+ + 
Sbjct: 373 PISTSKNATINYELDKTIRHTRQGMGNIRRLSAAVVVNHRKDVDKTGKPLTKAIPDAEMK 432

Query: 387 EINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFL 446
           +IN++V  A G    RGDT+++ +  F       +       +     + + + + L +L
Sbjct: 433 QINELVREAMGFTKERGDTLSVANAPFTAIDKSENELP----IWKDPENVSYIKDILKYL 488

Query: 447 VGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQ 506
           +   ++ FL +  ++         + E    +     P            +         
Sbjct: 489 LIAAIIAFLYIKLIQPSLKTMFPARHEGEKHAGDGTGPGGIFGGITGSAEEA-------- 540

Query: 507 DIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWA 550
                  +  +++          +     E + +  A I++ W 
Sbjct: 541 -----GEDGSTQVTIDNYAIKIQKAREFAEKDSKAVANIIKDWM 579


>gi|188583761|ref|YP_001927206.1| flagellar MS-ring protein [Methylobacterium populi BJ001]
 gi|179347259|gb|ACB82671.1| flagellar M-ring protein FliF [Methylobacterium populi BJ001]
          Length = 538

 Score =  354 bits (907), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 142/552 (25%), Positives = 253/552 (45%), Gaps = 21/552 (3%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           +       T LG  RI  +A+V L  +  F      V+ P    L+  L + D + +   
Sbjct: 1   MKPILDLVTKLGPARIAAMAAVTLTLVGFFAFVILRVSRPDMGVLFSDLSMQDSSAVIRE 60

Query: 67  LSEANIDFRISDN-GSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSF 125
           L    I +      G ++  P + + K R+  A +GLP+     GYE+FDK ++F  TSF
Sbjct: 61  LDARGIAYETKGELGQTVLAPRADLAKLRMDFAGKGLPAQGG-IGYEIFDKGDAFSSTSF 119

Query: 126 MQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVY 185
           +Q +  +RA+EGE+AR+I++I  + AARVH+V+P+   F +    P+A+++++ +     
Sbjct: 120 VQNVNHLRAMEGELARSIRAIGRVQAARVHLVIPERRLFERDREAPSAAIVVKLMGDLDP 179

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA--NEMERNILGKSLSIVQAIQHEIEM 243
               AIRHL A+AV  L    V+++D  G+LL       E    G        I+  +  
Sbjct: 180 SQVRAIRHLAASAVEGLKPERVSIVDERGRLLADGARGAEAEGAGALEERQAGIERRMRA 239

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            I + +A  +G    R  V AEL+++  + R   +DP+S+V RS +    ++ S T   E
Sbjct: 240 QIEEIVAGIVGQGRARVQVTAELDLNRVESRSESFDPESRVVRSTQT--RSENSLTGGAE 297

Query: 304 SAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVV 363
             V+V   +P  +  + P P+  +++ K EE +NYEI+  +   T +  +L+RLS+AV+V
Sbjct: 298 GQVSVGNELPGANQNQPP-PQQKDSSQKNEEVTNYEISRVTKVETLEGGRLKRLSVAVLV 356

Query: 364 NKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGT 423
           +        G++A Q + D+ +A I  +V  A G +  RGD + + ++ F E        
Sbjct: 357 DGVYAPGADGKAAYQPRSDAEIARIAALVRTAVGYDKARGDQVEVVNLRFAETPAAAEFA 416

Query: 424 VQ---VSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL 480
                 SF+         ++   V  + TL+V    +  L R     DA    + G ++ 
Sbjct: 417 EPGLIQSFLSPSKEDVMRLVELAVLSLLTLIVLMAVVRPLLRRVLESDAPVAALAGPALA 476

Query: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540
                    T   +               ++     ++IN  +  ++  R++ M+  +  
Sbjct: 477 LAGAGGEGPTEIAVRE-----------NSTNKFLESAKINGQIQAETVERVVDMVRASPT 525

Query: 541 RFAKILRKWARS 552
              ++LR W   
Sbjct: 526 ETVEVLRNWIHD 537


>gi|313673744|ref|YP_004051855.1| flagellar m-ring protein flif [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312940500|gb|ADR19692.1| flagellar M-ring protein FliF [Calditerrivibrio nitroreducens DSM
           19672]
          Length = 554

 Score =  353 bits (906), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 130/563 (23%), Positives = 239/563 (42%), Gaps = 20/563 (3%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M + D   QF        + + + + S  +  ++  +   ++ N P Y  L+  L   D 
Sbjct: 1   MNLKDVGEQFKTVFQKFSKVQQIAIISAAVAILLSIIVLVYWANKPVYKILFANLSQEDA 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
             +   L    I + + D+G +I VP+  V + RI LA +G+P      G+ELFDK + F
Sbjct: 61  AEVVAKLKAKKIPYNLKDSGKTIEVPAKDVYETRIELAKEGIPKGGG-VGFELFDKTS-F 118

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA- 179
           G+T F Q +   RAL+GE++RTI ++  +  ARVH+ +P    F        A+V+++  
Sbjct: 119 GITEFAQNVNYQRALQGELSRTISTLEEVEEARVHLTLPKDKLFITEDGEAKAAVVLKLK 178

Query: 180 -INPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNI----LGKSLSIV 234
                     +AI  LV  AV  L + +V ++D+ G LL+ +  E N+        L   
Sbjct: 179 KGETLNRDKVKAIASLVVGAVKGLKIQNVQIVDTQGNLLSESLNEENLPYVKTQTQLEYQ 238

Query: 235 QAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDA 294
           + ++  I   IN  LA  LG +N  + V AE++ D ++I +  +D +  V RS +  +  
Sbjct: 239 KKVEKIISSKINSLLATTLGENNAVAQVTAEIDFDKKEINKEEFDQN-PVLRSSQTIEIE 297

Query: 295 QRSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKL 354
            ++  + P+    VE N+   +   +          K EE  N+EI             +
Sbjct: 298 SKNTPNTPQGQPGVEPNLAEPN---IQQNGVNSTYTKNEETQNFEIGKTVTKEEKSIGSI 354

Query: 355 ERLSIAVVVNKGRLTEVLGR---SADQGKIDSYLAEINKIVSAATGINSRRGDTITITSM 411
           +RL+IAVVVN        G+   +    +    L +I  +V+ A G + +RGD I +T++
Sbjct: 355 KRLTIAVVVNDKAEIVKEGKKEVTKYVPRTKEELDKIKGLVAKAAGFDEKRGDQIEVTNV 414

Query: 412 DFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKK 471
            F  +Q+  S  ++   M+ L      +   ++ LV  LL  FL +  + +        K
Sbjct: 415 SFDTSQMSESKLLEKEKMNEL---IIQISKYVMVLVMFLLFYFLVIRPIMKKLGDIKETK 471

Query: 472 GEVGGKSILSP--PPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDL 529
                     P             +       +   +        +   + +  +K    
Sbjct: 472 SGELAAVGDIPLKGANVDLQLDDSVKFPKTLEELEREIESELDEKVSVDVGTVKTKVMVK 531

Query: 530 RLLHMIEINEERFAKILRKWARS 552
           ++   ++ + E  A +++ W + 
Sbjct: 532 KIEEAVKEDPEMIANLIKTWLKE 554


>gi|94500269|ref|ZP_01306802.1| flagellar M-ring protein [Oceanobacter sp. RED65]
 gi|94427568|gb|EAT12545.1| flagellar M-ring protein [Oceanobacter sp. RED65]
          Length = 577

 Score =  353 bits (906), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 115/557 (20%), Positives = 223/557 (40%), Gaps = 31/557 (5%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           +         L   R + L       + L +    +     Y  L   LE  +   I   
Sbjct: 39  INPIMMGFNKLTIVRQVALLIGFAGILALGIGVIIWSQEVTYRPLISNLEDYNAKEILQT 98

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L E  ID+RI+     ++VP + +  AR+ LA   +    +  G EL D+    G + F+
Sbjct: 99  LDEKGIDYRINPTTGIVTVPEAEIHDARLALAPI-VAEIDTTVGLELLDQEQGLGTSQFI 157

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INPSV 184
           +     R LEGE+ARTI S+  +  ARVH+ +P    F +    P ASV +         
Sbjct: 158 ESARYRRGLEGELARTIASLQSVRNARVHLALPKQSVFVRDDREPRASVFLEIYGGKGLK 217

Query: 185 YKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA--NEMERNILGKSLSIVQAIQHEIE 242
            + AEAI +L+A+++P L + +VT++D  G LL+    + E  +  K     + +++ + 
Sbjct: 218 REQAEAIINLIASSIPELPVENVTLVDQKGNLLSKEGQDEEDLLATKQFDYTRKVENSLH 277

Query: 243 MNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQP 302
             + + L   LG DNF++ V A+++    +  + +++PD    RS +     Q       
Sbjct: 278 QRVQRILEPVLGSDNFQAEVSADVDFTMVEQTQELFNPDLIALRSEQTL--NQEKVEKPE 335

Query: 303 ESAVTVEQNMPHVSDRKV------PLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLER 356
                   N P  +            P +     K E   NYE++     T H   +L R
Sbjct: 336 GGIPGALSNQPPGAAEVPEEVDENGNPVAQPIERKSEATRNYEVDRTLSHTQHQVGRLRR 395

Query: 357 LSIAVVV-NKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLE 415
           L+++V V ++ ++    G        ++ L  +  +V  + G N+ RGD++++ +  FL 
Sbjct: 396 LTVSVAVNDREKVNPETGVVESVPWTEAELKRLELLVKDSVGFNAARGDSVSVVNSLFLG 455

Query: 416 NQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVG 475
             +                 F  ++  ++  +  L++ F  +  + +    +   +G++ 
Sbjct: 456 GAVELGEPDFWK-----QPWFWEIVKQVLAGLFLLILIFGVIRPIVK----NLIDRGKMD 506

Query: 476 GKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMI 535
             + +            L  +D + L  +++ +   +     R            L  +I
Sbjct: 507 EVAEIEGELDELGDGDDLFGDDKVTLAGADEFLLPGASEGFER--------QLDALKGLI 558

Query: 536 EINEERFAKILRKWARS 552
             +  R A+  +KW   
Sbjct: 559 AEDPARVAQSFKKWVND 575


>gi|238788332|ref|ZP_04632126.1| Flagellar M-ring protein [Yersinia frederiksenii ATCC 33641]
 gi|238723578|gb|EEQ15224.1| Flagellar M-ring protein [Yersinia frederiksenii ATCC 33641]
          Length = 569

 Score =  353 bits (906), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 124/583 (21%), Positives = 230/583 (39%), Gaps = 58/583 (9%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           ++   F  +   L     + L       I + +A   +  SP Y  LY  L   D   I 
Sbjct: 10  NRENTFTTTLARLRANPKIPLLIAAAAAIAIIVALMLWAKSPDYRVLYSNLSDRDGGDIV 69

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L++ NI +R +D+G ++ +P+  V + R+ LA QGLP   +  G+EL D+   FG++ 
Sbjct: 70  TQLTQLNIPYRFADHGGALLIPADKVHETRLRLAQQGLPKGGA-VGFELLDQE-KFGISQ 127

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVM--IRAINP 182
           F +++   RALEGE+ARTI ++  ++  RVH+ MP    F +    PTASV   ++    
Sbjct: 128 FSEQVNYQRALEGELARTIGTLGPVLNVRVHLAMPKPSLFVREQKSPTASVTLALQPGRA 187

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQHEI 241
                  AI ++V+++V  L   +VTV+D TG+LLT ++     +    L     +++  
Sbjct: 188 LDDGQINAIVYMVSSSVAGLPPANVTVVDQTGRLLTQSDSAGRDLNAAQLKFTNEVENRF 247

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
           +  I   LA  +G  N  + V A+++  +++  +  Y P+    +    S+    SE   
Sbjct: 248 QRRIETILAPMVGSGNVHAQVTAQVDFASREQTDEEYKPNQAANQGAVRSQQVSSSEQLG 307

Query: 302 P---ESAVTVEQNMPHVSD----------------------------RKVPLPRSLENTD 330
                       N P  +                                    +  +  
Sbjct: 308 GSNVGGVPGALSNQPSATPVAPIEVPQPAAAPGATGAAANNANAANSPATTRSTATSSNS 367

Query: 331 KKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINK 390
           + ++ +N+E++     T      ++RLS+AVVVN G                  LA++  
Sbjct: 368 RHDQTTNFEVDRTIRHTQQQAGMVQRLSVAVVVNYGS----DKAGKPIALTKDQLAQVES 423

Query: 391 IVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTL 450
           +   A G ++ RGDT+ + +  F      +   +              ++NA  +L+  L
Sbjct: 424 LTREAMGFSTDRGDTLNVVNTPFNATDNASGNALPFWQQPSFFDQ---LLNAGRYLLILL 480

Query: 451 LVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFS 510
           +   L    +R L              + +     + A  T     + +AL   NQ   S
Sbjct: 481 VAWILWRKLVRPLIAKKQIADKAAASVNNIV--QTAQATETAKQSKEELALRKKNQQRVS 538

Query: 511 HSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
                         +    R+  + + +    A ++R+W  ++
Sbjct: 539 A-------------EVQAQRIRELADKDPRVVALVIRQWMSND 568


>gi|332161342|ref|YP_004297919.1| flagellar MS-ring protein [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325665572|gb|ADZ42216.1| flagellar MS-ring protein [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330863306|emb|CBX73430.1| flagellar M-ring protein [Yersinia enterocolitica W22703]
          Length = 559

 Score =  353 bits (905), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 117/538 (21%), Positives = 219/538 (40%), Gaps = 48/538 (8%)

Query: 40  RFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAA 99
             +  SP Y  LY  L   D   I   L++ NI +R +DNG ++ +P+  V + R+ LA 
Sbjct: 45  MLWAKSPDYRVLYSNLNDRDGGDIVTQLTQLNIPYRFADNGGALLIPADKVHETRLRLAQ 104

Query: 100 QGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMP 159
           QGLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI ++  ++  RVH+ MP
Sbjct: 105 QGLPKGGA-VGFELLDQE-KFGISQFSEQVNYQRALEGELARTIGTLGPVLNVRVHLAMP 162

Query: 160 DMGSFRKIGARPTASVM--IRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
               F +    PTASV   ++           AI ++V+++V  L   +VTV+D TG+LL
Sbjct: 163 KPSLFVREQKSPTASVTLALQPGRALDDGQINAIVYMVSSSVAGLPPANVTVVDQTGRLL 222

Query: 218 TANEMERN-ILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI 276
           T ++     +    L     +++  +  I   LA  +G  N  + V A+++  +++  + 
Sbjct: 223 TQSDSAGRDLNAAQLKFTNEVENRFQRRIETILAPMVGSGNVHAQVTAQVDFASREQTDE 282

Query: 277 VYDPDSKVERSIRLSKDAQRSETSQP---ESAVTVEQNMPHVSDRKV------------- 320
            Y P+    +    S+    SE               N P  +                 
Sbjct: 283 EYKPNQAANQGAVRSQQVSTSEQLGGTNVGGVPGALSNQPSATPVAPIEVPQATPAAGAG 342

Query: 321 -----PLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRS 375
                    +  +  + ++ +N+E++     T      ++RLS+AVVVN G         
Sbjct: 343 AAANAAKQTATSSNSRHDQTTNFEVDRTIRHTQQQAGMVQRLSVAVVVNYGS----DKAG 398

Query: 376 ADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRH 435
                    LA++  +   A G ++ RGDT+ + +  F      +   +           
Sbjct: 399 KPIALSKDQLAQVESLTREAMGFSTVRGDTLNVVNTPFNATDDASGSNLPFWQQPS---F 455

Query: 436 FATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMP 495
           F  ++N   +L+  L+   L    +R L              + +     ++        
Sbjct: 456 FDQLLNIGRYLLILLVAWILWRKLVRPLIAKKQEADKAAASVNNIVQAAQTTETAKQTKE 515

Query: 496 NDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
                         +  +  Q R+++ V  Q   R+  + + +    A ++R+W  ++
Sbjct: 516 E------------LALRKKNQQRVSAEVQAQ---RIRELADKDPRIVALVIRQWMSND 558


>gi|238920311|ref|YP_002933826.1| flagellar MS-ring protein [Edwardsiella ictaluri 93-146]
 gi|238869880|gb|ACR69591.1| flagellar M-ring protein FliF, putative [Edwardsiella ictaluri
           93-146]
          Length = 569

 Score =  353 bits (905), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 123/578 (21%), Positives = 224/578 (38%), Gaps = 56/578 (9%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
                    +     + L     V I + +    +  +P Y  LY  +   D   I   L
Sbjct: 18  NSIKAILERVRANPKIPLLLASAVAIAIVVVLALWARAPDYRVLYSNISDRDGGAIVTQL 77

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           ++ NI +R ++NG+++ VP+S V   R+ LA QGLP   +  G+EL D+   FG++ F +
Sbjct: 78  TQMNIPYRFANNGTTLMVPASDVYATRLKLAQQGLPRGGA-VGFELLDQE-KFGISQFSE 135

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR--AINPSVY 185
           ++   RALEGE+ARTI+++  +V+ARV +  P    F +   +P+ASV +          
Sbjct: 136 QVNYQRALEGELARTIETLGPVVSARVLLAEPKPSLFVREQKQPSASVTLTLEPGRVLDD 195

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM-ERNILGKSLSIVQAIQHEIEMN 244
               AI ++V+++V  L  G+VTV+D  G LL+  +   R++    L     ++  ++  
Sbjct: 196 GQINAIVYMVSSSVAGLPPGNVTVVDQYGHLLSQPDGTGRDLNAAQLKFTAEVESRLQRR 255

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQP-- 302
           I   L   LG  N  + V A+L+  +++  +  Y P+    ++   SK   +S+ S    
Sbjct: 256 IETILQPMLGNGNVHAQVTAQLDFASREQTDEEYTPNQPPNQAAVRSKQINQSDQSGGLQ 315

Query: 303 -ESAVTVEQNMPHVSDR------------------------KVPLPRSLENTDKKEEQSN 337
                    N P  +                                S     +++E  N
Sbjct: 316 SGGVPGALSNEPAPAPTGHINGKPRSAQGGNGAANRSNAVSNNGRQSSRSENFRRDETIN 375

Query: 338 YEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATG 397
           YE++     T      +ERLS+AVVVN         +  +       + +IN +V  A G
Sbjct: 376 YEVDRTIRHTKARAGTIERLSVAVVVNYAS----DTKGKEVALSQQKMDQINNLVREAMG 431

Query: 398 INSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGL 457
            +  RGDT+++ +  F   +                     +     +L+  L+   L  
Sbjct: 432 FSQSRGDTLSVVNTPFNSVEDNGGELP----FWQKQAFIDLLTTLGRYLLVALVAWLLWR 487

Query: 458 HALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQS 517
             ++ L             ++   P                     S Q      +  + 
Sbjct: 488 KLVKPLLTKQQQAAAAAQQRADTPPLSAQP----------------SKQLSNEELQQRRK 531

Query: 518 RINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
                 ++    R+  M E +    A ++R+W  +E +
Sbjct: 532 LQQRSTAEAQTERVREMAEQDPRVVALVIRQWMSTEQQ 569


>gi|123442764|ref|YP_001006741.1| flagellar MS-ring protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122089725|emb|CAL12578.1| flagellar M-ring protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 566

 Score =  353 bits (905), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 120/580 (20%), Positives = 229/580 (39%), Gaps = 55/580 (9%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           ++   F  +   L     + L       + + +A   +  SP Y  LY  L   D   I 
Sbjct: 10  NRENTFTTTLARLRANPKIPLLIAAAAAVAILVALMLWAKSPDYRVLYSNLNDRDGGDIV 69

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L++ NI +R +DNG ++ +P+  V + R+ LA QGLP   +  G+EL D+   FG++ 
Sbjct: 70  TQLTQLNIPYRFADNGGALLIPADKVHETRLRLAQQGLPKGGA-VGFELLDQE-KFGISQ 127

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVM--IRAINP 182
           F +++   RALEGE+ARTI ++  ++  RVH+ MP    F +    PTASV   ++    
Sbjct: 128 FSEQVNYQRALEGELARTIGTLGPVLNVRVHLAMPKPSLFVREQKSPTASVTLALQPGRA 187

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQHEI 241
                  AI ++V+++V  L   +VTV+D TG+LLT ++     +    L     +++  
Sbjct: 188 LDDGQINAIVYMVSSSVAGLPPANVTVVDQTGRLLTQSDSAGRDLNAAQLKFTNEVENRF 247

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
           +  I   LA  +G  N  + V A+++  +++  +  Y P+    +    S+    SE   
Sbjct: 248 QRRIETILAPMVGSGNVHAQVTAQVDFASREQTDEEYKPNQAANQGAVRSQQVSTSEQLG 307

Query: 302 P---ESAVTVEQNMPHVSDRKV-------------------------PLPRSLENTDKKE 333
                       N P  +                                 +  +  + +
Sbjct: 308 GTNVGGVPGALSNQPSATPVAPIEIPQATPAAGAGAAANAANRPATAARQTATSSNSRHD 367

Query: 334 EQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVS 393
           + +N+E++     T      ++RLS+AVVVN G                  LA++  +  
Sbjct: 368 QTTNFEVDRTIRHTQQQAGMVQRLSVAVVVNYGS----DKAGKPIALSKDQLAQVESLTR 423

Query: 394 AATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVT 453
            A G ++ RGDT+ + +  F      +   +              ++N   +L+  L+  
Sbjct: 424 EAMGFSTVRGDTLNVVNTPFNATDDASGSNLPFWQQPSFFDQ---LLNIGRYLLILLVAW 480

Query: 454 FLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSR 513
            L    +R L              + +     ++                      +  +
Sbjct: 481 ILWRKLVRPLIAKKQEADKAAASVNNIVQAAQTTETAKQTKEE------------LALRK 528

