RPSBLAST alignment of GI: 254780695 and protein with PDBid: 2pff

>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688
 Score = 40.2 bits (93), Expect = 0.001
 Identities = 69/289 (23%), Positives = 116/289 (40%), Gaps = 61/289 (21%)

Query: 47  HYDNLYVK-------LEVSDVNRISVALSEANIDFRISD---NGSSISVPSSMVG---KA 93
           +Y ++Y K       L V   N+ S    EA I+F I D   NG         +G    A
Sbjct: 518 YYQSIYAKYGAKGSTLIVVPFNQGSKQDVEALIEF-IYDTEKNGG--------LGWDLDA 568

Query: 94  RIHLAAQGLPSSSSNSGYEL--FDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVA 151
            I  AA  +P      G EL   D  + F     +  I R   + G + +  +S  GI  
Sbjct: 569 IIPFAA--IPEQ----GIELEHIDSKSEFAHRIMLTNILR---MMGCVKKQ-KSARGIET 618

Query: 152 ARVHIVMP---DMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVT 208
               +++P   + G+F   G    + + +  +    +  + A +  V  A+     G   
Sbjct: 619 RPAQVILPMSPNHGTFGGDGMYSESKLSLETLFNRWHSESWANQLTVCGAIIGWTRG--- 675

Query: 209 VLDSTGKLLTANEMERNILGK---SLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAE 265
               TG L++AN    NI+ +    + +    Q E+  N+   L   +     +S V+A+
Sbjct: 676 ----TG-LMSAN----NIIAEGIEKMGVRTFSQKEMAFNLLGLLTPEVVELCQKSPVMAD 726

Query: 266 LNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPH 314
           LN   Q      + P+ K E + +L K+    ETS+   AV++E  + H
Sbjct: 727 LNGGLQ------FVPELK-EFTAKLRKEL--VETSEVRKAVSIETALEH 766