RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780695|ref|YP_003065108.1| flagellar MS-ring protein [Candidatus Liberibacter asiaticus str. psy62] (563 letters) >1yj7_A ESCJ; mixed alpha/beta, extended linker, protein transport; 1.80A {Escherichia coli} (A:69-171) Length = 103 Score = 102 bits (256), Expect = 1e-22 Identities = 16/108 (14%), Positives = 44/108 (40%), Gaps = 7/108 (6%) Query: 113 LFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPT 172 +F + + + E +I R + I G++ V + + + + Sbjct: 2 IFPP-SQLVASPSQENAKINYLKEQDIERLLSKIPGVIDCSVSLNVNN-----NESQPSS 55 Query: 173 ASVMIRAINP-SVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTA 219 A+V++ + ++ S I++LV +V +L + +++V+ + Sbjct: 56 AAVLVISSPEVNLAPSVIQIKNLVKNSVDDLKLENISVVIKSSSGQDG 103 >1yj7_A ESCJ; mixed alpha/beta, extended linker, protein transport; 1.80A {Escherichia coli} (A:1-68) Length = 68 Score = 31.2 bits (71), Expect = 0.33 Identities = 11/60 (18%), Positives = 22/60 (36%), Gaps = 3/60 (5%) Query: 50 NLYVKLEVSDVNRISVALSEANIDF---RISDNGSSISVPSSMVGKARIHLAAQGLPSSS 106 LY L + N++ L +++ ++SV ++ +A L G P Sbjct: 4 QLYTGLTEKEANQMQALLLSNDVNVSKEMDKSGNMTLSVAAADFVRAITILNNNGFPKKK 63 >3l84_A Transketolase; TKT, structural genomics, center for structural genomics of infectious diseases, csgid, transferase; HET: MSE; 1.36A {Campylobacter jejuni} (A:508-632) Length = 125 Score = 26.8 bits (59), Expect = 7.3 Identities = 9/89 (10%), Positives = 22/89 (24%), Gaps = 5/89 (5%) Query: 194 LVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKALAAFL 253 L +A V+ L + + V ++ + K Sbjct: 34 LESANELEKQGFACNVVSXPCFELFEKQDKAYQERLLKGEVIGVEAAHSNELYKFCHKVY 93 Query: 254 GVDNF-----RSAVVAELNMDTQQIREIV 277 G+++F V ++ + Sbjct: 94 GIESFGESGKDKDVFERFGFSVSKLVNFI 122 >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A (A:1-200,A:283-322) Length = 240 Score = 26.7 bits (58), Expect = 8.1 Identities = 10/53 (18%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 239 HEIEMNINKALAAFLGVDNFRSAVVA-ELNMDTQQIREIVYDPDSKVERSIRL 290 H+ I+ AA + +N+R + A E+ T + + + L Sbjct: 140 HDKLSKIDPKAAAAIHPNNYRRVIRALEIIKLTGKTVTEQARHEEETPSPYNL 192 >3cu7_A Complement C5; Mg domain, inflammation, anaphylatoxin, cleavage on PAIR of basic residues, complement alternate pathway, complement pathway; HET: NAG; 3.10A {Homo sapiens} PDB: 3kls_A* 3km9_A* 1xwe_A (A:226-349) Length = 124 Score = 26.4 bits (58), Expect = 10.0 Identities = 11/68 (16%), Positives = 25/68 (36%) Query: 306 VTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIAVVVNK 365 +T D+K + +++NT + ++++ Y LE L+ + Sbjct: 42 ITFGIREDLKDDQKEMMQTAMQNTMLINGIAQVTFDSETAVKELSYYSLEDLNNKYLYIA 101 Query: 366 GRLTEVLG 373 + E G Sbjct: 102 VTVIESTG 109 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.317 0.131 0.353 Gapped Lambda K H 0.267 0.0599 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 3,835,257 Number of extensions: 164741 Number of successful extensions: 434 Number of sequences better than 10.0: 1 Number of HSP's gapped: 432 Number of HSP's successfully gapped: 9 Length of query: 563 Length of database: 4,956,049 Length adjustment: 93 Effective length of query: 470 Effective length of database: 1,812,184 Effective search space: 851726480 Effective search space used: 851726480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 57 (26.0 bits)