Query: 514 NLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
             Q R+++ V  Q   R+  + + +    A ++R+W  ++
Sbjct: 529 KNQQRVSAEVQAQ---RIRELADKDPRIVALVIRQWMSND 565


>gi|238751780|ref|ZP_04613268.1| Flagellar M-ring protein [Yersinia rohdei ATCC 43380]
 gi|238710051|gb|EEQ02281.1| Flagellar M-ring protein [Yersinia rohdei ATCC 43380]
          Length = 564

 Score =  353 bits (905), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 119/543 (21%), Positives = 218/543 (40%), Gaps = 53/543 (9%)

Query: 40  RFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAA 99
             +  SP Y  LY  L   D   I   L++ NI +R +D+G ++ +P+  V + R+ LA 
Sbjct: 45  MLWAKSPDYRVLYSNLSDRDGGDIVTQLTQLNIPYRFADSGGALLIPADKVHETRLRLAQ 104

Query: 100 QGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMP 159
           QGLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI ++  ++  RVH+ MP
Sbjct: 105 QGLPKGGA-VGFELLDQE-KFGISQFSEQVNYQRALEGELARTIGTLGPVLNVRVHLAMP 162

Query: 160 DMGSFRKIGARPTASVM--IRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
               F +    PTASV   ++           AI ++V+++V  L   +VTV+D TG+LL
Sbjct: 163 KPSLFVREQKSPTASVTLALQPGRALDDGQINAIVYMVSSSVAGLPPANVTVVDQTGRLL 222

Query: 218 TANEMERN-ILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI 276
           T ++     +    L     +++  +  I   LA  +G  N  + V A+++  +++  + 
Sbjct: 223 TQSDSAGRDLNAAQLKFTNEVENRFQRRIETILAPMVGSGNVHAQVTAQVDFASREQTDE 282

Query: 277 VYDPDSKVERSIRLSKDAQRSETSQP---ESAVTVEQNMPHVSDRKVPL----------- 322
            Y P+    +    S     SE               N P  +                 
Sbjct: 283 EYKPNQSANQGAVRSAQISTSEQLGGSNVGGVPGALSNQPSATPVAPIEVTQPAGANNAN 342

Query: 323 ------------PRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTE 370
                         +  +  + ++ +NYE++     T      ++RLS+AVVVN G    
Sbjct: 343 AAARPAATPAARSTATSSNSRHDQTTNYEVDRTIRHTQQQAGMVQRLSVAVVVNYGS--- 399

Query: 371 VLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMD 430
                         LA++  +   A G ++ RGDT+ + +  F          +      
Sbjct: 400 -DKAGKPIALTKDQLAQVESLTREAMGFSTNRGDTLNVVNTPFNATDDTTGRALPFW--- 455

Query: 431 ILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVT 490
                F  ++NA  +L+  L+   L    +R +    +         + +      +   
Sbjct: 456 QQQSFFDQLLNAGRYLLILLVTWILWRKLVRPMLAKKNVADKAAASVNSMVQAAQVTE-- 513

Query: 491 TGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWA 550
           T     + +AL   NQ   S              +    R+  + + +    A ++R+W 
Sbjct: 514 TVKQSKEELALRKKNQQRISA-------------EVQAQRIRELADKDPRVVALVIRQWM 560

Query: 551 RSE 553
            ++
Sbjct: 561 SND 563


>gi|212709512|ref|ZP_03317640.1| hypothetical protein PROVALCAL_00554 [Providencia alcalifaciens DSM
           30120]
 gi|212687850|gb|EEB47378.1| hypothetical protein PROVALCAL_00554 [Providencia alcalifaciens DSM
           30120]
          Length = 563

 Score =  353 bits (905), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 121/533 (22%), Positives = 227/533 (42%), Gaps = 34/533 (6%)

Query: 39  ARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLA 98
              +  SP Y  L   L   D   I   L++ N+ ++I+DNGS+I VP+  V + R+ LA
Sbjct: 44  LLLWFRSPDYRVLLSNLSAKDGGDIVSQLTQMNVPYQIADNGSAILVPADKVHELRLKLA 103

Query: 99  AQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVM 158
             GLP    N+G+EL DK   FG++ F ++I   RALEGE++RTI+S+S + +ARVH+ +
Sbjct: 104 QSGLPK-GGNTGFELLDKE-KFGISQFSEQINYQRALEGELSRTIESLSPVQSARVHLAI 161

Query: 159 PDMGSFRKIGARPTASVMIR--AINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKL 216
           P    F +    PTASV +              AI H+V+++V  L   +V ++D TG+L
Sbjct: 162 PKPTLFVREQKLPTASVTVGLLPGRMLDEGQISAIVHMVSSSVTGLTAANVIIVDQTGRL 221

Query: 217 LTANEMERNILGK-SLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           LT N+  +       + + + ++  ++  I   L+  +G  N  + V A+++    +   
Sbjct: 222 LTNNDNSQQSANSAQIKMTKEMEAHLKERIEDILSPLVGRANIHAQVTAQMDFSKVEQTS 281

Query: 276 IVYDPDSKVERSIRLSKDAQRS---ETSQPESAVTVEQNMP-------------HVSDRK 319
             Y P+   + +   S+ +  S       P        N P             +   + 
Sbjct: 282 EEYKPNQTPDAAAVRSRQSSESLQNSNGGPSGVPGALSNQPVSAPSAPIDGNKENTDGKT 341

Query: 320 VPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQG 379
               R+     +++E +NYE++ K   T      ++RLS+AV+VN        G    + 
Sbjct: 342 AGNTRNGTLNTQRDETTNYEVDRKISHTQRQIGVVDRLSVAVIVNYQSQEGEKG-PEMKP 400

Query: 380 KIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATV 439
                L +I+ +   A G +++RGD+I IT+  F ++         +S   ++S+     
Sbjct: 401 LPPEMLQQIDALTREAMGYSAQRGDSINITNSLFTDDTPVIEEPSLLSSPQVISQ----A 456

Query: 440 INALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNI 499
           ++    ++  L+  F+    ++         +       +             +    + 
Sbjct: 457 LDYGKIVLIALIAWFMWRFGIKPQWVKYRKTQQAQIDAEMSIANASQVKAPFVVEEEISE 516

Query: 500 ALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARS 552
            +D   +   +  R           +    R+  M E + +  A ++R+W   
Sbjct: 517 DMDEKTRRRLTRQRVSA--------EIQSQRIREMAEKDPQVVAMVIRQWLGK 561


>gi|271500086|ref|YP_003333111.1| flagellar M-ring protein FliF [Dickeya dadantii Ech586]
 gi|270343641|gb|ACZ76406.1| flagellar M-ring protein FliF [Dickeya dadantii Ech586]
          Length = 574

 Score =  353 bits (905), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 128/588 (21%), Positives = 232/588 (39%), Gaps = 67/588 (11%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
             F +    L     + L       I + +A   +   P Y  LY  L   D   I   L
Sbjct: 13  KSFGEILNRLRANPKIPLLIAAAATIAIVVALSLWARGPDYRALYTNLNERDGGSIVSEL 72

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
            + NI +R ++NG++I +P+  V + R+ LA QGLP   +  G+EL D+   FG++ F +
Sbjct: 73  GKMNIPYRFAENGAAILIPADKVYETRLKLAQQGLPKGGA-VGFELLDQE-KFGISQFSE 130

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN--PSVY 185
           +I   RALEGE+ART++++  I +ARVH+ +P    F +    P+A+V +          
Sbjct: 131 QINYQRALEGELARTMETLGPIQSARVHLAIPKPSLFVREQKSPSAAVTVTLQPGRALDD 190

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQHEIEMN 244
               AI +LV+++V  L    VTV+D TGKLLT N+     +    L     ++   +  
Sbjct: 191 SQINAITYLVSSSVAGLPADKVTVVDQTGKLLTQNDGSGRDLNAAQLKYANEVESNYQRR 250

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE------ 298
           I   L   +G  N  + V A+++   ++  +  Y P+    ++   S+   +S+      
Sbjct: 251 IEAILTPVVGAGNVHAQVTAQIDFANREQTDEQYQPNQTPNQAAVRSQQTSQSDQRGGPN 310

Query: 299 --------TSQPESAVTVEQNMPH------------------------VSDRKVPLPRSL 326
                   ++ P  A T   + P                          +        + 
Sbjct: 311 VGGVPGALSNTPTPAPTAPISTPPTNNANNANNANNTNNANNANAAGNNTQTSASNSANQ 370

Query: 327 ENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLA 386
               ++++  NYE++     T      ++RLS+AVVVN        G+ A     D  L 
Sbjct: 371 TFNSRRDQTINYEVDRTIRHTKQSTGSVQRLSVAVVVNY--TQGEDGKPA--ALSDEQLK 426

Query: 387 EINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFL 446
           +I  +V  + G +S RGD++ + +  F                      F  +I A  +L
Sbjct: 427 KIEALVRESMGFSSDRGDSVNVVNTPFTVTDTSAGELP----FWKKQAFFDLLIEAGRWL 482

Query: 447 VGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQ 506
           +  ++   +    +R         +      + L       +VT   M  +         
Sbjct: 483 LVLIVGWIMYRKLVRPQLQRRSQIQQAAEAAAALRGQDSDVSVTISAMEEE--------- 533

Query: 507 DIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                 +  + R ++ +  Q   R+  + E +    A ++R W  +E+
Sbjct: 534 ----IQKKSEQRAHAEMHSQ---RIRELAENDPRVVALVIRHWMSNEL 574


>gi|167588531|ref|ZP_02380919.1| flagellar MS-ring protein [Burkholderia ubonensis Bu]
          Length = 487

 Score =  353 bits (904), Expect = 6e-95,   Method: Composition-based stats.
 Identities = 111/441 (25%), Positives = 190/441 (43%), Gaps = 15/441 (3%)

Query: 39  ARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLA 98
              +  +P Y  LY  L   D   I  AL +AN+ ++ +D G +I VP++ V + R+ LA
Sbjct: 50  LVLWTRAPDYRVLYSNLSDRDGGAIIAALQQANVPYKFADAGGAILVPANQVHETRLKLA 109

Query: 99  AQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVM 158
           A GLP   S  G+EL D    FG++ F ++I   RALEGE+ RTI+S++ + AARVH+ +
Sbjct: 110 ALGLPKGGS-VGFELMDN-QKFGISQFAEQINYQRALEGELQRTIESVNAVKAARVHLAI 167

Query: 159 PDMGSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKL 216
           P    F +    P+ASV +              AI  +V++ VP++   +VT++D  G L
Sbjct: 168 PKPSVFVRDKEAPSASVFVDLYPGRVLDEGQVLAITRMVSSGVPDMPAKNVTIVDQDGNL 227

Query: 217 LTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI 276
           LT       +    L  VQ ++   +  I+  LA   G  N RS V A+++    +    
Sbjct: 228 LTQPASATGLDASQLKYVQQVERNTQKRIDAILAPIFGTGNARSQVSADIDFSRLEQTSE 287

Query: 277 VYDPDSKVERSIRLSKDAQRSE---TSQPESAVTVEQNMPHVSDRKV-------PLPRSL 326
            Y P+   +++   S+    +                N P                P++ 
Sbjct: 288 SYGPNGTPQQTAIRSQQTSTATELAQGGASGVPGALSNTPPQPASAPIVAGNGQNGPQAT 347

Query: 327 ENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLA 386
             +D+K+  +NYE++            ++RLS+AVVVN   + +  G    Q    + LA
Sbjct: 348 PVSDRKDSTTNYELDKTIRHVEQPMGSVKRLSVAVVVNYQPVADSKGHVTMQPLPPAKLA 407

Query: 387 EINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFL 446
           ++ ++V  A G +++RGD++ + +  F       +          +          L   
Sbjct: 408 QVEQLVKDAMGYDAKRGDSVNVVNSTFTAAGDPYANLP-WYRQPAIIDMAKEAAKWLGIA 466

Query: 447 VGTLLVTFLGLHALRRLHNID 467
                + F  +    R     
Sbjct: 467 AVAAALYFAVVRPAMRRAFPP 487


>gi|331005205|ref|ZP_08328599.1| Flagellar M-ring protein fliF [gamma proteobacterium IMCC1989]
 gi|330420987|gb|EGG95259.1| Flagellar M-ring protein fliF [gamma proteobacterium IMCC1989]
          Length = 565

 Score =  353 bits (904), Expect = 6e-95,   Method: Composition-based stats.
 Identities = 117/558 (20%), Positives = 234/558 (41%), Gaps = 25/558 (4%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
               +   +L   R + L   +   + +  A   +     Y  LY  L   D + I   L
Sbjct: 21  SNLVEGFNNLNLLRQVGLMVALAASVAIGFAVVLWTQEEDYRPLYSNLNQLDSSEIISIL 80

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
            +  I F++     ++ V +  +  AR+ LA  GLP++ S  G+EL DK    G + FM+
Sbjct: 81  EQNAIQFKVDTKTGALLVSAQDIHTARLKLAEVGLPNTGS-VGFELLDKEQPLGSSQFME 139

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPS--VY 185
                R LEGE+ARTI S++ + AARVH+ +P    F +    P ASV +          
Sbjct: 140 ATRYRRGLEGELARTITSLNAVRAARVHLAIPKRSVFVRDAREPRASVFVELYPGRAITP 199

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNI--LGKSLSIVQAIQHEIEM 243
           +   A+ +LVA+++  L + +VT++D  G LL+  E +  +    + L   + ++ +I  
Sbjct: 200 QQVVAMSNLVASSISELSLKNVTIVDQKGNLLSKGEEDPQLVQAAQELEYTREVEKKIIS 259

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            I   L   +G D FR+ V A+++ +  +  E +++PD    RS +   + +        
Sbjct: 260 RIQALLDPIVGGDRFRAEVAAQVDFNQVEQAEEMFNPDLPAIRSEQTVDEQRVGGGVGG- 318

Query: 304 SAVTVEQNMPHVSDRKVPLPRSLENTD-------KKEEQSNYEINTKSIATTHDNYKLER 356
                  N P  +     +    +N +       + +   N+E++     T H   K+ R
Sbjct: 319 -IPGALTNQPPANADAPEIAAGGDNNNAQQSSNSRSQSTRNFELDRTMSYTKHQVGKVRR 377

Query: 357 LSIAVVVNKGRLTEV-LGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLE 415
           LS+AVVV+   +T+   G    +   D+ +  ++ +V  A G +  RGD++ I +  FL 
Sbjct: 378 LSVAVVVDDRLVTDPLTGEQKYETWSDNEIERLSILVRDAVGFSPARGDSVNIINTPFLN 437

Query: 416 NQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVG 475
           +          +F +     F  +I  ++ L+  L++    L  + +      ++  +  
Sbjct: 438 DGFNAEEIQAPNFWEE--EWFTALIKPIIGLLIILIMVLGLLRPILKTLARTGSETRDDE 495

Query: 476 GKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMI 535
               L+    +   +   + ++ + L  +                    +Q    +  ++
Sbjct: 496 EAQQLAALEAAGLGSFDELSDEAVTLTGTTALSLPGPEES--------YEQMLNSVKGLV 547

Query: 536 EINEERFAKILRKWARSE 553
             +  R ++++++W   E
Sbjct: 548 ADDPGRVSQVIKRWINEE 565


>gi|238764898|ref|ZP_04625838.1| Flagellar M-ring protein [Yersinia kristensenii ATCC 33638]
 gi|238696917|gb|EEP89694.1| Flagellar M-ring protein [Yersinia kristensenii ATCC 33638]
          Length = 572

 Score =  353 bits (904), Expect = 6e-95,   Method: Composition-based stats.
 Identities = 128/586 (21%), Positives = 230/586 (39%), Gaps = 61/586 (10%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           ++   F  +   L     + L       I + +A   +  SP Y  LY  L   D   I 
Sbjct: 10  NRENTFTTTLARLRANPKIPLLIAAAAAIAIIVALMLWAKSPDYRVLYSNLSDRDGGDIV 69

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L++ NI +R +DNG ++ +P+  V + R+ LA QGLP   +  G+EL D+   FG++ 
Sbjct: 70  TQLTQLNIPYRFADNGGALLIPADKVHETRLRLAQQGLPKGGA-VGFELLDQE-KFGISQ 127

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVM--IRAINP 182
           F +++   RALEGE+ARTI ++  ++  RVH+ MP    F +    PTASV   ++    
Sbjct: 128 FSEQVNYQRALEGELARTISTLGPVLNVRVHLAMPKPSLFVREQKSPTASVTLALQPGRA 187

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQHEI 241
                  AI ++V+++V  L    VTV+D TG+LLT ++     +    L     +++  
Sbjct: 188 LDDGQINAIVYMVSSSVAGLPPASVTVVDQTGRLLTQSDSAGRDLNAAQLKFTNEVENRF 247

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
           +  I   LA  +G  N  + V A+++  +++  +  Y P+    +    S+    SE   
Sbjct: 248 QRRIETILAPMVGSGNIHAQVTAQVDFSSREQTDEEYKPNQAANQGAVRSQQVSTSEQLG 307

Query: 302 P---ESAVTVEQNMPHVSDRKV-------------------------------PLPRSLE 327
                       N P V+                                       +  
Sbjct: 308 GTNVGGVPGALSNQPPVTPVAPIEVPPATPAAGAGAPANTANAANRPAATTTAARQTATS 367

Query: 328 NTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAE 387
           +  + ++ +N+E++     T      ++RLS+AVVVN G                  LA+
Sbjct: 368 SNSRHDQTTNFEVDRTIRHTQQQAGMVQRLSVAVVVNYGT----DKAGKPIALSKEQLAQ 423

Query: 388 INKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLV 447
           +  +   A G ++ RGDT+ + +  F         ++           F  +IN   +L+
Sbjct: 424 VESLTREAMGFSTDRGDTLNVVNTPFSATGDDTGSSLPFW---QQQSFFDQLINIGRYLL 480

Query: 448 GTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQD 507
             L+   L    +R L              + L     + A  T     + +AL   NQ 
Sbjct: 481 ILLVAWILWRKLVRPLMEKKQVADKATASVNTLV--QTAQASETAKQTKEELALRKKNQQ 538

Query: 508 IFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
             S              +    R+  + + +    A ++R+W  ++
Sbjct: 539 RVSA-------------EVQAQRIRELADKDPRVVALVIRQWMSND 571


>gi|187478210|ref|YP_786234.1| flagellar MS-ring protein [Bordetella avium 197N]
 gi|115422796|emb|CAJ49324.1| flagellar M-ring protein [Bordetella avium 197N]
          Length = 544

 Score =  352 bits (903), Expect = 8e-95,   Method: Composition-based stats.
 Identities = 113/536 (21%), Positives = 204/536 (38%), Gaps = 61/536 (11%)

Query: 42  FVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQG 101
           +   P Y  L+  L+  D   I  AL++ N+ +R SDNG +I VP + V   R+ LA QG
Sbjct: 46  WSREPDYKVLFSNLDDRDGGAIVTALTQMNVPYRFSDNGGAILVPGNRVYDLRMQLAGQG 105

Query: 102 LPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDM 161
           LP   S  G+EL D    FG + F +++   RALEGE+AR+I+++  +  ARVH+ +P  
Sbjct: 106 LPRGGS-VGFELMDNA-RFGASQFAEQVNYQRALEGELARSIEAMHTVQHARVHLALPRQ 163

Query: 162 GSFRKIGARPTASVMIRAINPSVY--KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219
             F +    PT SV++              AI  LVA++VP+L   +V+++D  G+LL+A
Sbjct: 164 SLFVRDRQPPTGSVLLTLYPGRSLAEAQVSAIAWLVASSVPDLSADNVSIVDQNGRLLSA 223

Query: 220 NEMERN-ILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVY 278
              E   +    +   +  +      I   L   +G  N  +    E++   ++    +Y
Sbjct: 224 PAGEGRGLDADQMRFAREYEQRTVERILTILNPLVGPGNVHAQASVEVDFARREETSEIY 283

Query: 279 DPDSKVERSIRLSKDAQ---RSETSQPESAVTVEQNMPHVSDRKVPLPRSLE-------- 327
            P+ +  ++   S+      ++  S          N P  + +                 
Sbjct: 284 RPNQEPGQAAVRSQQTSDSRQTNASPAAGVPGALSNQPPAATQAPLTNPPAPAQPQAQPA 343

Query: 328 ---------NTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQ 378
                      ++++   NYE++           +++RLS+AVVVN     +       Q
Sbjct: 344 APQQAAQISGNERRDATINYEVDRTISHVKQPVGQVKRLSVAVVVNHLPNKDGD----PQ 399

Query: 379 GKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFAT 438
                 L+++  +V  A G +  RGD++ + +  F +                       
Sbjct: 400 ALPPEELSKLTTLVREAMGYSEARGDSLNLVNSQFNDAPPTVPLWRDP--------DLIA 451

Query: 439 VINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDN 498
            I   +  V  LL+ F     +R + +     +                         D 
Sbjct: 452 TIKTALGWVFGLLIAFWAYRRIRPIVSEYLYPQI------------------------DP 487

Query: 499 IALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
            A+ +   +I   +            + +  R   M   +    A +LR W   + 
Sbjct: 488 EAVAAERAEIEREAVAAARAKEVNRYEDNLQRARDMATKDPRAVAMVLRAWMTKDE 543


>gi|88704287|ref|ZP_01102001.1| flagellar M-ring protein FliF [Congregibacter litoralis KT71]
 gi|88701338|gb|EAQ98443.1| flagellar M-ring protein FliF [Congregibacter litoralis KT71]
          Length = 574

 Score =  352 bits (903), Expect = 8e-95,   Method: Composition-based stats.
 Identities = 130/580 (22%), Positives = 225/580 (38%), Gaps = 38/580 (6%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
           AI + L   F   +    TR L L   +   I L M    +V  P+Y  LY  +   D N
Sbjct: 4   AIDNNLFNRFSGFSRQPATRQLALLIGLAASIALAMGMVQWVVEPNYKPLYGTMAPEDTN 63

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
            +  +L    +D+R+      ++VP+  V +AR+ LA  G P      G+E   +    G
Sbjct: 64  DVIASLEANGMDYRMDQRTGMVAVPAGEVHRARLLLAGDGYPR-GEGVGFESLYREQEIG 122

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA-- 179
           L+SFM++    RALE E+ARTI ++  +  ARVH+ M    +F +   +P ASVM+    
Sbjct: 123 LSSFMEQARFHRALESELARTISALDNVRGARVHLAMAKQSAFLRQREQPAASVMLNLYA 182

Query: 180 INPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTAN--EMERNILGKSLSIVQAI 237
                 +    I HLVA++VPNL+   V+V+D  GKLL+    + E           + +
Sbjct: 183 GRTLNDRQLAGIIHLVASSVPNLESEQVSVVDQQGKLLSQQGRDDEFAFTQDQFQYTRQL 242

Query: 238 QHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRS 297
           +  +   I   L   LG +  R+ V A+++    +  E  Y PD+   R        + S
Sbjct: 243 ESNLSARIVDILEPILGANAVRAQVAADVDFTRVERTEETYAPDT---RVRSEQTSEETS 299

Query: 298 ETSQPESAVTVEQNMPHVSDRKVPLPRS------------------------LENTDKKE 333
                        N P +                                        + 
Sbjct: 300 NQPYGGGVPGTLSNEPPIDTTVTAQQAQPNLGANAGVNTGVNVDATAQLGAIPPARTSRR 359

Query: 334 EQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVS 393
              NYE++            L++LSIAVV++    T   G +  +      + E+  +V 
Sbjct: 360 STVNYEMDKTISHVRETPGTLQKLSIAVVLDYIESTADDGTTTREPMPQERIDEVTSLVR 419

Query: 394 AATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVT 453
            A G ++ RGDT+++ S  F+E        ++ S ++        +   L+ L+  L + 
Sbjct: 420 EAVGFDAARGDTVSVISASFVEAPAIEDAVIESSILEE--DWIWQLGKGLLALIVLLSLI 477

Query: 454 FLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSR 513
           F+ +  L +   +         G        + +A+    M +D + L   NQ     + 
Sbjct: 478 FVVVRPLVKFAAVPVPMMQSPQGIQGPDGQAV-AALGGAGMSDDQVTLGGQNQAGLPGTS 536

Query: 514 NLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
                  +   +Q       +     +R A+++R W   +
Sbjct: 537 GDGG---AGGYQQQLQMARSVAAGEPDRAAQVVRNWVSDD 573


>gi|27355280|dbj|BAC52264.1| fliF [Bradyrhizobium japonicum USDA 110]
          Length = 519

 Score =  352 bits (903), Expect = 9e-95,   Method: Composition-based stats.
 Identities = 131/531 (24%), Positives = 223/531 (41%), Gaps = 18/531 (3%)

Query: 25  LASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSIS 84
           + +V    +  F      V +P    L+  L V D + I   L    I F + + G+ I 
Sbjct: 1   MIAVTAALVGFFAFVIMRVTTPQMTTLFTDLSVEDSSSIIKDLERQAIQFELRNEGTIIM 60

Query: 85  VPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQ 144
           VP   V + R+ LA           GYE+FDK ++ G TSF+Q I  +RALEGE+ARTI+
Sbjct: 61  VPKDKVTRLRMKLAEG-GLPKGGGVGYEVFDKSDALGTTSFVQNINHLRALEGELARTIR 119

Query: 145 SISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDM 204
           +I  I AARVH+V+P+   F +    P+AS+++R       +   AIRHLVA+AV  L  
Sbjct: 120 AIDRIQAARVHLVLPERPLFSREAPEPSASIVVRVRGALEAQQIRAIRHLVASAVNGLKP 179

Query: 205 GDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVA 264
             V+++D  G+LL                    +  +   +   +++ +G    R  + A
Sbjct: 180 QRVSIVDEAGQLLADGAATDPEQALGDERRTTFEKRMRKQVEDIVSSVVGSGRARVQLSA 239

Query: 265 ELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSDRKVPLPR 324
           + + +        +DP+ +V RS +  ++   S T+     VTV   +P           
Sbjct: 240 DFDFNKITQTSDKFDPEGRVLRSTQTREE--SSMTADNNGQVTVNNELPGNQQN--NGVA 295

Query: 325 SLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSY 384
           + + + K EE +NYEI+  +     +  ++ R+S+AV+V+        G  A Q +    
Sbjct: 296 AKDQSKKTEETNNYEISRTTKTEVTEAGRVNRISVAVLVDGIYSKNDKGELAYQDRTKEQ 355

Query: 385 LAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILS---RHFATVIN 441
           L  I  +V +A G + +RGD + + ++ F +            F+ +L          + 
Sbjct: 356 LDRIATLVRSAIGFDQKRGDQVEVVNLRFADAPSTAPIAEPSGFLGMLQFTKDDVMYFVE 415

Query: 442 ALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIAL 501
             V ++  L+V F+ +  L +     D     + G          +A   G         
Sbjct: 416 LGVMMLLGLVVLFMVIRPLVKRILASDEVAAAISGVLSGPAASDEAAPAAGQAL------ 469

Query: 502 DSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARS 552
                   + S    + I   V  QS  R+  + E N      I+R+W   
Sbjct: 470 ----LPGGAASAIDVATIQGQVHAQSVHRVGELAERNPNETVAIIRQWLTE 516


>gi|238784726|ref|ZP_04628730.1| Flagellar M-ring protein [Yersinia bercovieri ATCC 43970]
 gi|238714405|gb|EEQ06413.1| Flagellar M-ring protein [Yersinia bercovieri ATCC 43970]
          Length = 572

 Score =  352 bits (902), Expect = 9e-95,   Method: Composition-based stats.
 Identities = 121/586 (20%), Positives = 231/586 (39%), Gaps = 61/586 (10%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           ++   F  +   L     + L       + + +A   +  SP Y  LY  L   D   I 
Sbjct: 10  NRDNAFTTTLARLRANPKIPLLIAAAAAVAIIVALMLWAKSPDYRVLYSNLSDRDGGEIV 69

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L++ NI +R +DNG ++ +P+  V + R+ LA QGLP   +  G+EL D+   FG++ 
Sbjct: 70  TQLTQLNIPYRFADNGGALLIPADKVHETRLRLAQQGLPKGGA-VGFELLDQE-KFGISQ 127

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVM--IRAINP 182
           F ++I   RALEGE+ARTI ++  ++  RVH+ MP    F +    PTASV   ++    
Sbjct: 128 FSEQINYQRALEGELARTIGTLGPVLNVRVHLAMPKPSLFVREQKSPTASVTLALQPGRA 187

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQHEI 241
                  AI ++V+++V  L  G+VTV+D TG+LLT ++     +    L     +++  
Sbjct: 188 LDDGQINAIVYMVSSSVAGLPPGNVTVVDQTGRLLTQSDSAGRDLNAAQLKFTNEVENRF 247

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
           +  I   LA  +G  N  + V A+++  +++  +  Y P+    +    S+    SE   
Sbjct: 248 QRRIETILAPMVGSGNVHAQVTAQVDFASREQTDEEYKPNQAANQGAVRSQQTSNSEQLG 307

Query: 302 P---ESAVTVEQNMPHVSDRKV-------------------------------PLPRSLE 327
                       N P  +                                       +  
Sbjct: 308 GSNVGGVPGALSNQPSATPVAPIEVPQPAPVAGAAGAAANNANAANRPATTTAARSTATS 367

Query: 328 NTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAE 387
           +  + ++ +N+E++     T      ++RLS+AVVVN G                  LA+
Sbjct: 368 SNSRHDQTTNFEVDRTIRHTQQQAGMVQRLSVAVVVNYGS----DKAGKPVALSKDQLAQ 423

Query: 388 INKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLV 447
           +  +   A G ++ RGDT+ + +  F      +  ++              ++N   +L+
Sbjct: 424 VESLTREAMGFSTDRGDTLNVVNTPFNATDDGSGLSLPFWKQQSFFDQ---LLNGGRYLL 480

Query: 448 GTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQD 507
             L+   L    +R +              + +     ++                    
Sbjct: 481 ILLVAWILWRKLVRPMIAKKQLADKAAASVNSMVQTAQTAETVKQSKEE----------- 529

Query: 508 IFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
             +  +  Q R+++ V  Q   R+  + + +    A ++R+W  ++
Sbjct: 530 -LALRKKNQQRVSAEVQAQ---RIRELADKDPRIVALVIRQWMSND 571


>gi|319787100|ref|YP_004146575.1| flagellar M-ring protein FliF [Pseudoxanthomonas suwonensis 11-1]
 gi|317465612|gb|ADV27344.1| flagellar M-ring protein FliF [Pseudoxanthomonas suwonensis 11-1]
          Length = 573

 Score =  352 bits (902), Expect = 9e-95,   Method: Composition-based stats.
 Identities = 106/565 (18%), Positives = 217/565 (38%), Gaps = 22/565 (3%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           ++          +   R       I + +   +   F+   P Y  LY  L+       +
Sbjct: 17  EKAASAVVKLQEMQLGRKFGTLLAIALAVAAGLYIFFWSQKPAYTPLYTGLDPKATAEAT 76

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L  A I FRI    S+ISVP   +  AR+ LA  GL  S    G+EL ++   FG++ 
Sbjct: 77  DLLRAAQIPFRIDQATSAISVPEENLHDARLKLAGSGLTESG-RLGFELMERDPGFGVSQ 135

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INP 182
           F++      ALE E+ RTI ++  +  ARVH+ +P   +F +     +ASV++       
Sbjct: 136 FVENARYQHALETELVRTISTLRPVRDARVHLAIPKPSAFTRAREAASASVVLELRSGAV 195

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT--ANEMERNILGKSLSIVQAIQHE 240
                 +AI HLV++++P+L    VTV+D  G++++   N+    +       V+  +  
Sbjct: 196 LERNQVDAIVHLVSSSIPDLAPERVTVVDQNGRMISRNGNDSASELSAVQFEQVRRQETS 255

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
               I + L    G     + V  +++    +    +++ + +  RS ++S+    +   
Sbjct: 256 YNQRIRELLEPLTGSGRVNAEVTVDMDFSVTEEARELFNAEPQKLRSEQVSE--NTTAGE 313

Query: 301 QPESAVTVEQNMPH----------VSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHD 350
            P+       N P                     +      +    N+E++     T   
Sbjct: 314 GPQGIPGATSNTPPGAVAQQNADGTPAPGTVATATAAGNSSRSATRNFELDRTLQHTRQP 373

Query: 351 NYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITS 410
             ++ R++ AV+V+        G+ A Q   +  LA + ++V  A G +  RGD +++ +
Sbjct: 374 AGRIRRVTAAVLVDHVPRAGGDGKVALQPLSEQELARVQELVRQAVGFDPARGDVVSVVN 433

Query: 411 MDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAK 470
             F+      +  ++      +      +   L   +  L + F  L    R        
Sbjct: 434 APFVREDAPAAEPLKWWEDPRMRD----IARVLAGALVVLALLFGVLRPSLRQIASPAGA 489

Query: 471 KGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLR 530
           K    G++   P     ++    +    +A D++   + +    +    +S   +     
Sbjct: 490 KKSGSGEASDEPATAEVSLVEDDLDIPALAGDTAQLGLQAPGAPMALP-SSNSYEDRLRN 548

Query: 531 LLHMIEINEERFAKILRKWARSEIE 555
               +  + +R A++++ W  +E  
Sbjct: 549 AREAVRADSKRVAQVVKDWLGNEAA 573


>gi|239817137|ref|YP_002946047.1| flagellar MS-ring protein [Variovorax paradoxus S110]
 gi|239803714|gb|ACS20781.1| flagellar M-ring protein FliF [Variovorax paradoxus S110]
          Length = 560

 Score =  352 bits (902), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 115/538 (21%), Positives = 209/538 (38%), Gaps = 46/538 (8%)

Query: 39  ARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLA 98
              +  +P Y  LY  +   D   I  +L + N+ ++ ++ G +I V    V + R+ LA
Sbjct: 45  FLLWSRAPDYGVLYTNVTDRDGGAIIASLQQMNVPYKFAEGGGAILVARDRVPEVRLKLA 104

Query: 99  AQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVM 158
           +QGLP      G+EL D    FG ++F +++   R LEGE+AR+++SI  + +AR+H+ +
Sbjct: 105 SQGLPKGGG-VGFELMDN-QKFGTSNFAEQVNYQRGLEGELARSVESIGSVESARIHLAL 162

Query: 159 PDMGSFRKIGARPTASVMIRAINPSVYK--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKL 216
           P    F +   +P+ASV++              AI H+V+++VP+LD   VTV+D  G L
Sbjct: 163 PKPSLFVRDQKKPSASVILTLHRGRSIDEGQVSAIVHMVSSSVPDLDAKSVTVVDQRGNL 222

Query: 217 LTANEMERNILG-KSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           L+A       L    L   Q I+      I   L   +G  N R+ V AE++    +  E
Sbjct: 223 LSAANAGARGLDVSQLKYAQEIEQGYIRRIEAILQPLVGASNVRAQVAAEIDFSVVERTE 282

Query: 276 IVYDPDSKVERSIRLSKDAQRS---ETSQPESAVTVEQNMPHVSDRKVPLPRSLE----- 327
             Y P+     +   S+ +  S     + P        N P  +                
Sbjct: 283 ESYKPNQDPRAAAVRSQQSSESMQQGATPPGGVPGALSNQPPQTPSAPITAPPNAAAAAP 342

Query: 328 -------------NTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGR 374
                         + +K+  +NYE++            ++RLS+AVVVN     +  G+
Sbjct: 343 KAAATATAASTAPGSSRKDTTTNYELDRSIRHVQQGAGGVKRLSVAVVVNHRDTADSAGK 402

Query: 375 SADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSR 434
              +    + + +I  +V  A G +  RGD++ + +  F            + F    + 
Sbjct: 403 PGQRALTPAEIEQIRNLVKEAMGFSQERGDSLNVVNSAFAREGGDAEAGPALPFWRDPA- 461

Query: 435 HFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLM 494
           +    ++   +L+   L  F     LR L     A       ++  + P  +    T   
Sbjct: 462 NLGLAMSIAQYLLMAGLALFAWFAVLRPLLRKHLAPPAAAVPEAAPAAPGAADDDGTAAQ 521

Query: 495 PNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARS 552
            N  +      +    ++                       + +    A +++ W  S
Sbjct: 522 NNARLREIERQKADLDYAHQT-------------------ADQDPRLVATLIKHWMNS 560


>gi|51596039|ref|YP_070230.1| flagellar MS-ring protein [Yersinia pseudotuberculosis IP 32953]
 gi|51589321|emb|CAH20942.1| flagellar M-ring protein [Yersinia pseudotuberculosis IP 32953]
          Length = 570

 Score =  352 bits (902), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 127/584 (21%), Positives = 234/584 (40%), Gaps = 59/584 (10%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           ++   F  +   L     + L       I + +A   +  SP Y  LY  L   D   I 
Sbjct: 10  NRENTFTMTLARLRANPKIPLLIAAAAAIAIIVALMLWAKSPDYRVLYSNLSDRDGGDIV 69

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L++ NI +R +DNG ++ +P+  V + R+ LA QGLP   +  G+EL D+   FG++ 
Sbjct: 70  TQLTQLNIPYRFADNGGALLIPAEKVHETRLRLAQQGLPKGGA-VGFELLDQE-KFGISQ 127

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVM--IRAINP 182
           F ++I   RALEGE++RTI ++  ++  RVH+ MP    F +    PTASV   ++    
Sbjct: 128 FSEQINYQRALEGELSRTIGTLGPVLNVRVHLAMPKPSLFVREQKSPTASVTLALQPGRA 187

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQHEI 241
                  AI ++V+++V  L  G+VTV+D TG+LLT ++     +    L     +++  
Sbjct: 188 LDDGQINAIVYMVSSSVAGLPPGNVTVVDQTGRLLTQSDSAGRDLNASQLKFTSEVENRY 247

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
           +  I   LA  +G  N  + V A+++  +++  +  Y P+    +    S+    SE   
Sbjct: 248 QRRIENILAPMVGNGNVHAQVTAQVDFASREQTDEEYKPNQAANQGAVRSQQVSTSEQLG 307

Query: 302 P---ESAVTVEQNMPHVSDRKV-----------------------------PLPRSLENT 329
                       N P V+                                    ++  + 
Sbjct: 308 GTNVGGVPGALSNQPPVAPIAPIEIPQPAGAAANNAAPANAATTANANTTATAAKASSSN 367

Query: 330 DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEIN 389
            + ++ +N+E++     T      ++RLS+AVVVN                    LA++ 
Sbjct: 368 SRHDQTTNFEVDRTIRHTQQQAGMVQRLSVAVVVNYTS----DKAGKPIALSKDQLAQVE 423

Query: 390 KIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGT 449
            +   A G ++ RGDT+ + +  F  +      ++           F  ++NA  +L+  
Sbjct: 424 SLTREAMGFSTVRGDTLNVVNTPFTASDDTRGSSLPFW---QQQSFFDQLLNAGRYLLIL 480

Query: 450 LLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIF 509
           L+   L    LR +              + +     + A  T     + +AL   NQ   
Sbjct: 481 LVAWILWRKLLRPMLAKKQVADKAAASVNNIV--QTAQAAETVKQSKEELALRKKNQQRV 538

Query: 510 SHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
           S              +    R+  + + +    A ++R+W  ++
Sbjct: 539 SA-------------EVQAQRIRELADKDPRVVALVIRQWMSND 569


>gi|22126359|ref|NP_669782.1| flagellar MS-ring protein [Yersinia pestis KIM 10]
 gi|45441380|ref|NP_992919.1| flagellar MS-ring protein [Yersinia pestis biovar Microtus str.
           91001]
 gi|108807202|ref|YP_651118.1| flagellar MS-ring protein [Yersinia pestis Antiqua]
 gi|108812454|ref|YP_648221.1| flagellar MS-ring protein [Yersinia pestis Nepal516]
 gi|145598582|ref|YP_001162658.1| flagellar MS-ring protein [Yersinia pestis Pestoides F]
 gi|149366222|ref|ZP_01888257.1| flagellar M-ring protein [Yersinia pestis CA88-4125]
 gi|153947408|ref|YP_001401259.1| flagellar MS-ring protein [Yersinia pseudotuberculosis IP 31758]
 gi|162421303|ref|YP_001606485.1| flagellar MS-ring protein [Yersinia pestis Angola]
 gi|165926013|ref|ZP_02221845.1| flagellar M-ring protein FliF [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165938662|ref|ZP_02227217.1| flagellar M-ring protein FliF [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166010885|ref|ZP_02231783.1| flagellar M-ring protein FliF [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166210437|ref|ZP_02236472.1| flagellar M-ring protein FliF [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167401031|ref|ZP_02306534.1| flagellar M-ring protein FliF [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167420343|ref|ZP_02312096.1| flagellar M-ring protein FliF [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167425776|ref|ZP_02317529.1| flagellar M-ring protein FliF [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|167468921|ref|ZP_02333625.1| flagellar M-ring protein FliF [Yersinia pestis FV-1]
 gi|218928951|ref|YP_002346826.1| flagellar MS-ring protein [Yersinia pestis CO92]
 gi|229897213|ref|ZP_04512369.1| flagellar M-ring protein [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229897940|ref|ZP_04513091.1| flagellar M-ring protein [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229902829|ref|ZP_04517946.1| flagellar M-ring protein [Yersinia pestis Nepal516]
 gi|270486615|ref|ZP_06203689.1| flagellar M-ring protein FliF [Yersinia pestis KIM D27]
 gi|294504003|ref|YP_003568065.1| flagellar M-ring protein [Yersinia pestis Z176003]
 gi|21959343|gb|AAM86033.1|AE013851_5 basal-body MS (membrane and supramembrane)-ring and collar protein
           [Yersinia pestis KIM 10]
 gi|45436240|gb|AAS61796.1| flagellar M-ring protein [Yersinia pestis biovar Microtus str.
           91001]
 gi|108776102|gb|ABG18621.1| flagellar M-ring protein [Yersinia pestis Nepal516]
 gi|108779115|gb|ABG13173.1| flagellar M-ring protein [Yersinia pestis Antiqua]
 gi|115347562|emb|CAL20471.1| flagellar M-ring protein [Yersinia pestis CO92]
 gi|145210278|gb|ABP39685.1| flagellar M-ring protein [Yersinia pestis Pestoides F]
 gi|149292635|gb|EDM42709.1| flagellar M-ring protein [Yersinia pestis CA88-4125]
 gi|152958903|gb|ABS46364.1| flagellar M-ring protein FliF [Yersinia pseudotuberculosis IP
           31758]
 gi|162354118|gb|ABX88066.1| flagellar M-ring protein FliF [Yersinia pestis Angola]
 gi|165913276|gb|EDR31898.1| flagellar M-ring protein FliF [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165922217|gb|EDR39394.1| flagellar M-ring protein FliF [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165990229|gb|EDR42530.1| flagellar M-ring protein FliF [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166207617|gb|EDR52097.1| flagellar M-ring protein FliF [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166962038|gb|EDR58059.1| flagellar M-ring protein FliF [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167049420|gb|EDR60828.1| flagellar M-ring protein FliF [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167055175|gb|EDR64972.1| flagellar M-ring protein FliF [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|229680276|gb|EEO76375.1| flagellar M-ring protein [Yersinia pestis Nepal516]
 gi|229688981|gb|EEO81046.1| flagellar M-ring protein [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229693550|gb|EEO83599.1| flagellar M-ring protein [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|262361812|gb|ACY58533.1| flagellar M-ring protein [Yersinia pestis D106004]
 gi|270335119|gb|EFA45896.1| flagellar M-ring protein FliF [Yersinia pestis KIM D27]
 gi|294354462|gb|ADE64803.1| flagellar M-ring protein [Yersinia pestis Z176003]
 gi|320015431|gb|ADV99002.1| flagellar M-ring protein [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 570

 Score =  352 bits (902), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 127/584 (21%), Positives = 234/584 (40%), Gaps = 59/584 (10%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           ++   F  +   L     + L       I + +A   +  SP Y  LY  L   D   I 
Sbjct: 10  NRENTFTMTLARLRANPKIPLLIAAAAAIAIIVALMLWAKSPDYRVLYSNLSDRDGGDIV 69

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L++ NI +R +DNG ++ +P+  V + R+ LA QGLP   +  G+EL D+   FG++ 
Sbjct: 70  TQLTQLNIPYRFADNGGALLIPAEKVHETRLRLAQQGLPKGGA-VGFELLDQE-KFGISQ 127

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVM--IRAINP 182
           F ++I   RALEGE++RTI ++  ++  RVH+ MP    F +    PTASV   ++    
Sbjct: 128 FSEQINYQRALEGELSRTIGTLGPVLNVRVHLAMPKPSLFVREQKSPTASVTLALQPGRA 187

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQHEI 241
                  AI ++V+++V  L  G+VTV+D TG+LLT ++     +    L     +++  
Sbjct: 188 LDDGQINAIVYMVSSSVAGLPPGNVTVVDQTGRLLTQSDSAGRDLNASQLKFTSEVENRY 247

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
           +  I   LA  +G  N  + V A+++  +++  +  Y P+    +    S+    SE   
Sbjct: 248 QRRIENILAPMVGNGNVHAQVTAQVDFASREQTDEEYKPNQAANQGAVRSQQVSTSEQLG 307

Query: 302 P---ESAVTVEQNMPHVSDRKV-----------------------------PLPRSLENT 329
                       N P V+                                    ++  + 
Sbjct: 308 GTNVGGVPGALSNQPPVAPIAPIEIPQPAGAAANNAAPANTAATANANTTATAAKASSSN 367

Query: 330 DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEIN 389
            + ++ +N+E++     T      ++RLS+AVVVN                    LA++ 
Sbjct: 368 SRHDQTTNFEVDRTIRHTQQQAGMVQRLSVAVVVNYTS----DKAGKPIALSKDQLAQVE 423

Query: 390 KIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGT 449
            +   A G ++ RGDT+ + +  F  +      ++           F  ++NA  +L+  
Sbjct: 424 SLTREAMGFSTVRGDTLNVVNTPFTASDDTRGSSLPFW---QQQSFFDQLLNAGRYLLIL 480

Query: 450 LLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIF 509
           L+   L    LR +              + +     + A  T     + +AL   NQ   
Sbjct: 481 LVAWILWRKLLRPMLAKKQVADKAAASVNNIV--QTAQAAETVKQSKEELALRKKNQQRV 538

Query: 510 SHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
           S              +    R+  + + +    A ++R+W  ++
Sbjct: 539 SA-------------EVQAQRIRELADKDPRVVALVIRQWMSND 569


>gi|300722640|ref|YP_003711930.1| flagellar basal-body MS-ring and collar protein [Xenorhabdus
           nematophila ATCC 19061]
 gi|297629147|emb|CBJ89743.1| flagellar biosynthesis; basal-body MS(membrane and
           supramembrane)-ring and collar protein [Xenorhabdus
           nematophila ATCC 19061]
          Length = 574

 Score =  351 bits (901), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 133/592 (22%), Positives = 242/592 (40%), Gaps = 64/592 (10%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
            + +Q   F    + +     + L       I + +A   ++ SP Y  LY  L   D  
Sbjct: 6   DVENQKKGFSAIISRIKADPKVPLLVAGSAAIAIVVALFLWLRSPDYRVLYSNLSDKDGG 65

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
            I   L++ N+ +R ++NGS+I +P+  V + R+ LA QGLP   +  G+EL DK   FG
Sbjct: 66  EIVTQLTQMNVPYRFAENGSAIMIPTEKVHETRLKLAQQGLPKGGAT-GFELLDKE-KFG 123

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA-- 179
           ++ F +++   RALEGE+ART++S+  + +ARVH+ MP    F +    P+ASV +    
Sbjct: 124 ISQFSEQVNYQRALEGELARTVESLGPVQSARVHLAMPKPSLFVREQKSPSASVTVGLLQ 183

Query: 180 INPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM-ERNILGKSLSIVQAIQ 238
                     AI H+V+++V  L  G+VT++D +G+LLT ++   R++    L   Q I+
Sbjct: 184 GRVLDEGQINAIVHMVSSSVAGLPAGNVTIVDQSGRLLTQSDATGRDLNTTQLKYTQEIE 243

Query: 239 HEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE 298
           +     I   LA  +G  N  + V A+++   ++     Y P+    ++   SK +  SE
Sbjct: 244 NRFRHRIETILAPVVGRGNVHAQVTAQVDFSRREETTEEYKPNQPPNQAAVRSKQSSSSE 303

Query: 299 --------------TSQPESAVTVEQNMPHVSDRKVPLPR-------------------- 324
                         ++QP +A +     P+ +                            
Sbjct: 304 QSGGPLVGGVPGALSNQPSAAPSAPIEKPNTNANTNAKDNSDEKPDQQQRNGNNRNNSYE 363

Query: 325 ---SLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKI 381
              S  + ++ +E +NYE++     T      +ERLS+AVVVN   +    G    +  +
Sbjct: 364 RMVSNNHNNRYDETTNYEVDRTIRHTQLQAGAVERLSVAVVVNYTMVQGENGPET-KPLM 422

Query: 382 DSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVIN 441
              LA+I  +   A G ++ RGD++ +T+  F +                          
Sbjct: 423 PEQLAQIEALTREAIGFSTDRGDSLNVTNTPFNDTTEVIEALPFWQHP------------ 470

Query: 442 ALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIAL 501
                   L         L          +  +  +         +A+          A 
Sbjct: 471 ------VLLDKLLDAGRWLLLALAAWLLWRKMIVPQIAKKRAAEKAALDAQKNQQKRSAE 524

Query: 502 DSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
            ++  D     +  + R+N+ +  Q   R+  + E +    A ++R+W  +E
Sbjct: 525 TNAEMDEKMRRQMARQRVNAELQSQ---RIRELAEKDPRVVALVIRQWMSNE 573


>gi|118581826|ref|YP_903076.1| flagellar M-ring protein FliF [Pelobacter propionicus DSM 2379]
 gi|118504536|gb|ABL01019.1| flagellar M-ring protein FliF [Pelobacter propionicus DSM 2379]
          Length = 528

 Score =  351 bits (901), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 120/561 (21%), Positives = 224/561 (39%), Gaps = 49/561 (8%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           + L +  +   +L   + +++A V ++ +  F    F  N   Y  L+  L   D   I 
Sbjct: 3   EGLQRLIEPFMALSPGKRMLIAGVAILSVAAFAVLIFVANRVDYRPLFTNLSTEDAAEIV 62

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L +    ++I+ +G  I VP+ +V + R+ LA++GLP      G+E+FD+ N FG+T 
Sbjct: 63  KKLKDNKTPYQITADGKGIMVPADLVYEQRLALASEGLPQGGG-VGFEIFDRKN-FGMTE 120

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSV 184
           F+Q+I   RAL+GE++RTI  ++G+  AR+H+V+P+   F++     TAS++++  +   
Sbjct: 121 FVQKINYQRALQGELSRTISQLNGVEQARIHLVIPEKSLFKENEKPSTASIVLKMKSGRS 180

Query: 185 YKS--AEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT----ANEMERNILGKSLSIVQAIQ 238
            +    + I HLVA+++  ++   VTVLDS GK+L       +             +  +
Sbjct: 181 LRQNEVQGIVHLVASSIEGMEADQVTVLDSRGKVLNKGGGDPDPTSKATSVMQETQRIYE 240

Query: 239 HEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE 298
             +E  I   L   +G     + V A  +    +  E  +DP+S   RS + S++   + 
Sbjct: 241 KNVEERIQSMLDPVVGSGRAIARVSALFDFKQVERLEEKFDPESIAVRSEQRSEEK-GAT 299

Query: 299 TSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLS 358
                    V+ N+                  K +E  NYE++  +         L RLS
Sbjct: 300 AVNAAGVPGVQTNLGRTGAGGATQAGGAA---KNDETLNYEVSRTTAKIIEPVGALSRLS 356

Query: 359 IAVVVNKGRLTEV------LGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMD 412
           +AV+V+                     +    L +I  +V +A G N+ RGD + I ++ 
Sbjct: 357 VAVLVDGKYALPTAVKDGQTATPKYIPRSPEELQKIEALVKSAVGFNAERGDQLAIQNIP 416

Query: 413 FLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKG 472
           F +     +   Q  +    +  F ++   L+  +G + +    +  L     I      
Sbjct: 417 FQDTGELGNIETQKWWN---NPFFMSLFKNLLIGLGFMALIIFVIRPLLVSLKIVRPSAR 473

Query: 473 EVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLL 532
           E                                    S       R    +       L+
Sbjct: 474 E----------------------------SIETVHEISDKLTSAERAQISMQMAEQQNLI 505

Query: 533 HMIEINEERFAKILRKWARSE 553
              + +  + A+IL+ W   +
Sbjct: 506 DTAKKDPYQVAQILQNWIGED 526


>gi|260598447|ref|YP_003211018.1| flagellar MS-ring protein [Cronobacter turicensis z3032]
 gi|260217624|emb|CBA31913.1| Flagellar M-ring protein [Cronobacter turicensis z3032]
          Length = 571

 Score =  351 bits (901), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 130/582 (22%), Positives = 232/582 (39%), Gaps = 63/582 (10%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +   P Y  LY  L   D   I   L++ 
Sbjct: 15  VEWLNRLRANPKIPLMVAGAAAVAIIVALVLWAKQPEYRVLYSNLSDQDGGAIVTQLTQM 74

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +  +DNG+SI VP+  V   R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 75  NIPYNFADNGASIMVPAEKVYDLRLRLAQQGLPKGGA-VGFELMDQE-KFGISQFSEQVN 132

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVM--IRAINPSVYKSA 188
             RALEGE+ARTI+++  + +ARVH+ MP    F +    P+ASV   ++          
Sbjct: 133 YQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTLSLQPGRTLDDGQV 192

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQHEIEMNINK 247
            A+ H+V++AV  L  G+VT++D  G+LLT +      +    L     ++  I+  I  
Sbjct: 193 AAVVHMVSSAVAGLPPGNVTLVDQAGRLLTQSGTGARDLNDAQLKYASDVEGRIQRRIES 252

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRS---ETSQPES 304
            LA  +G  N  + V A+++   ++  E  Y P+S   +    S+    +       P  
Sbjct: 253 ILAPIVGSGNVHAQVTAQIDFSNKEQTEEQYRPNSDPSQMAVRSRQLNTNDQVGAGNPGG 312

Query: 305 AVTVEQNMPHV--------------------------------SDRKVPLPRSLENTDKK 332
                 N P                                           S  ++ ++
Sbjct: 313 VPGALSNQPAPANSAPIDAPAGQNANGQNANGQNANGQNAQRTQSTSTTGASSGPHSSQR 372

Query: 333 EEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIV 392
           +E +NYE++     T  +   ++RLS+AVVVN  +L    G           L +I  + 
Sbjct: 373 DETTNYEVDRTIRHTKMNVGDVQRLSVAVVVNYRQL----GNGKPLALTADQLKQIEDLT 428

Query: 393 SAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLV 452
             A G + +RGDT+ + +  F  +    +                 +++A  +LV  ++ 
Sbjct: 429 REAMGYSDKRGDTLNVVNSPFTASDEAGAELP----FWKQQAFIDQLLSAGRWLVVLIVA 484

Query: 453 TFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHS 512
             L   A+R        +   V              +       +       ++D  +  
Sbjct: 485 WLLWRKAVRPQLQRRAEEVKRV------------QEIQQQRQEVEESVEVRLSKDEQTQQ 532

Query: 513 RNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
           R    R+++ V  Q   R+  M + +    A ++R+W  +E+
Sbjct: 533 RRANQRLSAEVMSQ---RIREMSDNDPRVVALVIRQWMSNEL 571


>gi|241763655|ref|ZP_04761705.1| flagellar M-ring protein FliF [Acidovorax delafieldii 2AN]
 gi|241367130|gb|EER61496.1| flagellar M-ring protein FliF [Acidovorax delafieldii 2AN]
          Length = 561

 Score =  351 bits (901), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 128/566 (22%), Positives = 225/566 (39%), Gaps = 45/566 (7%)

Query: 10  FFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSE 69
           + +  ++L R++ + L   + + + + +AA      P Y  L+  L   D   I   LS+
Sbjct: 17  WLQRLSTLDRSQRMRLGVGVALLVAVAIAAIVLGRQPDYRVLFANLSDKDGGAIVAQLSQ 76

Query: 70  ANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEI 129
            N+ ++ +D G +I +PS  V   R+ LA QGLP   S +G+EL  + N FG+T F + +
Sbjct: 77  MNVPYKYADGGGAILIPSDRVHDVRLRLATQGLPK-GSVAGFELM-ESNRFGITQFQERL 134

Query: 130 TRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVM--IRAINPSVYKS 187
              R LEGE+ R+IQ++S +  ARVH+ +P+   F +   +P+ASV+  +          
Sbjct: 135 NFQRGLEGELTRSIQALSSVQGARVHLALPNQNGFFREQQKPSASVLVSLHPGRILDRAQ 194

Query: 188 AEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM---ERNILGKSLSIVQAIQHEIEMN 244
              I HLVA++VP L    V+VLD TGKLL+ +        +  + L  VQ I+ +    
Sbjct: 195 LAGIVHLVASSVPELAPSAVSVLDDTGKLLSQSPDTAAGTGVDAQQLLYVQQIEQQYTRR 254

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ--- 301
           I   L   +G +N ++ V AE++    +     + P+   + S   S+    S   Q   
Sbjct: 255 IMDILEPVVGRNNVKAQVSAEVDFSQTESTSEQHRPNQSPDASAVRSQQVVESNGPQGNP 314

Query: 302 -PESAVTVEQNMPHVSDRKVPLPRSLENT-------------DKKEEQSNYEINTKSIAT 347
            P        N P  +        +   T              K+E   NYE++     T
Sbjct: 315 LPTGVPGAASNQPPAASTAPINGANPAPTAAGGQQQGALGAGSKRESVINYEVDKTVRVT 374

Query: 348 THDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTIT 407
              +  ++RL+ AVVVN     +  G++  +      L ++  +V    G N  RGD++ 
Sbjct: 375 RGGSGAVKRLTAAVVVNYQSAED-KGKTVAKALTPEQLEQMTALVRETIGFNKERGDSVN 433

Query: 408 ITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNID 467
           + +  F  +    +        ++L    +        L   L++  L   AL+      
Sbjct: 434 LMNTPFQVDVTPANDVPLWKQPEMLELAKSFAWPVGAVLFAALVLLGLVRPALK------ 487

Query: 468 DAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQS 527
                               A+       D +  +   +            +     +  
Sbjct: 488 --------------GQERPRAIAVAGGSIDALEAEQPERPALPAPAKKDELLPVTPEQLR 533

Query: 528 DLRLLHMIEINEERFAKILRKWARSE 553
                 + + N    A IL+ W   E
Sbjct: 534 LEEARMLAKENPMAVANILKTWVNGE 559


>gi|186895144|ref|YP_001872256.1| flagellar MS-ring protein [Yersinia pseudotuberculosis PB1/+]
 gi|186698170|gb|ACC88799.1| flagellar M-ring protein FliF [Yersinia pseudotuberculosis PB1/+]
          Length = 570

 Score =  351 bits (901), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 128/584 (21%), Positives = 236/584 (40%), Gaps = 59/584 (10%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           ++   F  +   L     + L       I + +A   +  SP Y  LY  L   D   I 
Sbjct: 10  NRENTFTMTLARLRANPKIPLLIAAAAAIAIIVALMLWAKSPDYRVLYSNLSDRDGGDIV 69

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L++ NI +R +DNG ++ +P+  V + R+ LA QGLP   +  G+EL D+   FG++ 
Sbjct: 70  TQLTQLNIPYRFADNGGALLIPAEKVHETRLRLAQQGLPKGGA-VGFELLDQE-KFGISQ 127

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVM--IRAINP 182
           F ++I   RALEGE++RTI ++  ++  RVH+ MP    F +    PTASV   ++    
Sbjct: 128 FSEQINYQRALEGELSRTIGTLGPVLNVRVHLAMPKPSLFVREQKSPTASVTLALQPGRA 187

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQHEI 241
                  AI ++V+++V  L  G+VTV+D TG+LLT ++     +    L     +++  
Sbjct: 188 LDDGQINAIVYMVSSSVAGLPPGNVTVVDQTGRLLTQSDSAGRDLNASQLKFTSEVENRY 247

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
           +  I   LA  +G  N  + V A+++  +++  +  Y P+    +    S+    SE   
Sbjct: 248 QRRIENILAPMVGNGNVHAQVTAQVDFASREQTDEEYKPNQAANQGAVRSQQVSTSEQLG 307

Query: 302 P---ESAVTVEQNMPHVSDRKV-----------------------------PLPRSLENT 329
                       N P V+                                    ++  + 
Sbjct: 308 GTNVGGVPGALSNQPPVAPIAPIEIPQPAGAAANNAAPANAATTANANTTATAAKASSSN 367

Query: 330 DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEIN 389
            + ++ +N+E++     T      ++RLS+AVVVN                    LA++ 
Sbjct: 368 SRHDQTTNFEVDRTIRHTQQQAGMVQRLSVAVVVNYTS----DKAGKPIALSKDQLAQVE 423

Query: 390 KIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGT 449
            +   A G ++ RGDT+ + +  F  +      ++           F  ++NA  +L+  
Sbjct: 424 SLTREAMGFSTVRGDTLNVVNTPFTASDDTRGSSLPFW---QQQSFFDQLLNAGRYLLIL 480

Query: 450 LLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIF 509
           L+   L    LR +         +    S+ +    + A  T     + +AL   NQ   
Sbjct: 481 LVAWILWRKLLRPMLAKKQV--ADNAAASVNNIVQTAQAAETVKQSKEELALRKKNQQRV 538

Query: 510 SHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
           S              +    R+  + + +    A ++R+W  ++
Sbjct: 539 SA-------------EVQAQRIRELADKDPRVVALVIRQWMSND 569


>gi|288549808|ref|ZP_05968261.2| flagellar M-ring protein FliF [Enterobacter cancerogenus ATCC
           35316]
 gi|288317495|gb|EFC56433.1| flagellar M-ring protein FliF [Enterobacter cancerogenus ATCC
           35316]
          Length = 543

 Score =  351 bits (901), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 123/543 (22%), Positives = 223/543 (41%), Gaps = 51/543 (9%)

Query: 39  ARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLA 98
              +  SP Y  LY  L   D   I   L++ NI +R +DNG ++ VP+  V + R+ LA
Sbjct: 26  MVLWAKSPDYRTLYSNLSDQDGGAIVTQLTQMNIPYRFADNGGALEVPADKVHELRLRLA 85

Query: 99  AQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVM 158
            QGLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI+++  + +ARVH+ M
Sbjct: 86  QQGLPKGGA-VGFELLDQE-KFGISQFSEQVNYQRALEGELARTIETLGPVKSARVHLAM 143

Query: 159 PDMGSFRKIGARPTASVM--IRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKL 216
           P    F +    P+ASV   +            A+ HLV++AV  L  G+VT++D +G L
Sbjct: 144 PKPSLFVREQKSPSASVTVNLEPGRALDEGQISAVTHLVSSAVAGLPPGNVTLVDQSGHL 203

Query: 217 LTANEMERN-ILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           LT +      +    L     ++  ++  I   L   +G  N  + V A+++   ++  E
Sbjct: 204 LTQSNSAGRDLNDAQLKYAADVEGRLQRRIEAILGPVVGSSNVHAQVTAQIDFANKEQTE 263

Query: 276 IVYDPDSKVERSIRLSK---DAQRSETSQPESAVTVEQNMPHVSDRKV------------ 320
             Y P+    +++  S+   + ++     P        N P  ++               
Sbjct: 264 EQYSPNGNPSQAVMRSRQVNENEQVGGPYPGGVPGALSNQPAPANAAPITTPAANQQNGQ 323

Query: 321 --------PLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVL 372
                       S   T  + E +NYE++     T  +   ++RLS+AVVVN   L +  
Sbjct: 324 QNNAQTTSTAASSGPRTSSRNETTNYEVDRTIRHTKLNVGDVQRLSVAVVVNYKTLPDGK 383

Query: 373 GRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDIL 432
                       + +I  +   A G + +RGDT+ + +  F                   
Sbjct: 384 ----PLPLTTEQMKQIEDLTREAMGYSEKRGDTLNVVNSPFSSVDETGGELP----FWQQ 435

Query: 433 SRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTG 492
                 +++A  +L+  ++   L    +R         +     +  ++      AV   
Sbjct: 436 QAFIDQLMSAGRWLLVLIVAWLLWRKGVRPQLQRRAEAERAAQ-EQQVTRQDTEEAVEVR 494

Query: 493 LMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARS 552
           L  ++ I    +NQ + +   +               R+  M + +    A ++R+W  +
Sbjct: 495 LSKDEQIQQRRANQRMGAEVMS--------------QRIREMSDNDPRVVALVIRQWMGN 540

Query: 553 EIE 555
           E E
Sbjct: 541 EHE 543


>gi|318605263|emb|CBY26761.1| flagellar M-ring protein FliF [Yersinia enterocolitica subsp.
           palearctica Y11]
          Length = 559

 Score =  351 bits (900), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 116/538 (21%), Positives = 219/538 (40%), Gaps = 48/538 (8%)

Query: 40  RFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAA 99
             +  SP Y  LY  L   D   I   L++ NI +R +DNG ++ +P+  V + R+ LA 
Sbjct: 45  MLWAKSPDYRVLYSNLNDRDGGDIVTQLTQLNIPYRFADNGGALLIPADKVHETRLRLAQ 104

Query: 100 QGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMP 159
           QGLP   +  G+EL D+   FG++ F +++   RALEGE+ARTI ++  ++  RVH+ MP
Sbjct: 105 QGLPKGGA-VGFELLDQE-KFGISQFSEQVNYQRALEGELARTIGTLGPVLNVRVHLAMP 162

Query: 160 DMGSFRKIGARPTASVM--IRAINPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL 217
               F +    PTASV   ++           AI ++V+++V  L   +VTV++ TG+LL
Sbjct: 163 KPSLFVREQKSPTASVTLALQPGRALDDGQINAIVYMVSSSVAGLPPANVTVVNQTGRLL 222

Query: 218 TANEMERN-ILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREI 276
           T ++     +    L     +++  +  I   LA  +G  N  + V A+++  +++  + 
Sbjct: 223 TQSDSAGRDLNAAQLKFTNEVENRFQRRIETILAPMVGSGNVHAQVTAQVDFASREQTDE 282

Query: 277 VYDPDSKVERSIRLSKDAQRSETSQP---ESAVTVEQNMPHVSDRKV------------- 320
            Y P+    +    S+    SE               N P  +                 
Sbjct: 283 EYKPNQAANQGAVRSQQVSTSEQLGGTNVGGVPGALSNQPSATPVAPIEVPQATPAAGAG 342

Query: 321 -----PLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRS 375
                    +  +  + ++ +N+E++     T      ++RLS+AVVVN G         
Sbjct: 343 AAANAAKQTATSSNSRHDQTTNFEVDRTIRHTQQQAGMVQRLSVAVVVNYGS----DKAG 398

Query: 376 ADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRH 435
                    LA++  +   A G ++ RGDT+ + +  F      +   +           
Sbjct: 399 KPIALSKDQLAQVESLTREAMGFSTVRGDTLNVVNTPFNATDDASGSNLPFWQQPS---F 455

Query: 436 FATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMP 495
           F  ++N   +L+  L+   L    +R L              + +     ++        
Sbjct: 456 FDQLLNIGRYLLILLVAWILWRKLVRPLIAKKQEADKAAASVNNIVQAAQTTETAKQTKE 515

Query: 496 NDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
                         +  +  Q R+++ V  Q   R+  + + +    A ++R+W  ++
Sbjct: 516 E------------LALRKKNQQRVSAEVQAQ---RIRELADKDPRIVALVIRQWMSND 558


>gi|2832233|gb|AAC01568.1| M-ring [Brucella abortus]
          Length = 540

 Score =  351 bits (900), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 194/507 (38%), Positives = 293/507 (57%), Gaps = 3/507 (0%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
                + Q   +   LG  +++ L  V    +   +    ++  P Y+ LYV L   DVN
Sbjct: 9   NFQQLIEQLKGTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYVGLSRDDVN 68

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
           R+ +AL EA I F +   GSSI VP      AR++LA +GLP+S+ N+GYELFD + S G
Sbjct: 69  RMGLALGEAGIPFDVKSYGSSILVPIGKAENARMYLAEKGLPTSN-NAGYELFDNMGSLG 127

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN 181
           LTSFMQEITRVRALEGEIARTIQ+I G+ AARVHIV+ + GSFR+   +P+ASV+IRA  
Sbjct: 128 LTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSASVVIRAEG 187

Query: 182 PSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILG-KSLSIVQAIQHE 240
               +SA++IR LVAAAVP+LD   VTVLD+ G LL +     N     + S+ Q +   
Sbjct: 188 GFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASLEQQVASH 247

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           ++ +I KALA +LG+ +F+++V A L+ D +Q +E  YDP+S+VERS+R+ +++  S  +
Sbjct: 248 VDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRESGDSRNN 307

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           + ++A  VEQN+P    +      S E TD++EE +NYE+N+K+++T  D Y ++RLSIA
Sbjct: 308 RNDNATGVEQNIPQEQIQNRNGESSTEKTDRREELTNYEVNSKTVSTVSDGYSIKRLSIA 367

Query: 361 VVVNKGRLTEVLGRSADQG-KIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           VV+++ RL +  G +      +D  + +I  +V+ A G+N+ RGD I +T+++FL+    
Sbjct: 368 VVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVNFLDPAGA 427

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
           +   V   + D L R   +  NAL  L    L+ + GL  L R  N+  A       ++ 
Sbjct: 428 DMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTEVAIREAG 487

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQ 506
               P        +       +     
Sbjct: 488 EVATPNFIGGAESVGEGVQAVIGGPAA 514


>gi|21231374|ref|NP_637291.1| flagellar MS-ring protein [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66768573|ref|YP_243335.1| flagellar MS-ring protein [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188991617|ref|YP_001903627.1| flagellar MS-ring protein [Xanthomonas campestris pv. campestris
           str. B100]
 gi|21113037|gb|AAM41215.1| flagellar protein [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66573905|gb|AAY49315.1| flagellar protein [Xanthomonas campestris pv. campestris str. 8004]
 gi|167733377|emb|CAP51578.1| Flagellar biosynthesis lipoprotein FliF [Xanthomonas campestris pv.
           campestris]
          Length = 573

 Score =  351 bits (900), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 116/567 (20%), Positives = 230/567 (40%), Gaps = 27/567 (4%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           ++  Q+F    S+  TR L + ++I + +   +A  F+   P Y  LY  L+       +
Sbjct: 15  EKAGQWFDRIRSMQITRKLTMMAMIALAVAAGLAVFFWSQKPGYQALYTGLDDKGNAEAA 74

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L  A I F+I  +  +ISVP   +  AR+ LA  GL    +  G+EL +K   FG++ 
Sbjct: 75  DLLRTAQIPFKIDQSTGAISVPQDRLYDARLKLAGSGLTGQQTGGGFELMEKDPGFGVSQ 134

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INP 182
           F++      ALE E++RTI ++  +  ARVH+ +P   +F +     +ASV++       
Sbjct: 135 FVENARYQHALETELSRTIGTLRPVREARVHLAIPKPSAFTRQRDVASASVVLELRGGQG 194

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL--GKSLSIVQAIQHE 240
                 +AI +LVA+++P++    VTV+D +G++L+  +   +          V+  +  
Sbjct: 195 LERNQVDAIVNLVASSIPDMTPERVTVVDQSGRMLSIADPNSDAAQHAAQFEQVRRQESS 254

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
               I + L    G       V  +++    +    +Y+ +    RS ++S     +  +
Sbjct: 255 YNQRIRELLEPMTGAGRVNPEVSVDMDFSVVEEARELYNGEPAKLRSEQVS--DSSTSAT 312

Query: 301 QPESAVTVEQN-------------MPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIAT 347
            P+       N              P           +      K    NYE++     T
Sbjct: 313 GPQGPPGATSNSPGQPPAPAATAGAPGAPAAGQAATPAAPTESSKSATRNYELDRTLQHT 372

Query: 348 THDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTIT 407
                +++R+S+AV+++        G+  +Q    + L  I  +V  A G ++ RGDT++
Sbjct: 373 RQPAGRIKRVSVAVLLDNVPRPGAKGKIVEQPLTAAELTRIEGLVKQAVGFDAARGDTVS 432

Query: 408 ITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNID 467
           + +  F+   +      +      +       +  LV  V  L + F  +    R     
Sbjct: 433 VMNAPFVREAVAGEEGPKWWEDPRVQN----GLRLLVGAVVVLALLFGVVRPTLRQLTGT 488

Query: 468 DAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQS 527
            A K +         P         ++  D+  +    +D     ++ +  I    + + 
Sbjct: 489 AAVKEKHKKGGNDGTPQS---ADVRMVDEDDDLMPRLEEDTAQIGQDKKLPIALPDAYEE 545

Query: 528 DLRL-LHMIEINEERFAKILRKWARSE 553
            +RL    ++ + +R A++++ W  SE
Sbjct: 546 RVRLAREAVKADSKRVAQVVKGWVASE 572


>gi|319406987|emb|CBI80624.1| Flagellar M-ring protein [Bartonella sp. 1-1C]
          Length = 554

 Score =  351 bits (900), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 201/548 (36%), Positives = 311/548 (56%), Gaps = 11/548 (2%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           L     +   LG  R++ L  V L      + + F++  P Y+ LYV L   DVNR+ +A
Sbjct: 9   LSSSGNALHKLGVKRLIALGMVGLTLFGTILFSSFYLTRPIYETLYVGLSRDDVNRMGMA 68

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           LSEA I F +S +G ++ VP     +AR+ LA +GLP+S+ N+GYELFD + S GLTSFM
Sbjct: 69  LSEAGIAFDVSSDGGTVQVPVGQAEQARMFLAEKGLPTSN-NAGYELFDNMGSLGLTSFM 127

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           QEITR RALEGEIARTIQ + G+ AARVHIV+PD GSFRK   +PTASV+IR  +    +
Sbjct: 128 QEITRQRALEGEIARTIQVVQGVKAARVHIVLPDKGSFRKANQKPTASVVIRTNSSFSVE 187

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLS-IVQAIQHEIEMNI 245
            A++IR LVAAAVP+L+   VTV+D+ G+LL +     N     ++ + Q +  +I+ NI
Sbjct: 188 FAQSIRQLVAAAVPSLEASSVTVMDTRGQLLASGVDAMNGASMMMASLEQQVASQIDANI 247

Query: 246 NKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESA 305
            K L  +LG+D+F+++V   L+ D +Q  E V+DP+S+V RS+R  +D   S+ ++   A
Sbjct: 248 RKQLVPYLGLDHFQTSVQVVLDTDRRQTNETVFDPESQVVRSVRSVRDQADSQNNRNSDA 307

Query: 306 VTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNK 365
           V VEQN+P          RS +  D++EE +NYEIN+K+I+T  D Y +++L++A+VV++
Sbjct: 308 VGVEQNIPQEEIANGGGERSTDKKDRREEITNYEINSKTISTVSDGYSVKKLAVAIVVDR 367

Query: 366 GRLTEVLG-RSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTV 424
            RL    G +   +  ++  +  I ++V+ A G++ +RGD I +T++DF+ N   +   +
Sbjct: 368 ARLVLPDGTKPTSENALNDEVNRIQQMVATAAGLDPKRGDIINVTAVDFVGNSEADMAPI 427

Query: 425 QVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPP 484
           Q      LSR+ + +IN +  ++   L+ FLG+  L R                      
Sbjct: 428 QEPLWKSLSRYTSGLINGVALVIAVFLILFLGVRPLMREMREGKKALENSANAVAGLGNI 487

Query: 485 ISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAK 544
            +                ++N        +  S + + +      RL  MI ++EERFA 
Sbjct: 488 PALEHQYQDNAEFGGVTGTNN--------DTLSNLRNRMRVPPQNRLEQMIAMDEERFAG 539

Query: 545 ILRKWARS 552
           +LR+W   
Sbjct: 540 VLREWVHD 547


>gi|319409176|emb|CBI82820.1| Flagellar M-ring protein [Bartonella schoenbuchensis R1]
          Length = 555

 Score =  351 bits (899), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 211/552 (38%), Positives = 323/552 (58%), Gaps = 11/552 (1%)

Query: 3   ILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNR 62
           +L  L    ++   LG  R++ L  V +      + + F++  P Y+ LY+ L   DVNR
Sbjct: 5   LLAFLSSSGQALQKLGVKRLVALGLVGITLFGTILFSSFYLTRPSYETLYIGLSRDDVNR 64

Query: 63  ISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGL 122
           + VAL E  I F +S +GSSI VP     KAR+ LA +GLP+S+ N+GYELFD + S GL
Sbjct: 65  MGVALGETGIAFDVSSDGSSIQVPVGQAEKARMFLAEKGLPTSN-NAGYELFDNMGSLGL 123

Query: 123 TSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP 182
           TSFMQEITR RALEGEIARTIQ + G+ AARVHIV+PD GSFRK   +PTASV+IR    
Sbjct: 124 TSFMQEITRQRALEGEIARTIQVVQGVKAARVHIVLPDKGSFRKANQKPTASVVIRTDGG 183

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLS-IVQAIQHEI 241
              +SA++IR LV+AAVP+L+   VTV+D+ G+LL +     N     ++ + Q +  +I
Sbjct: 184 FSAESAQSIRQLVSAAVPSLEASSVTVMDTRGQLLASGVDAANGASVRMALLEQQVASQI 243

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
           + NI K L  +LG+D+F+++V  +L+ + QQI E V+DP+S+V RS+R  +D   S+ S+
Sbjct: 244 DANIRKQLVPYLGLDHFQTSVQVDLDTNRQQINETVFDPESQVVRSVRSVRDQADSQNSR 303

Query: 302 PESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAV 361
              AV VEQN+P          RS +  D++EE +NYEIN+K I+T  D Y +++L++A+
Sbjct: 304 NNDAVGVEQNIPQEEIANGGGERSTDKKDRREETTNYEINSKIISTVKDGYSVKKLAVAI 363

Query: 362 VVNKGRLTEVLGRSAD-QGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN 420
           VV++ RL    G + D +  I+  +  I ++V+ A G++ +RGD I +T++DF+     +
Sbjct: 364 VVDRARLALAKGNNGDSESFINDEINRIQQMVATAAGLDPKRGDVINVTAVDFMGYSDKD 423

Query: 421 SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL 480
              +Q      LS + +T +N L  +V  LL+ FLG+  L R            G K++ 
Sbjct: 424 LTPMQTPIWKSLSPYLSTFVNGLALVVAVLLILFLGVRPLMREMR--------EGQKALD 475

Query: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540
           +     + +       +   ++     I     +  + + S +      RL  MIEI+E+
Sbjct: 476 NEQNALAGLQDVPALENQSNINGEFGGIAGAKDDTLNDLRSRMRVAPQNRLEKMIEIDEQ 535

Query: 541 RFAKILRKWARS 552
           RFA++LR+W   
Sbjct: 536 RFAEVLREWVND 547


>gi|330502763|ref|YP_004379632.1| flagellar MS-ring protein [Pseudomonas mendocina NK-01]
 gi|328917049|gb|AEB57880.1| flagellar MS-ring protein [Pseudomonas mendocina NK-01]
          Length = 594

 Score =  351 bits (899), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 119/586 (20%), Positives = 232/586 (39%), Gaps = 55/586 (9%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
           L F ++   +   R L L   +   + +  A   +   P Y  LY  L   D  ++   L
Sbjct: 25  LSFLENLAEMSVLRQLGLLVGLAASVAIGFAVVLWSQQPDYRPLYGSLNGMDATQVVETL 84

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           + + ID+ I  N  ++ V +  + +AR+ LAA G   + ++ G+E+ D+    G + FM+
Sbjct: 85  TASGIDYTIEPNSGALLVKADDLARARMRLAAAGAAPTDTSVGFEILDREQGLGTSQFME 144

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN--PSVY 185
                R LEGE+ART+ S++ + AARVH+ MP    F +   +P+ASV++          
Sbjct: 145 ATRYRRGLEGELARTVASLNNVKAARVHLAMPKASVFVRDERKPSASVLVELYPGRALEP 204

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM--ERNILGKSLSIVQAIQHEIEM 243
               AI +LVA +VP LD G VTV+D  G LL+  +   E  + GK     + ++     
Sbjct: 205 SQVMAIVNLVATSVPELDKGQVTVVDQKGNLLSDQQELSELTMAGKQFDYTRRMEGLFTQ 264

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            ++  L   LG   +++ V A+++  + +    +++PD    RS +   + ++S +  P+
Sbjct: 265 RVHNILQPVLGTGRYKAEVSADVDFSSVESTSEMFNPDQPALRSEQQVNEQRQS-SLPPQ 323

Query: 304 SAVTVEQNMP----------------------------------HVSDRKVPLPRSLENT 329
                  N P                                         P+       
Sbjct: 324 GVPGALSNQPPGPAAAPQQAAGAAAPAGPVAAGQPLVDANGQQIMDPATGQPMLAPYPAD 383

Query: 330 DKKEEQSNYEINTKSIATTHDNYKLERLS-IAVVVNKGRLTEVLGRSADQGKIDSYLAEI 388
            +++   N+E++     T     +L RLS   VV ++ R+    G +         LA  
Sbjct: 384 KREQSTRNFELDRSISYTRQQQGRLRRLSVAVVVDDQVRVDPATGETTRVPWTADDLARF 443

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
            ++V  + G ++ RGD++++ +  F  +       +           F  ++  ++ ++ 
Sbjct: 444 TRLVQDSVGFDASRGDSVSVINTAFTASLGEEIPDIPF----YTQPWFWDIVKQVLGVLF 499

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
            L++ F  L  +          K   G            A   G + +D ++L      +
Sbjct: 500 ILVLVFGVLRPVLNNITGGGRGKDLAGSG---DVELGEMAGLDGELSDDRVSLGGPQSIM 556

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEI 554
                       S         +  ++  +  R A+++++W  S+ 
Sbjct: 557 LPSP--------SEGYDAQLNAIKSLVAEDPGRVAQVVKEWINSDE 594


>gi|269139487|ref|YP_003296188.1| flagellar biosynthesis/type III secretory pathway lipoprotein
           [Edwardsiella tarda EIB202]
 gi|267985148|gb|ACY84977.1| flagellar biosynthesis/type III secretory pathway lipoprotein
           [Edwardsiella tarda EIB202]
 gi|304559376|gb|ADM42040.1| Flagellar M-ring protein FliF [Edwardsiella tarda FL6-60]
          Length = 572

 Score =  351 bits (899), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 122/581 (20%), Positives = 222/581 (38%), Gaps = 59/581 (10%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
                    +     + L     V I + +    +  +P Y  LY  +   D   I   L
Sbjct: 18  NSIKAILERVRANPKIPLLLASAVAIAIVVVLALWARAPDYRVLYSNISDRDGGAIVTQL 77

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
           ++ NI +R ++NG+++ VP+  V   R+ LA QGLP   +  G+EL D+   FG++ F +
Sbjct: 78  TQMNIPYRFANNGATLMVPADKVYDTRLKLAQQGLPKGGA-VGFELLDQE-KFGISQFSE 135

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIR--AINPSVY 185
           +I   RALEGE+ARTI+++  +V+ARVH+ MP    F +   +P+ASV +          
Sbjct: 136 QINYQRALEGELARTIETLGPVVSARVHLAMPKPSLFVREQKQPSASVTLTLEPGRALDD 195

Query: 186 KSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM-ERNILGKSLSIVQAIQHEIEMN 244
               AI ++V+++V  L  G+VTV+D  G LLT  +   R++    L     ++  ++  
Sbjct: 196 GQINAIVYMVSSSVAGLPPGNVTVVDQFGHLLTQPDGTGRDLNAAQLKFTSEVEGRLQRR 255

Query: 245 INKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRL---SKDAQRSETSQ 301
           I   L   LG  N  + V A+L+  +++  +  Y P+    ++         + +S    
Sbjct: 256 IETILQPMLGSGNVHAQVTAQLDFASREQTDEEYKPNQLPNQAAIRSQQISQSDQSGGQL 315

Query: 302 PESAVTVEQNMPHVSDRKVPLP---------------------------RSLENTDKKEE 334
                    N P                                      S     +++E
Sbjct: 316 NGGVPGALSNEPAPPATGNIDKPRSAQGTAGRNTPTPSRSSAISNNGRLTSRNENIRRDE 375

Query: 335 QSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSA 394
            +NYE++     T      +ERLS+AVVVN         +  +       + +IN +V  
Sbjct: 376 TTNYEVDRTIRHTQARAGNIERLSVAVVVNYAT----DTKGKEIALSQEKMDQINNLVRE 431

Query: 395 ATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTF 454
           A G +  RGDT+++ +  F   +                     +     +L+  L+   
Sbjct: 432 AMGFSQSRGDTLSVVNTPFNSVEDNGGELP----FWQKQSFIDLLTTLGRYLLVALVAWL 487

Query: 455 LGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRN 514
           L    ++ +             +    P  +  A                 Q      + 
Sbjct: 488 LWRKLVKPMLTKQQRAAAAAQQRVDAPPLSVQPA----------------KQPSNEELQQ 531

Query: 515 LQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSEIE 555
            +       ++    R+  M E +    A ++R+W  +E +
Sbjct: 532 RRKLQQRSTAEAQTERVREMAEQDPRVVALVIRQWMSTEQQ 572


>gi|253998468|ref|YP_003050531.1| flagellar M-ring protein FliF [Methylovorus sp. SIP3-4]
 gi|253985147|gb|ACT50004.1| flagellar M-ring protein FliF [Methylovorus sp. SIP3-4]
          Length = 576

 Score =  351 bits (899), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 119/549 (21%), Positives = 222/549 (40%), Gaps = 50/549 (9%)

Query: 39  ARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLA 98
              +   P Y  L+      D   I  +L + NI ++ S++G++I VP+S V + R+ LA
Sbjct: 44  FWLWSQQPEYRVLFSNYADKDGGAIVASLEQMNIPYKFSESGTAILVPASQVHQVRLKLA 103

Query: 99  AQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVM 158
           AQGLP    N G+EL  +   FG++ F++++   R LEGE+ R+IQ+IS +  AR+H+ +
Sbjct: 104 AQGLPK-GGNIGFELL-ENQKFGVSQFVEQVNFQRGLEGELERSIQTISAVEVARIHLAI 161

Query: 159 PDMGSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKL 216
           P    F +   +PTASV++          +   AI HLVA++VP L + +VTV+D  G L
Sbjct: 162 PKPSVFVRDQQKPTASVLLNLRPGRMLDQQQVSAIVHLVASSVPELPIANVTVVDQNGNL 221

Query: 217 LTANE---MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQI 273
           L+  +      N+    L  +  +Q  I   +   +A  +G  N  +   AE++  TQ+ 
Sbjct: 222 LSDTDKKAGRNNLDPTQLKYIDELQQNIVRRVESIIAPMVGAKNVHAEASAEVDFSTQEQ 281

Query: 274 REIVYDPDSKVERSIRLSKDAQRSETSQP---ESAVTVEQNMPHVSDRKVPLPRSLEN-- 328
               Y P+   +     S+ +  S+++ P           N P              N  
Sbjct: 282 AAETYRPNQAPDAMSVRSQQSNESQSTSPAGVGGVPGALSNQPPAPATAPLNTAVPANAG 341

Query: 329 ------------------------TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVN 364
                                     +K   +NYE++            ++RL++AVVVN
Sbjct: 342 APGAGTPANAAAANAANATPAVPVNTQKNVTTNYELDKTIRYVQQPMGGVKRLTVAVVVN 401

Query: 365 KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTV 424
             ++ +  G+  ++   D+   EI+ +   A G N  RGD++T+ +  F   Q+     +
Sbjct: 402 HKQVVDKNGKVTNRPLTDAEKTEISDLAKQAMGFNQERGDSLTVVNSSFAGEQIEAIPDL 461

Query: 425 QVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPP 484
            +             +     L+   L+    +  + +     D K+         +   
Sbjct: 462 PLWKQPENIEMAKEWLKMAAGLLVIFLLYRKLMKPMMQKLVKSDEKEALPAPGDDDAAVV 521

Query: 485 ISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAK 544
             +    G    + + +                ++ +   +Q+      + + N +  A 
Sbjct: 522 TLTGAAEGAEGENMVGVP--------------RKLAAKGYEQNLEAAKQLAKENPKLVAS 567

Query: 545 ILRKWARSE 553
           ++  W   E
Sbjct: 568 LVTNWVSKE 576


>gi|238798572|ref|ZP_04642049.1| Flagellar M-ring protein [Yersinia mollaretii ATCC 43969]
 gi|238717592|gb|EEQ09431.1| Flagellar M-ring protein [Yersinia mollaretii ATCC 43969]
          Length = 572

 Score =  351 bits (899), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 122/586 (20%), Positives = 233/586 (39%), Gaps = 61/586 (10%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           ++   F  +   L     + L       + + +A   +  SP Y  LY  L   D   I 
Sbjct: 10  NRDNAFTTTLARLRANPKIPLLIAAAAAVAIIVALMLWAKSPDYRVLYSNLSDRDGGEIV 69

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L++ NI +R +DNG ++ +P+  V + R+ LA QGLP   +  G+EL D+   FG++ 
Sbjct: 70  TQLTQLNIPYRFADNGGALLIPAEKVHETRLRLAQQGLPKGGA-VGFELLDQE-KFGISQ 127

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVM--IRAINP 182
           F +++   RALEGE+ARTI ++  ++  RVH+ MP    F +    PTASV   ++    
Sbjct: 128 FSEQVNYQRALEGELARTIGTLGPVLNVRVHLAMPKPSLFVREQKSPTASVTLALQPGRA 187

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQHEI 241
                  AI ++V+++V  L  G+VTV+D TG+LLT ++     +    L     +++  
Sbjct: 188 LDDGQINAIVYMVSSSVAGLPPGNVTVVDQTGRLLTQSDSAGRDLNAAQLKFTNEVENRF 247

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
           +  I   LA  +G  N  + V A+++  +++  +  Y P+    +    S+    SE   
Sbjct: 248 QRRIETILAPMVGNGNVHAQVTAQVDFASREQTDEEYKPNQAANQGAVRSQQTSNSEQLG 307

Query: 302 P---ESAVTVEQNMPHVSDRKV-------------------------------PLPRSLE 327
                       N P  +                                       +  
Sbjct: 308 GSNVGGVPGALSNQPSATPVAPIEVPQPAPAAGAAGATANNANAANRPAATTAARSTATS 367

Query: 328 NTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAE 387
           +  + ++ +N+E++     T      ++RLS+AVVVN G                  LA+
Sbjct: 368 SNSRHDQTTNFEVDRTIRHTQQQAGIVQRLSVAVVVNYGS----DKAGKPVALSKDQLAQ 423

Query: 388 INKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLV 447
           +  +   A G ++ RGDT+ + +  F      +  ++           F  ++NA  +L+
Sbjct: 424 VESLTREAMGFSTDRGDTLNVVNTPFNATDDGSGSSLPFW---QQQSFFDQLLNAGRYLL 480

Query: 448 GTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQD 507
             L+   L    +R +              + +     ++                    
Sbjct: 481 ILLVAWILWRKLVRPMITKKQIADKAAASVNSMVQTAQTAETVKQSKEE----------- 529

Query: 508 IFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
             +  +  Q R+++ V  Q   R+  + + +    A ++R+W  ++
Sbjct: 530 -LALRKKNQQRVSAEVQAQ---RIRELADKDPRIVALVIRQWMSND 571


>gi|319898649|ref|YP_004158742.1| flagellar M-ring protein [Bartonella clarridgeiae 73]
 gi|319402613|emb|CBI76158.1| Flagellar M-ring protein [Bartonella clarridgeiae 73]
          Length = 557

 Score =  350 bits (898), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 201/552 (36%), Positives = 312/552 (56%), Gaps = 8/552 (1%)

Query: 3   ILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNR 62
            L  L     +   LG  R++ L  + L      + + F++  P Y+ LYV L   DVNR
Sbjct: 5   FLAFLSSSGNALHKLGAKRLIALGIIGLTLFGTILFSSFYLTRPVYETLYVGLSRDDVNR 64

Query: 63  ISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGL 122
           + +AL E  I F +S +GS++ VP     +AR+ LA +GLP+S+ N+GYELFD + S GL
Sbjct: 65  MGMALGEVGIAFDVSADGSTVQVPVGQAEQARMFLAEKGLPTSN-NAGYELFDNMGSLGL 123

Query: 123 TSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP 182
           TSFMQEITR RALEGEIARTIQ + G+ AARVHIV+PD GSFRK   +PTASV+IR    
Sbjct: 124 TSFMQEITRQRALEGEIARTIQVVQGVKAARVHIVLPDKGSFRKANQKPTASVVIRTNGG 183

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLS-IVQAIQHEI 241
              +SA++IR LVAAAVP+L+   VTV+D+ G+LL +     N     ++ + Q +  +I
Sbjct: 184 FAVESAQSIRQLVAAAVPSLEASSVTVMDTRGQLLASGVDAMNGTSMMMASLEQQVASQI 243

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
           + NI K L  +LG+D+F+++V   L+ D +Q  E V+DP+S+V RS+R  +D   S+ ++
Sbjct: 244 DANIRKQLVPYLGLDHFQTSVQVVLDTDRRQTNETVFDPESQVVRSVRSVRDQADSQNNR 303

Query: 302 PESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAV 361
              AV VEQN+P          RS +  D++EE +NYEIN+K+I+T  D Y +++L++A+
Sbjct: 304 NSDAVGVEQNIPQEEIANGSGERSTDKKDRREETTNYEINSKTISTVSDGYSVKKLAVAI 363

Query: 362 VVNKGRLTEVL-GRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN 420
           VV++ RLT     +   +  ++  +  I ++V+ A G++ +RGD I +T++DF+ +   +
Sbjct: 364 VVDRARLTLPDSTKPTSESALNEEINRIQQMVATAAGLDPKRGDIINVTAVDFIGHTESD 423

Query: 421 SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL 480
              VQ+    +LSR+ + +IN +  ++  LL+ FLG+  L R                  
Sbjct: 424 MIPVQMPLWKLLSRYTSALINGVALVIAVLLILFLGVRPLMREMREGKKALENSKNAMAD 483

Query: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540
                +                S        + +    + + +      RL  MI ++EE
Sbjct: 484 LENIPALEHQYQANAEF-----SGITGTSDDTHDALHNLRNRMRVPPQNRLEQMIAMDEE 538

Query: 541 RFAKILRKWARS 552
           RFA +LR+W   
Sbjct: 539 RFAGVLREWIND 550


>gi|313200543|ref|YP_004039201.1| flagellar m-ring protein flif [Methylovorus sp. MP688]
 gi|312439859|gb|ADQ83965.1| flagellar M-ring protein FliF [Methylovorus sp. MP688]
          Length = 580

 Score =  350 bits (898), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 119/549 (21%), Positives = 223/549 (40%), Gaps = 50/549 (9%)

Query: 39  ARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLA 98
              +   P Y  L+      D   I  +L + NI ++ S++G++I VP+S V + R+ LA
Sbjct: 48  FWLWSQQPEYRVLFSNYADKDGGAIVASLEQMNIPYKFSESGTAILVPASQVHQVRLKLA 107

Query: 99  AQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVM 158
           AQGLP    N G+EL  +   FG++ F++++   R LEGE+ R+IQ+IS +  AR+H+ +
Sbjct: 108 AQGLPK-GGNIGFELL-ENQKFGVSQFVEQVNFQRGLEGELERSIQTISAVEVARIHLAI 165

Query: 159 PDMGSFRKIGARPTASVMIRAINP--SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKL 216
           P    F +   +PTASV++          +   AI HLVA++VP L + +VTV+D  G L
Sbjct: 166 PKPSVFVRDQQKPTASVLLNLRPGRMLDQQQVSAIVHLVASSVPELPIANVTVVDQNGNL 225

Query: 217 LTANE---MERNILGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQI 273
           L+  +      N+    L  +  +Q  I   +   +A  +G  N  +   AE++  TQ+ 
Sbjct: 226 LSDTDKKAGRNNLDPTQLKYIDELQQNIVRRVESIIAPMVGAKNVHAEASAEVDFSTQEQ 285

Query: 274 REIVYDPDSKVERSIRLSKDAQRSETSQP---ESAVTVEQNMPHVSDRKVPLPRSLEN-- 328
               Y P+   +     S+ +  S+++ P           N P              N  
Sbjct: 286 AAETYRPNQAPDAMSVRSQQSNESQSTSPAGVGGVPGALSNQPPAPATAPLNTAVPANAG 345

Query: 329 ------------------------TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVN 364
                                     +K   +NYE++            ++RL++AVVVN
Sbjct: 346 APGAGTPANAAAANAANATPAVPVNTQKNVTTNYELDKTIRYVQQPMGGVKRLTVAVVVN 405

Query: 365 KGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGTV 424
             ++ +  G+  ++   D+   EI+ +   A G N  RGD++T+ +  F  +Q+     +
Sbjct: 406 HKQVVDKNGKVTNRPLTDAEKTEISDLAKQAMGFNQERGDSLTVVNSSFAGDQIEAIPDL 465

Query: 425 QVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPP 484
            +             +     L+   L+    +  + +     D K+         +   
Sbjct: 466 PLWKQPENIEMAKEWLKMAAGLLVIFLLYRKLMKPMMQKLVKSDEKEALPAPGDDDAAVV 525

Query: 485 ISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAK 544
             +    G    + + +                ++ +   +Q+      + + N +  A 
Sbjct: 526 TLTGAAEGAEGENMVGVP--------------RKLAAKGYEQNLEAAKQLAKENPKLVAS 571

Query: 545 ILRKWARSE 553
           ++  W   E
Sbjct: 572 LVTNWVSKE 580


>gi|92114078|ref|YP_574006.1| flagellar M-ring protein FliF [Chromohalobacter salexigens DSM
           3043]
 gi|91797168|gb|ABE59307.1| flagellar M-ring protein FliF [Chromohalobacter salexigens DSM
           3043]
          Length = 594

 Score =  350 bits (898), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 122/550 (22%), Positives = 203/550 (36%), Gaps = 47/550 (8%)

Query: 39  ARFFVNSPHYDNLYVKLEVSDVNRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLA 98
              +  +P Y  LY  L  +D  +I   L    + +  S+NG ++ VP+  V K R+ LA
Sbjct: 54  LLMWARAPEYRVLYSTLTDADGGKIVSELDSMGVPYEFSENGQALLVPADQVNKLRLQLA 113

Query: 99  AQGLPSSSSNSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVM 158
            QGLP +S   GYEL D+  SFG++ F + +   RALEGE+ARTI+ +  +  ARVH+ M
Sbjct: 114 EQGLPEASG-VGYELMDE-QSFGISQFTEHVNYQRALEGELARTIEDLGPVSKARVHLAM 171

Query: 159 PDMGSFRKIGARPTASVMIRA--INPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKL 216
                F +     +ASVM+             +AI H+V+++V  L + DV V+D TG+L
Sbjct: 172 AKPSVFVRESEPASASVMLDLQRGRVLGEGQVQAIMHMVSSSVSELAISDVAVVDQTGRL 231

Query: 217 LTANEMERNI-LGKSLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIRE 275
           L+          G  L  V  ++      I   LA  LG  N ++ V A+L+   ++   
Sbjct: 232 LSPASDGNEALNGSQLDYVARVERNYAERIESILAPILGARNVKAEVSAQLDFSEREGTS 291

Query: 276 IVYDPDSKVERSIRLSKDAQ---RSETSQPESAVTVEQNMPHVSDRKV------------ 320
             Y P+     +   S+        +            N P  +                
Sbjct: 292 ETYGPNQPPNEAAVRSEQTSLSYSGDGDLAMGIPGALSNQPPGTAASPINAPQEDDAGDG 351

Query: 321 ------------------PLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVV 362
                                 +      ++   NYE++       H+   +ERL+ A+V
Sbjct: 352 EGEDAQDDGNQDEDGEATTQENATLGRTSRDNTINYEVDRTVEHIQHETGTIERLNAAIV 411

Query: 363 VNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSG 422
           VN     +  G        D  +A I  +   A G +  RGD + + +  F +       
Sbjct: 412 VNYRDGVDEDGNPTRVPLSDQEIANIRSLAQQAIGFSQARGDQLEVVNSPFDDTS-EQRP 470

Query: 423 TVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSP 482
                   +L     T+   L+  +  L + F  L  L +      A        +  + 
Sbjct: 471 EPAWWESPLLWSLATTLGQYLLIGLVALFLWFKVLRPLIQRQTERPAFTPATAAPAGAAG 530

Query: 483 PPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERF 542
              + A T            +  Q              S   +Q+   +  + + +    
Sbjct: 531 GAEAYAATAAEGTGAEEEPPAPPQKRRERR--------SASYEQNLRDVREIAQEDPRLV 582

Query: 543 AKILRKWARS 552
           A I+R W  S
Sbjct: 583 AMIVRGWMSS 592


>gi|290475703|ref|YP_003468592.1| flagellar basal-body MS(membrane and supramembrane)-ring and collar
           protein [Xenorhabdus bovienii SS-2004]
 gi|289175025|emb|CBJ81828.1| flagellar biosynthesis; basal-body MS(membrane and
           supramembrane)-ring and collar protein [Xenorhabdus
           bovienii SS-2004]
          Length = 569

 Score =  350 bits (898), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 126/585 (21%), Positives = 225/585 (38%), Gaps = 56/585 (9%)

Query: 2   AILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVN 61
            + +Q   F    + +     + L       I + +A   ++ SP Y  LY  L   D  
Sbjct: 7   DVENQNKGFSAIISRIKADPKVPLLVAGSAAIAIVVALFLWMRSPDYRVLYSNLSDKDGG 66

Query: 62  RISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFG 121
            I   L++ NI +R ++N S++ +P+  V +AR+ LA QGLP   +  GYEL DK   FG
Sbjct: 67  EIVTQLTQMNIPYRFAENSSALMIPADKVHEARLKLAQQGLPKGGA-VGYELLDKE-KFG 124

Query: 122 LTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA-- 179
           ++ F +++   RA EGE++RTI+S+  + +ARV + +P    F +    PTASV +R   
Sbjct: 125 ISQFSEQVNYNRAKEGELSRTIESLDPVESARVILSIPKPSLFVREQKSPTASVTVRLLQ 184

Query: 180 INPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMER-NILGKSLSIVQAIQ 238
                     AI HLV++ V  L   +V ++D +G+LLT  +    ++    L  +Q ++
Sbjct: 185 GRTLDEGQVNAIAHLVSSGVAGLPPSNVKIVDQSGRLLTQADANGLDLNTTQLKYIQEVE 244

Query: 239 HEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSE 298
              +  I   L   +G  N  + V A+L+   ++     Y P+     +  LSK +  SE
Sbjct: 245 KRFQHRIETILTPVVGRGNVHAQVTAQLDFSRREQTAEEYKPNQPPNEAAVLSKQSSSSE 304

Query: 299 TSQP---ESAVTVEQNMPHVSDRKVPLPR---------------------------SLEN 328
            S             N P  +                                   +   
Sbjct: 305 QSGGSLVGGVPGALSNQPSAAPSAPIEKPNPDTKGKGDEKSDQNRNSTYNNYERLVNNSR 364

Query: 329 TDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEI 388
            ++ +E  NY++      T      +ERLS+AVV+N        G    +      L++I
Sbjct: 365 NNRHDELINYQVGKTISHTQLQVGAVERLSVAVVINYATTQGENGPET-KALTPEQLSQI 423

Query: 389 NKIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVG 448
             +   A G +++RGD++ + +  F +                        +    +L+ 
Sbjct: 424 EALTREAMGFSTKRGDSLNVVNTPFNDTAEVIEPLP----FWQHPVLLEKTLELGRWLLL 479

Query: 449 TLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDI 508
            L+   L    +        A +              +      L       L       
Sbjct: 480 ALVAWLLWRKMIVPQIAKKRAAEKAALNAQKNQQKQQAPESNAELDEKMRRKLA------ 533

Query: 509 FSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
                  + R+N+ +  Q   R+  + E +    A ++R+W  +E
Sbjct: 534 -------RQRVNAEIQSQ---RIRELAEKDPRVVALVIRQWMSNE 568


>gi|52841987|ref|YP_095786.1| flagellar MS-ring protein [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|148359304|ref|YP_001250511.1| flagellar basal body M-ring protein FliF [Legionella pneumophila
           str. Corby]
 gi|52629098|gb|AAU27839.1| flagellar basal body M-ring protein FliF [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|148281077|gb|ABQ55165.1| flagellar basal body M-ring protein FliF [Legionella pneumophila
           str. Corby]
 gi|307610459|emb|CBX00030.1| flagellar M-ring protein [Legionella pneumophila 130b]
          Length = 544

 Score =  350 bits (897), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 121/574 (21%), Positives = 229/574 (39%), Gaps = 57/574 (9%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           MA+ D          SL   R + +   +   I + +A   +   P Y  LY +L   D 
Sbjct: 1   MALADNASVAATKFASLSIPRQIGVLFGLAASIAIGVAVVLWSRDPSYVPLYSQLNAQDS 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNS- 119
           + I   L   +IDF+I  N   + VP+  +  AR+ LAAQGLP   +  G++L       
Sbjct: 61  SEILTILERNSIDFKIDKNNGLLMVPADELQSARLKLAAQGLPRD-TAIGHDLLGSSGGV 119

Query: 120 FGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA 179
           F  + FM+     +ALE E+ARTI   + I +ARVH+ +P   +F +    P+ASV I  
Sbjct: 120 FNTSQFMENARYRQALEAELARTISKFNNIKSARVHLAIPRESAFVRDSQEPSASVFIDV 179

Query: 180 INPSVYK--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKS--LSIVQ 235
            +    K  +  AI +LVA+++PNL  G VTV+D  G+LL               L   Q
Sbjct: 180 YSGFEIKKHTIAAIVNLVASSIPNLSAGRVTVVDQDGQLLNEGSGYNLFSETERFLDYRQ 239

Query: 236 AIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQ 295
            ++H+    I   L   LG    R+ V A+++  + +  + +++P+    RS +  ++++
Sbjct: 240 NLEHQYAQKIQDILTPILGYGRVRAKVSADIDFTSYEQTQELFNPELSALRSEQTMQESR 299

Query: 296 RSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTD------------------KKEEQSN 337
            +   +         N P  +          +N                    + +   N
Sbjct: 300 NASN-EASGVPGTLSNTPQPNSSLGQKNNPQQNATPNNLPQQTSSDQMQAKDVRMQTTKN 358

Query: 338 YEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRS-ADQGKIDSYLAEINKIVSAAT 396
           +E++     T +    ++RLS+AV+V+   +     +    +      + +I  +VS A 
Sbjct: 359 FELDKTISHTKNQPGTIKRLSVAVLVDNRPVMNDKTKKLEKKPLTKEEIEQIKLLVSDAI 418

Query: 397 GINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLG 456
           G+N +RGD++ + +  F++     +   +  +       F +VI  +   +  L + F  
Sbjct: 419 GLNVKRGDSLNVINSSFVKPDPIEAIPEEHFWQ---KDSFWSVIKQIGGALFILAILFGV 475

Query: 457 LHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQ 516
           L  + +    +                   +  T     +  I+                
Sbjct: 476 LRPMLKTLASNK-----------DMDQATDNQDTGDFTLDGKISFR-------------- 510

Query: 517 SRINSYVSKQSDLRLLHMIEINEERFAKILRKWA 550
              +    +     L  +++   +R A++++ W 
Sbjct: 511 ---DVQDYETQLSLLRQVVDKEPKRVAQVVKSWV 541


>gi|54297673|ref|YP_124042.1| flagellar MS-ring protein [Legionella pneumophila str. Paris]
 gi|53751458|emb|CAH12876.1| Flagellar M-ring protein [Legionella pneumophila str. Paris]
          Length = 544

 Score =  350 bits (897), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 121/574 (21%), Positives = 229/574 (39%), Gaps = 57/574 (9%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           MA+ D          SL   R + +   +   I + +A   +   P Y  LY +L   D 
Sbjct: 1   MALADNASVAATKFASLSIPRQIGVLFGLAASIAIGVAVVLWSRDPSYVPLYSQLNAQDS 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNS- 119
           + I   L   +IDF+I  N   + VP+  +  AR+ LAAQGLP   +  G++L       
Sbjct: 61  SEIMTILERNSIDFKIDKNNGLLMVPADELQSARLKLAAQGLPRD-TAIGHDLLGSSGGV 119

Query: 120 FGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA 179
           F  + FM+     +ALE E+ARTI   + I +ARVH+ +P   +F +    P+ASV I  
Sbjct: 120 FNTSQFMENARYKQALEAELARTISKFNNIKSARVHLAIPRESAFVRDSQEPSASVFIDV 179

Query: 180 INPSVYK--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKS--LSIVQ 235
            +    K  +  AI +LVA+++PNL  G VTV+D  G+LL               L   Q
Sbjct: 180 YSGFEIKKHTIAAIVNLVASSIPNLSAGRVTVVDQDGQLLNEGSGYNLFSETERFLDYRQ 239

Query: 236 AIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQ 295
            ++H+    I   L   LG    R+ V A+++  + +  + +++P+    RS +  ++++
Sbjct: 240 NLEHQYAQKIQDILTPILGYGRVRAKVSADIDFTSYEQTQELFNPELSALRSEQTMQESR 299

Query: 296 RSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTD------------------KKEEQSN 337
            +   +         N P  +          +N                    + +   N
Sbjct: 300 NASN-EASGVPGTLSNTPQPNSSLGQKNNPQQNATPNNLPQQTSSDQMQAKDVRMQTTKN 358

Query: 338 YEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRS-ADQGKIDSYLAEINKIVSAAT 396
           +E++     T +    ++RLS+AV+V+   +     +    +      + +I  +VS A 
Sbjct: 359 FELDKTISHTKNQPGTIKRLSVAVLVDNRPVMNDKTKKLEKKPLTKEEIEQIKLLVSDAI 418

Query: 397 GINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLG 456
           G+N +RGD++ + +  F++     +   +  +       F +VI  +   +  L + F  
Sbjct: 419 GLNVKRGDSLNVINSSFVKPDPIEAIPEEHFWQ---KDSFWSVIKQIGGALFILAILFGV 475

Query: 457 LHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQ 516
           L  + +    +                   +  T     +  I+                
Sbjct: 476 LRPMLKTLASNK-----------DIDQATDNQDTGDFTLDGKISFR-------------- 510

Query: 517 SRINSYVSKQSDLRLLHMIEINEERFAKILRKWA 550
              +    +     L  +++   +R A++++ W 
Sbjct: 511 ---DVQDYETQLSLLRQVVDKEPKRVAQVVKSWV 541


>gi|54294647|ref|YP_127062.1| flagellar MS-ring protein [Legionella pneumophila str. Lens]
 gi|53754479|emb|CAH15963.1| Flagellar M-ring protein [Legionella pneumophila str. Lens]
          Length = 544

 Score =  349 bits (896), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 121/574 (21%), Positives = 229/574 (39%), Gaps = 57/574 (9%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           MA+ D          SL   R + +   +   I + +A   +   P Y  LY +L   D 
Sbjct: 1   MALADNASVAATKFASLSIPRQIGVLFGLAASIAIGVAVVLWSRDPSYVPLYSQLNAQDS 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNS- 119
           + I   L   +IDF+I  N   + VP+  +  AR+ LAAQGLP   +  G++L       
Sbjct: 61  SEILTVLERNSIDFKIDKNNGLLMVPADELQSARLKLAAQGLPRD-TAIGHDLLGSSGGV 119

Query: 120 FGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA 179
           F  + FM+     +ALE E+ARTI   + I +ARVH+ +P   +F +    P+ASV I  
Sbjct: 120 FNTSQFMENARYKQALEAELARTISKFNNIKSARVHLAIPRESAFVRDSQEPSASVFIDV 179

Query: 180 INPSVYK--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKS--LSIVQ 235
            +    K  +  AI +LVA+++PNL  G VTV+D  G+LL               L   Q
Sbjct: 180 YSGFEIKKHTIAAIVNLVASSIPNLSTGRVTVVDQDGQLLNEGSGYNLFSETERFLDYRQ 239

Query: 236 AIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQ 295
            ++H+    I   L   LG    R+ V A+++  + +  + +++P+    RS +  ++++
Sbjct: 240 NLEHQYAQKIQDILTPILGYGRVRAKVSADIDFTSYEQTQELFNPELSALRSEQTMQESR 299

Query: 296 RSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTD------------------KKEEQSN 337
            +   +         N P  +          +N                    + +   N
Sbjct: 300 NASN-EASGVPGTLSNTPQPNSSLGQKNNPQQNATPNNLPQQTSSDQMQAKDVRMQTTKN 358

Query: 338 YEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRS-ADQGKIDSYLAEINKIVSAAT 396
           +E++     T +    ++RLS+AV+V+   +     +    +      + +I  +VS A 
Sbjct: 359 FELDKTISHTKNQPGTIKRLSVAVLVDNRPVMNDKTKKLEKKPLTKEEIEQIKLLVSDAI 418

Query: 397 GINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLG 456
           G+N +RGD++ + +  F++     +   +  +       F +VI  +   +  L + F  
Sbjct: 419 GLNVKRGDSLNVINSSFVKPDPIEAIPEEHFWQ---KDSFLSVIKQIGGALFILAILFGV 475

Query: 457 LHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQ 516
           L  + +    +                   +  T     +  I+                
Sbjct: 476 LRPMLKTLASNK-----------DMDQATDNQDTGDFTLDGKISFR-------------- 510

Query: 517 SRINSYVSKQSDLRLLHMIEINEERFAKILRKWA 550
              +    +     L  +++   +R A++++ W 
Sbjct: 511 ---DVQDYETQLSLLRQVVDKEPKRVAQVVKSWV 541


>gi|126665015|ref|ZP_01735998.1| flagellar M-ring protein [Marinobacter sp. ELB17]
 gi|126630385|gb|EBA01000.1| flagellar M-ring protein [Marinobacter sp. ELB17]
          Length = 569

 Score =  349 bits (896), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 114/560 (20%), Positives = 227/560 (40%), Gaps = 36/560 (6%)

Query: 8   LQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVAL 67
            + F     L   R + L   +   + L +A   +   P+Y  +   L   +   ++  L
Sbjct: 27  SRAFMGFNRLDLLRQIGLMVGLAASVALGVAVVLWAQEPNYQPVLGDLSSYNPQDVTSIL 86

Query: 68  SEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQ 127
             + ID+++     ++ V +  V  AR+ LAA+G+ +     G+EL D+    G + +M+
Sbjct: 87  DSSGIDYKMDPRTGALLVVADQVYNARLRLAAEGV-TDQKTLGFELLDQDRGLGTSQYME 145

Query: 128 EITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKS 187
            I+  R LEGE+ARTI S+ G+ +ARVH+ +P+   F +    P+ASV +        + 
Sbjct: 146 TISYRRGLEGELARTIASMRGVRSARVHLAIPERSVFIRDAREPSASVFLEVFAGRRPEQ 205

Query: 188 --AEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNIL--GKSLSIVQAIQHEIEM 243
               AI +LVA +VP +    VTV+D  G LLT  + E +             ++  +  
Sbjct: 206 EYIAAIVNLVAGSVPMMTQSGVTVVDQNGNLLTGADAETDTDRMSDQYDYTDRVEERLSR 265

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            ++  ++  +G   +R+ V A+L+  + +  E +++P+ +  RS       +RS    P 
Sbjct: 266 RVSSLISPIVGEGRYRTEVSADLDFSSVERAEELFNPEQQAVRSE-RQLTERRSAGDGPI 324

Query: 304 SAVTVEQNMPHVSDRKVPL-----------PRSLENTDKKEEQSNYEINTKSIATTHDNY 352
                  N P  +                 P       + E   NYE++        +  
Sbjct: 325 GIPGALSNQPPANATVPQQANAGANADGAEPAPAPVDVRSESTRNYEMDRTVSYVRQELG 384

Query: 353 KLERLSIAVVVNKGRLTEVL-GRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSM 411
           +++RL++A+ V+  ++     G    +   +  L  ++ +V  A G ++ RGD++T+ + 
Sbjct: 385 RIKRLTVALAVDDIKVVNADTGAVTYEPWPEQELQRLSMLVRDAVGYSAARGDSVTVMNT 444

Query: 412 DFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKK 471
            F   Q+      +          F  ++  L+  +  L++    L    +     +   
Sbjct: 445 AFAPEQVLEYDAPRFWQQP----WFWDLMKQLLAGLVVLVLVLGLLRPTLKNLASGNRGL 500

Query: 472 GEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRL 531
              G                G    D I    S +   ++  +L    ++    +    L
Sbjct: 501 AGSG--------------NEGYGDLDGIEGGDSLRRAMANQDDLLLPGSTGGYDRQLNAL 546

Query: 532 LHMIEINEERFAKILRKWAR 551
             +I  +  R A+++R+W  
Sbjct: 547 KGLIAEDPARVAQVMRQWVN 566


>gi|291613068|ref|YP_003523225.1| flagellar M-ring protein FliF [Sideroxydans lithotrophicus ES-1]
 gi|291583180|gb|ADE10838.1| flagellar M-ring protein FliF [Sideroxydans lithotrophicus ES-1]
          Length = 546

 Score =  349 bits (896), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 120/560 (21%), Positives = 232/560 (41%), Gaps = 39/560 (6%)

Query: 9   QFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALS 68
              +    +   + L L   +   + L      +  +P Y  LY  +   D   +  +L 
Sbjct: 11  SLTRLLFGMPSQQKLGLIVAVAATVALLAGLFMWGQTPDYRVLYANMSERDGGAVIESLQ 70

Query: 69  EANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQE 128
           + NI ++ +  G ++ VP+  V + R+ +AA+GLP      G+EL  +   FG + F+++
Sbjct: 71  QQNIPYKFT-EGGTLMVPADRVYEVRLQMAAKGLPK-GGTVGFELM-ENQKFGTSQFLEQ 127

Query: 129 ITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMI--RAINPSVYK 186
           +   RALEGE++R++++I+ + +ARVH+ +P    F K   +P+ASV++  RA N     
Sbjct: 128 VNYQRALEGELSRSVETIASVASARVHLAIPKQSVFVKEQQKPSASVILSLRAGNSLDEG 187

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT---ANEMERNILGKSLSIVQAIQHEIEM 243
              AI HL++++VPN++  +VTV+D +G LL+    +  E+ +    L  V+ I+ +   
Sbjct: 188 QVSAIVHLISSSVPNMNAQNVTVVDQSGTLLSSARDSNAEQLMDATQLKYVRQIEQDYVK 247

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKD--AQRSETSQ 301
            I   L    GV N R+ V A L+    +     + P+    ++   S      ++ T+ 
Sbjct: 248 RIEDILIPITGVQNVRAQVTASLDFSQTEQTAETFRPNQPPNQAAVRSLQTLETQNGTTS 307

Query: 302 PESAVTVEQNMPHVSDRKV--------PLPRSLENTDKKEEQSNYEINTKSIATTHDNYK 353
                    N P V                        KE  +NYE++     T      
Sbjct: 308 TGGVPGALSNQPPVPATAPIVTPASAVVAAAGTAGNMHKELTTNYEVDRTIQHTKLPVGS 367

Query: 354 LERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDF 413
           ++RLSIAVVVN    T   G++  +   D+  A+I  +V    G +++RGD++ + +  F
Sbjct: 368 IKRLSIAVVVNNPSTTGKDGKATSRPYTDAEKAQITALVKETVGFDAKRGDSLNLLNSAF 427

Query: 414 LENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGE 473
            E Q   + T      D ++     +   L+   G   + F  +    +  +   A +  
Sbjct: 428 NEQQEIIAETPMWKQPDTIAM-AKDIFKYLLIAGGIGFLLFGIIKPAFKTISEQSAAQET 486

Query: 474 VGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLH 533
               +         A                            ++ ++   + +      
Sbjct: 487 AMMSAAQHGQISHQAGNAAGQ--------------------YAAQQSASSYEDNLQLAKQ 526

Query: 534 MIEINEERFAKILRKWARSE 553
           + + + +  A ++++W   E
Sbjct: 527 LAKDDPKIVATVVKEWVNKE 546


>gi|322421735|ref|YP_004200958.1| flagellar M-ring protein FliF [Geobacter sp. M18]
 gi|320128122|gb|ADW15682.1| flagellar M-ring protein FliF [Geobacter sp. M18]
          Length = 524

 Score =  349 bits (895), Expect = 6e-94,   Method: Composition-based stats.
 Identities = 125/559 (22%), Positives = 233/559 (41%), Gaps = 46/559 (8%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           + L +  +   +L   + L++  V L  ++ F A     N   Y  L+  L   D   I 
Sbjct: 3   EGLKKLLEPFLALSAGKRLVVGGVALASLLAFAALITVANKTDYRPLFANLTSEDAGEIV 62

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L E  + ++I+ +G +I VPS  V   R+ +A+ GLP      GYE+FD+ N FG+T 
Sbjct: 63  KKLKEQKVPYQIAADGKAIMVPSDKVYDLRLSMASDGLPQGGG-IGYEIFDRKN-FGMTE 120

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINP-- 182
           F+Q++   RAL+GE++RTI  I+G+ +ARVH+ +P+   F+      TASV+++  +   
Sbjct: 121 FVQKLNYQRALQGELSRTISQIAGVESARVHLAIPEKTLFKDAEKPATASVVLKMKSNRM 180

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLT---ANEMERNILGKSLSIVQAIQH 239
                 + I HLVA+++  +D   VTVLDS GK+L+    ++    + G      +  + 
Sbjct: 181 LREAEVQGIVHLVASSIEGMDPEQVTVLDSRGKMLSGNTPSDTASKLTGSRQETQRNFEK 240

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
             E  +   L   +G     + V A  +    +  E  YDP+S   RS + S++     T
Sbjct: 241 TQEEKLQTLLDRVVGSGKCVARVSAAFDFKQVEKYEERYDPESAAVRSEQRSEEK-GGVT 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
           +       V+ N+   +              K +E  NYE++  +         L ++S+
Sbjct: 300 ATASGVPGVQSNLGRSAPGAPGQTGGG---SKTDETLNYEVSRSTARIIEPVGALSKVSV 356

Query: 360 AVVVNKGR----LTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLE 415
           AV+V+         +       Q +    + +I  +V +A G ++ RGD +T+ ++ F E
Sbjct: 357 AVLVDGKYDLPAGAKPGATPKYQPRTPDEMQKIEALVKSAVGFSAERGDQVTVANIPFQE 416

Query: 416 NQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVG 475
                    +     I+     T+I  L+  +G L +    +  L +   I+        
Sbjct: 417 TGDTGGEPPKWYDAPIVQ----TLIKNLLIGLGFLALIMFVIRPLLKTLKIERPAS---- 468

Query: 476 GKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMI 535
                                   +      D          ++     + + + L+  +
Sbjct: 469 -----------------------SSFLPVQDDAEHAHMIEMQKLAQEKMRMTQIELVEKV 505

Query: 536 EINEERFAKILRKWARSEI 554
           + +  + A+IL+ W   + 
Sbjct: 506 KQDPYQAAQILQNWLTRKE 524


>gi|90422618|ref|YP_530988.1| flagellar MS-ring protein [Rhodopseudomonas palustris BisB18]
 gi|90104632|gb|ABD86669.1| flagellar M-ring protein FliF [Rhodopseudomonas palustris BisB18]
          Length = 544

 Score =  349 bits (895), Expect = 6e-94,   Method: Composition-based stats.
 Identities = 182/555 (32%), Positives = 305/555 (54%), Gaps = 14/555 (2%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M   +   + + +   LG  R+ +LA V L          ++++ P ++ LY  L   D+
Sbjct: 1   MVNREYAQKLWSNLLELGPRRLTVLAMVGLAVFFGVGGGAYYLSRPEFNVLYSGLSREDI 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
            R+S  L +AN+ F ++  G +I V      +AR  LA +GLP SS++ GYELFDK+ S 
Sbjct: 61  TRVSAVLRDANVPFDVNATGDTILVRPGQAAQARTLLADKGLP-SSTSGGYELFDKIGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGEIARTIQ I G+ AARVHIVMP  GSFR+  A PTASV++R  
Sbjct: 120 GLTSFMQEVTRVRALEGEIARTIQVIKGVKAARVHIVMPARGSFRREQAPPTASVVLRTD 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLS-IVQAIQH 239
            P+  K+A ++RHLVAAAVP +    VTVLDS G LL A++        +++ + + +  
Sbjct: 180 GPADAKTARSVRHLVAAAVPGMTPDKVTVLDSDGSLLGADDDGTGTTPTTMANLQRVVSR 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
            I+ N++KAL  +LG+DNF  +V  +L+ D +Q  E VYDP+S+V+RS+R  ++ + S++
Sbjct: 240 LIQDNVSKALTPYLGLDNFEVSVATQLSTDKRQTNETVYDPESRVQRSVRAVRERETSQS 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
              ++  TV+QN+P           S +   ++E+ +NYE+++K+  T  D Y + ++ +
Sbjct: 300 LDRQTPTTVQQNLPDQQLNAGGGKNSNDEKQRREDVTNYEVSSKTTTTVSDGYVVNKMFL 359

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AV+VN+ RL   LG    +  +++ +AEI+++ + A G++  RGD I +++++F+E    
Sbjct: 360 AVLVNRPRLIASLGDKVSESAMEAKVAEISQLAATAAGLDRPRGDQIQVSAVEFIEGARD 419

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
            +    ++F ++L R     ++A+  L    ++ + GL     +              + 
Sbjct: 420 LAPVPGITFTEVLMRQSGNFVSAITILAVAGMLIWFGLRPAINVVLASSKSSEGAPLLAA 479

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
            +   + +                          NL   ++         RL  +++++E
Sbjct: 480 EAAALLGADAAVAAQIARE------------AMPNLVQDVSRRAQHAPQKRLEQIVQLDE 527

Query: 540 ERFAKILRKWARSEI 554
           ++ A IL++W R E 
Sbjct: 528 KQAAAILKQWIRQEE 542


>gi|120613031|ref|YP_972709.1| flagellar M-ring protein FliF [Acidovorax citrulli AAC00-1]
 gi|120591495|gb|ABM34935.1| flagellar M-ring protein FliF [Acidovorax citrulli AAC00-1]
          Length = 566

 Score =  349 bits (895), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 127/565 (22%), Positives = 227/565 (40%), Gaps = 42/565 (7%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +  ++L R++ L   + I + +   +AA      P Y  L+  L   D   I   LS  
Sbjct: 21  LQRFSALDRSKRLRFGAGIALLVAAVVAAVVLNRQPDYKVLFSNLSDKDGGAIVAQLSTM 80

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           N+ ++ S+ G +I VP+  V   R+ LA QGLP   S +G+EL  + N FG+T F + + 
Sbjct: 81  NVPYKYSEGGGAILVPAERVHDVRLRLATQGLPK-GSVTGFELM-ETNRFGVTQFQERLN 138

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAIN--PSVYKSA 188
             R LEGE+ R+IQ++S + +ARVH+ +P+   F +   +P+ASV++             
Sbjct: 139 FQRGLEGELTRSIQALSSVQSARVHLALPNQNGFFREQQKPSASVLLSLYPGRFLDRTQL 198

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM---ERNILGKSLSIVQAIQHEIEMNI 245
             I HLVA++VP +    V+VLD TGKLL+ +        I  + LS VQ I+ +    I
Sbjct: 199 AGIVHLVASSVPEMSPSAVSVLDDTGKLLSQSPDTAAGSAIDAQQLSYVQQIEQQYTRRI 258

Query: 246 NKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS----- 300
              L   +G +N ++ V AE++    +     + P+   + S   S+    S        
Sbjct: 259 LDILEPVVGKNNVKAQVTAEVDFSQSEQTSEQHRPNQTPDSSAVRSQQVVESSGGTQGNQ 318

Query: 301 QPESAVTVEQNMPH-----------VSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTH 349
            P        N P             +       +      K+E  +NYE++     T  
Sbjct: 319 PPAGVPGAASNQPPQPSTAPINGANPAPTAGNGQQGQAAGSKRESITNYEVDKTVRVTRA 378

Query: 350 DNYKLERLSIAVVVNKGRLTEVLGRSADQ-GKIDSYLAEINKIVSAATGINSRRGDTITI 408
            +  ++R+S AVVVN   + +  G++          + ++  +V    G +  RGD++ I
Sbjct: 379 GSGAIKRVSAAVVVNYQAIADAAGKAPQAKAFTPEQIEQMTALVRETIGYSKDRGDSVNI 438

Query: 409 TSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDD 468
            +  FL +             +++    +      + L   L++  L   A++ ++    
Sbjct: 439 MNTQFLVDNTPAVELPLWKQPEMIELAKSLGWPVGMSLFAALILLGLVRPAIKGMNQPPA 498

Query: 469 AKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSD 528
                  G+ + +             P     L  + + +                    
Sbjct: 499 PAAAPASGRQVDAIEADEPERPALAAPAKPEDLIQTPEQM------------------RL 540

Query: 529 LRLLHMIEINEERFAKILRKWARSE 553
                + + N    A IL+ W   E
Sbjct: 541 EEARVLAKENPVAVANILKVWVNGE 565


>gi|170024616|ref|YP_001721121.1| flagellar MS-ring protein [Yersinia pseudotuberculosis YPIII]
 gi|169751150|gb|ACA68668.1| flagellar M-ring protein FliF [Yersinia pseudotuberculosis YPIII]
          Length = 570

 Score =  349 bits (895), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 127/584 (21%), Positives = 234/584 (40%), Gaps = 59/584 (10%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           ++   F  +   L     + L       I + +A   +  SP Y  LY  L   D   I 
Sbjct: 10  NRENTFTMTLARLRANPKIPLLIAAAAAIAIIVALMLWAKSPDYRVLYSNLSDRDGGDIV 69

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             L++ NI +R +DNG ++ +P+  V + R+ LA QGLP   +  G+EL D+   FG++ 
Sbjct: 70  TQLTQLNIPYRFADNGGALLIPAEKVHETRLRLAQQGLPKGGA-VGFELLDQE-KFGISQ 127

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVM--IRAINP 182
           F ++I   RALEGE++RTI ++  ++  RVH+ MP    F +    PTASV   ++    
Sbjct: 128 FSEQINYQRALEGELSRTIGTLGPVLNVRVHLAMPKPSLFVREQKSPTASVTLALQPGRA 187

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQHEI 241
                  AI ++V+++V  L  G+VTV+D TG+LLT ++     +    L     +++  
Sbjct: 188 LDDGQINAIVYMVSSSVAGLPPGNVTVVDQTGRLLTQSDSAGRDLNASQLKFTSEVENRY 247

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
           +  I   LA  +G  N  + V A+++  +++  +  Y P+    +    S+    SE   
Sbjct: 248 QRRIENILAPMVGNGNVHAQVTAQVDFASREQTDEEYKPNQAANQGAVRSQQVSTSEQLG 307

Query: 302 P---ESAVTVEQNMPHVSDRKV-----------------------------PLPRSLENT 329
                       N P V+                                    ++  + 
Sbjct: 308 GTNVGGVPGALSNQPPVAPIAPIEIPQPAGAAANNAAPANAAATANANTTATAAKASSSN 367

Query: 330 DKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEIN 389
            + ++ +N+E++     T      ++RLS+AVVVN                    LA++ 
Sbjct: 368 SRHDQTTNFEVDRTIRHTQQQAGMVQRLSVAVVVNYTS----DKAGKPIALSKDQLAQVE 423

Query: 390 KIVSAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGT 449
            +   A G ++ RGDT+ + +  F  +      ++           F  ++NA  +L+  
Sbjct: 424 SLTREAMGFSTVRGDTLNVVNTPFTASDDTRGSSLPFW---QQQSFFDQLLNAGRYLLIL 480

Query: 450 LLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIF 509
           L+   L    LR +              + +     + A  T     + +AL   NQ   
Sbjct: 481 LVAWILWRKLLRPMLAKKQVADKAAASVNNIV--QTAQAAETVKQSKEELALRKKNQQRV 538

Query: 510 SHSRNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
           S              +    R+  + + +    A ++R+W  ++
Sbjct: 539 SA-------------EVQAQRIRELADKDPRVVALVIRQWMSND 569


>gi|238794015|ref|ZP_04637633.1| Flagellar M-ring protein [Yersinia intermedia ATCC 29909]
 gi|238726647|gb|EEQ18183.1| Flagellar M-ring protein [Yersinia intermedia ATCC 29909]
          Length = 572

 Score =  349 bits (895), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 126/581 (21%), Positives = 232/581 (39%), Gaps = 61/581 (10%)

Query: 10  FFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSE 69
           F  +   L     + L       + + +A   +  SP Y  LY  L   D   I   L++
Sbjct: 15  FTTTLARLRANPKIPLLIAAAAAVAIIVALMLWAKSPDYRVLYSNLNDRDGGDIVTQLTQ 74

Query: 70  ANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEI 129
            NI +R +DNG ++ +P+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++
Sbjct: 75  LNIPYRFADNGGALLIPADKVHETRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQV 132

Query: 130 TRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVM--IRAINPSVYKS 187
              RALEGE++RTI ++  ++  RVH+ MP    F +    PTASV   ++         
Sbjct: 133 NYQRALEGELSRTISTLGPVMNVRVHLAMPKPSLFVREQKSPTASVTLALQPGRALDDGQ 192

Query: 188 AEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERN-ILGKSLSIVQAIQHEIEMNIN 246
             AI ++V+++V  L  G+VTV+D TG+LLT ++     +    L     +++  +  I 
Sbjct: 193 INAIVYMVSSSVAGLPPGNVTVVDQTGRLLTQSDSAGRDLNAAQLKFTNEVENRFQRRIE 252

Query: 247 KALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQP---E 303
             LA  +G  N  + V A+++  +++  +  Y P+   ++    S+    SE        
Sbjct: 253 TILAPMVGNGNVHAQVTAQVDFASREQTDEEYKPNQAADKGAVRSQQVSTSEQLGGTNVG 312

Query: 304 SAVTVEQNMPHVSDRKVPLPRS-------------------------------LENTDKK 332
                  N P  +                                          +  + 
Sbjct: 313 GVPGALSNQPSATPVAPIETPQATPAAGAAGATANNANAANRPATTTAAKSTATSSNSRH 372

Query: 333 EEQSNYEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIV 392
           ++ +N+E++     T      ++RLS+AVVVN G                  LA++  + 
Sbjct: 373 DQTTNFEVDRTIRHTQQQAGMVQRLSVAVVVNYGS----DKAGKPVALTKDQLAQVESLT 428

Query: 393 SAATGINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLV 452
             A G ++ RGDT+ + +  F      +  T+           F  ++NA  +L+  L+ 
Sbjct: 429 REAMGFSTDRGDTLNVVNTPFSATDDASGNTLPFW---QQQSFFDQMLNAGRYLLILLVA 485

Query: 453 TFLGLHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHS 512
             L    +R +         +    SI +    + A        + +AL   NQ   S  
Sbjct: 486 WILWRKLVRPMMAKKQV--ADKAAASINNIVQTAVASENAKQSKEELALRKKNQQRVSA- 542

Query: 513 RNLQSRINSYVSKQSDLRLLHMIEINEERFAKILRKWARSE 553
                       +    R+  + + +    A ++R+W  ++
Sbjct: 543 ------------EVQAQRIRELADKDPRVVALVIRQWMSND 571


>gi|328545497|ref|YP_004305606.1| flagellar M-ring protein [polymorphum gilvum SL003B-26A1]
 gi|326415238|gb|ADZ72301.1| Flagellar M-ring protein [Polymorphum gilvum SL003B-26A1]
          Length = 546

 Score =  349 bits (894), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 193/553 (34%), Positives = 311/553 (56%), Gaps = 12/553 (2%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           M   +   +   +   LG  R++ LA + +  I       ++++ P    LY  L+  DV
Sbjct: 1   MPGREHAEKLLANLLELGTRRLIALALIGVATIATVGLGAYYLSRPQQTTLYTGLQGEDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           +RI  AL +A I + +S +G+++ V      +AR+ LA +GLP   +++GYELFD + S 
Sbjct: 61  SRIGSALQDAGIPYDVSSDGTAVLVNHGAAARARMLLAERGLPR-GADAGYELFDDLGSL 119

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQE+TRVRALEGE+ARTIQ + G+ AARVHIV+P+ GSFR+    P+ASV+IR+ 
Sbjct: 120 GLTSFMQEVTRVRALEGELARTIQLMQGVRAARVHIVLPEKGSFRRDQQPPSASVVIRSD 179

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLS-IVQAIQH 239
            P   ++A+AIRHLV+AAVP +    VTVLD++G LL A +   N     ++ +  A+  
Sbjct: 180 VPDDLRTADAIRHLVSAAVPGMSADKVTVLDTSGGLLAAGKDPANASAGQIASLEAAVSG 239

Query: 240 EIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSET 299
            I+ NI K L  +LG+DNF+ +V A+LN D ++I E +YDP+S+VERS+R  +  + S+ 
Sbjct: 240 RIQENIRKTLTPYLGLDNFQVSVAADLNTDRRRIAETIYDPESRVERSVRTLRQNEMSQN 299

Query: 300 SQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSI 359
           S  E+  TV+QN+P  +       RS E   ++EE  NYEI++K+I T+ D Y +ERLSI
Sbjct: 300 SSTETPTTVQQNLPDETVTAENGERSSEENQRREETVNYEISSKTIETSQDGYSVERLSI 359

Query: 360 AVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLF 419
           AV+V++ RL   LG S D   + + L EI ++V+++ G++SRRGD I ++ +DF+     
Sbjct: 360 AVLVDRARLEASLGGSPDPDTVAAQLVEIEQLVASSAGVSSRRGDVIKVSVVDFVNGGRA 419

Query: 420 NSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSI 479
                 +S  ++L R    +INA   L    L+ + GL     +     +      G+  
Sbjct: 420 MEPVPPMSVSELLIRQSGNLINAFAILTVAGLLIWFGLRPALAVLVPQKSAAPAEIGELA 479

Query: 480 LSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINE 539
           +                       + Q        +   + + +++    +L  +++++E
Sbjct: 480 MMT----------EGEGLAGEFSEARQLAGPDHSGMLQDLTNKLNQSPLKKLESLLDLDE 529

Query: 540 ERFAKILRKWARS 552
           ++ A IL++W   
Sbjct: 530 QQSAAILKQWMYE 542


>gi|296107351|ref|YP_003619051.1| flagellar M-ring protein FliF [Legionella pneumophila 2300/99
           Alcoy]
 gi|295649252|gb|ADG25099.1| flagellar M-ring protein FliF [Legionella pneumophila 2300/99
           Alcoy]
          Length = 544

 Score =  349 bits (894), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 121/574 (21%), Positives = 229/574 (39%), Gaps = 57/574 (9%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           MA+ D          SL   R + +   +   I + +A   +   P Y  LY +L   D 
Sbjct: 1   MALADNASVAATKFASLSIPRQVGVLFGLAASIAIGVAVVLWSRDPSYVPLYSQLNAQDS 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNS- 119
           + I   L   +IDF+I  N   + VP+  +  AR+ LAAQGLP   +  G++L       
Sbjct: 61  SEILTILERNSIDFKIDKNNGLLMVPADELQSARLKLAAQGLPRD-TAIGHDLLGSSGGV 119

Query: 120 FGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA 179
           F  + FM+     +ALE E+ARTI   + I +ARVH+ +P   +F +    P+ASV I  
Sbjct: 120 FNTSQFMENARYRQALEAELARTISKFNNIKSARVHLAIPRESAFVRDSQEPSASVFIDV 179

Query: 180 INPSVYK--SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKS--LSIVQ 235
            +    K  +  AI +LVA+++PNL  G VTV+D  G+LL               L   Q
Sbjct: 180 YSGFEIKKHTIAAIVNLVASSIPNLSAGRVTVVDQDGQLLNEGSGYNLFSETERFLDYRQ 239

Query: 236 AIQHEIEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQ 295
            ++H+    I   L   LG    R+ V A+++  + +  + +++P+    RS +  ++++
Sbjct: 240 NLEHQYAQKIQDILTPILGYGRVRAKVSADIDFTSYEQTQELFNPELSALRSEQTMQESR 299

Query: 296 RSETSQPESAVTVEQNMPHVSDRKVPLPRSLENTD------------------KKEEQSN 337
            +   +         N P  +          +N                    + +   N
Sbjct: 300 NASN-EASGVPGTLSNTPQPNSSLGQKNNPQQNATPNNLPQQTSSDQMQAKDVRMQTTKN 358

Query: 338 YEINTKSIATTHDNYKLERLSIAVVVNKGRLTEVLGRS-ADQGKIDSYLAEINKIVSAAT 396
           +E++     T +    ++RLS+AV+V+   +     +    +      + +I  +VS A 
Sbjct: 359 FELDKTISHTKNQPGTIKRLSVAVLVDNRPVMNDKTKKLEKKPLTKEEIEQIKLLVSDAI 418

Query: 397 GINSRRGDTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLG 456
           G+N +RGD++ + +  F++     +   +  +       F +VI  +   +  L + F  
Sbjct: 419 GLNVKRGDSLNVINSSFVKPDPIEAIPEEHFWQ---KDSFWSVIKQIGGALFILAILFGV 475

Query: 457 LHALRRLHNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQ 516
           L  + +    +                   +  T     +  I+                
Sbjct: 476 LRPMLKTLASNK-----------DMDQATDNQDTGDFTLDGKISFR-------------- 510

Query: 517 SRINSYVSKQSDLRLLHMIEINEERFAKILRKWA 550
              +    +     L  +++   +R A++++ W 
Sbjct: 511 ---DVQDYETQLSLLRQVVDKEPKRVAQVVKSWV 541


>gi|284007155|emb|CBA72437.1| flagellar M-ring protein FliF [Arsenophonus nasoniae]
          Length = 554

 Score =  349 bits (894), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 137/565 (24%), Positives = 236/565 (41%), Gaps = 35/565 (6%)

Query: 5   DQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRIS 64
           + L         +     + L     + I  F+AA F++    Y  +Y  L   D   I 
Sbjct: 10  NPLKGLSTIFDKIKSDPKVPLIVAGALAITFFIAAMFWLQGADYRPVYTNLSDKDGGEIV 69

Query: 65  VALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTS 124
             LS+ NI +++S +GS + VP+  V + R+ LA QGLP    N+G+EL D+   FGL+ 
Sbjct: 70  TQLSQMNIPYQLSADGSMVKVPADQVHEVRLKLAQQGLPK-GGNAGFELLDQE-KFGLSQ 127

Query: 125 FMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRA--INP 182
           F ++I   RALEGE+A+TI+S+  +  ARVH+ +P    F +    PTASV +       
Sbjct: 128 FSEQINYQRALEGELAKTIESLGVVQRARVHLAIPKPSLFVREQKNPTASVTLNLQNGRK 187

Query: 183 SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEM-ERNILGKSLSIVQAIQHEI 241
                  AI H+++++V  L   +VT++D  G LLT  +   R++    L+ VQ+I++  
Sbjct: 188 LDEGQIAAIVHMISSSVSGLASSNVTIVDQLGNLLTQPDGISRDLNLTQLNYVQSIENRY 247

Query: 242 EMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ 301
           +  I   +   +G  N  + V A++N    +     Y P+     S   SK   RSE + 
Sbjct: 248 KQRIESIIMPLVGRGNVHAQVTAQINFARTEETAEEYKPNQPPNESAVRSKQTSRSEQNG 307

Query: 302 P---ESAVTVEQNMPH---------VSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTH 349
                       N P           +D+  P P +  +  + +E +NYEI+ +   T H
Sbjct: 308 QLLVGGVPGALSNQPTPAPKAPIDKPNDKNAPQPINNNHNSRVDETTNYEIDRRIRHTQH 367

Query: 350 DNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITIT 409
               L+RLS+A++VN     +     +     D  L +I  +   A   + +RGD++ + 
Sbjct: 368 QIGNLQRLSVAIIVNYADSDKKENDDSL-PLTDEKLTQIKTLAQEAMEFSEQRGDSLYVV 426

Query: 410 SMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDA 469
           +  F                       A V+    +L+  LL   L    ++   +    
Sbjct: 427 NAPFQAQDAELKPLE----FWQQPVFIANVLEIGRYLLLLLLAWLLWRLVVKPQLHKKRQ 482

Query: 470 KKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDL 529
            +      + L     +       +  D  A               + R+N+ +  Q   
Sbjct: 483 AEKAAKMAAELKVKKDAEQAARQKIEQDEAA----------RQEQTRQRVNAEMHTQ--- 529

Query: 530 RLLHMIEINEERFAKILRKWARSEI 554
           RL  M++ +    A ++R W   E+
Sbjct: 530 RLREMVQKDPRVVAMVVRDWMSKEL 554


>gi|213419965|ref|ZP_03353031.1| flagellar MS-ring protein [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
          Length = 551

 Score =  348 bits (893), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 122/563 (21%), Positives = 220/563 (39%), Gaps = 52/563 (9%)

Query: 11  FKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVALSEA 70
            +    L     + L       + + +A   +  +P Y  L+  L   D   I   L++ 
Sbjct: 14  LEWLNRLRANPRIPLIVAGSAAVAIVVAMVLWAKTPDYRTLFSNLSDQDGGAIVAQLTQM 73

Query: 71  NIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFMQEIT 130
           NI +R ++   +I VP+  V + R+ LA QGLP   +  G+EL D+   FG++ F +++ 
Sbjct: 74  NIPYRFANGSGAIEVPADKVHELRLRLAQQGLPKGGA-VGFELLDQE-KFGISQFSEQVN 131

Query: 131 RVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK--SA 188
             RALEGE+ARTI+++  + +ARVH+ MP    F +    P+ASV +             
Sbjct: 132 YQRALEGELARTIETLGPVKSARVHLAMPKPSLFVREQKSPSASVTVTLEPGRALDEGQI 191

Query: 189 EAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANE-MERNILGKSLSIVQAIQHEIEMNINK 247
            A+ HLV++AV  L  G+VT++D +G LLT +    R++    L     ++  I+  I  
Sbjct: 192 SAVVHLVSSAVAGLPPGNVTLVDQSGHLLTQSNTSGRDLNDAQLKFANDVESRIQRRIEA 251

Query: 248 ALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQ---PES 304
            L+  +G  N  + V A+L+   ++  E  Y P+    ++   S+    SE      P  
Sbjct: 252 ILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVGAGYPGG 311

Query: 305 AVTVEQNMP---------------------HVSDRKVPLPRSLENTDKKEEQSNYEINTK 343
                 N P                       +        +     ++ E SNYE++  
Sbjct: 312 VPGALSNQPAPPNEAPIATPPTNQQNAQNTPQTSTSTNSNNAGPRNTQRNETSNYEVDRT 371

Query: 344 SIATTHDNYKLERLSIAVVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRG 403
              T  +   +ERLS+AVVVN   L +              + +I  +   A G + +RG
Sbjct: 372 IRHTKMNVGDIERLSVAVVVNYKTLADGK----PLPLTADQMKQIEDLTREAMGFSDKRG 427

Query: 404 DTITITSMDFLENQLFNSGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRL 463
           DT+ + +  F                         ++ A  +L+  ++   L   A+   
Sbjct: 428 DTLNVVNSPFSAVDNTGGELP----FWQQQSFIDQLLAAGRWLLVLVVAWILWRKAVHPQ 483

Query: 464 HNIDDAKKGEVGGKSILSPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYV 523
                 +      ++ +                +       ++D     R    R+ + V
Sbjct: 484 LTRRVEEAKAAQEQAQVR------------QETEEAVEVRLSKDEQLQQRRANQRLGAEV 531

Query: 524 SKQSDLRLLHMIEINEERFAKIL 546
             Q   R+  M + +    A ++
Sbjct: 532 MSQ---RIREMSDNDPRVVALVI 551


>gi|328542763|ref|YP_004302872.1| flagellar M-ring protein [polymorphum gilvum SL003B-26A1]
 gi|326412509|gb|ADZ69572.1| Flagellar M-ring protein [Polymorphum gilvum SL003B-26A1]
          Length = 538

 Score =  348 bits (893), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 134/549 (24%), Positives = 240/549 (43%), Gaps = 16/549 (2%)

Query: 7   LLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRISVA 66
           +    +   +LG TR+  + +V  + I +F    F V +P    LY  L + D + I   
Sbjct: 1   MNGLVEFIRTLGPTRVAAMGAVAAILIGVFAFIIFRVTAPQMTQLYSDLTLEDSSAIVNQ 60

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLTSFM 126
           L    I F +  +G++I +P   V + R+ LA +GLP+  S  GYE+FD+ ++ G TSF+
Sbjct: 61  LESLGIPFELKRDGATIMIPKEQVARVRMRLAEEGLPTGGS-IGYEIFDRSDTLGATSFV 119

Query: 127 QEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYK 186
           Q I  +RA+EGE+ARTI+S+  IV+ARVH+V+P+   F++    P+AS+ I+        
Sbjct: 120 QNINHLRAMEGELARTIRSLDRIVSARVHLVIPERQLFQRDRRPPSASIAIKTRGSLGQN 179

Query: 187 SAEAIRHLVAAAVPNLDMGDVTVLDSTGKLL---TANEMERNILGKSLSIVQAIQHEIEM 243
              AI+HLVAAAV  L    V+++D TG+LL   +    E  +          I+  ++ 
Sbjct: 180 EIRAIQHLVAAAVDGLGPERVSIVDDTGRLLATGSDESAEGIVASSLQERTFEIEQRLKN 239

Query: 244 NINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPE 303
            I + L + +G    R  V AE++ +        +DP+ +V RS +  +++  S + Q  
Sbjct: 240 QIEEILNSVVGPGRARVRVAAEVDFNRITETSEKFDPEGQVVRSTQSKEESSTSISRQAG 299

Query: 304 SAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVV 363
             V    N    ++         E ++  EE  N+EI+        +  +++RLS+AV+V
Sbjct: 300 VTVG---NQIPNAEADAGEGGDREGSNLAEEIVNFEISKSVRTEVVEAGRIKRLSVAVLV 356

Query: 364 NKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFNSGT 423
           +        G      +    L  I  +V +A G ++ RGD + + ++ F +    +  +
Sbjct: 357 DGVYSPNESGEVQYAPRTQEVLDRIAVLVRSAVGFDAARGDVVEVVNLRFAQAPEPDFDS 416

Query: 424 VQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSILSPP 483
                 +             V L+ +LL+    +  L R     + K  +    +     
Sbjct: 417 ASAGLFEFTRDDVLRFAELGVLLLISLLLLLFVVRPLLRRIVTPEEKAPQELVIAPDGTL 476

Query: 484 PISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEERFA 543
                V       D+  +              +++    +   S  ++  MI+       
Sbjct: 477 VAEVEVPAEAKEEDDEVV---------IEWLEEAKAQGALQASSIAKVGAMIDDYPTEAV 527

Query: 544 KILRKWARS 552
            I+R W   
Sbjct: 528 TIVRGWLEE 536


>gi|167626144|ref|YP_001676438.1| flagellar MS-ring protein [Shewanella halifaxensis HAW-EB4]
 gi|167356166|gb|ABZ78779.1| flagellar M-ring protein FliF [Shewanella halifaxensis HAW-EB4]
          Length = 572

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 117/571 (20%), Positives = 210/571 (36%), Gaps = 33/571 (5%)

Query: 5   DQLLQFFKSGTSLGRT-RILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDVNRI 63
           D+L    +      R  R     +++ +     +    +     Y  LY   E  + + I
Sbjct: 20  DRLNSLKQKWHQFSRGDRHAATLAILAIVAACVIVLMLWSTGQGYSPLYGNQENVETSHI 79

Query: 64  SVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSFGLT 123
              L    I +R+