RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254780695|ref|YP_003065108.1| flagellar MS-ring protein
[Candidatus Liberibacter asiaticus str. psy62]
         (563 letters)



>1yj7_A ESCJ; mixed alpha/beta, extended linker, protein transport; 1.80A
           {Escherichia coli}
          Length = 171

 Score =  130 bits (327), Expect = 1e-30
 Identities = 27/168 (16%), Positives = 66/168 (39%), Gaps = 10/168 (5%)

Query: 51  LYVKLEVSDVNRISVALSEANIDFRIS---DNGSSISVPSSMVGKARIHLAAQGLPSSSS 107
           LY  L   + N++   L   +++           ++SV ++   +A   L   G P    
Sbjct: 5   LYTGLTEKEANQMQALLLSNDVNVSKEMDKSGNMTLSVAAADFVRAITILNNNGFPKKKF 64

Query: 108 NSGYELFDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKI 167
            +  E+    +    +   +        E +I R +  I G++   V + +         
Sbjct: 65  -ADIEVIFPPSQLVASPSQENAKINYLKEQDIERLLSKIPGVIDCSVSLNVN-----NNE 118

Query: 168 GARPTASVMIRAI-NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTG 214
               +A+V++ +    ++  S   I++LV  +V +L + +++V+  + 
Sbjct: 119 SQPSSAAVLVISSPEVNLAPSVIQIKNLVKNSVDDLKLENISVVIKSS 166


>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 58.8 bits (142), Expect = 3e-09
 Identities = 75/487 (15%), Positives = 142/487 (29%), Gaps = 179/487 (36%)

Query: 13  SGTSLGRTRILIL--ASV---ILVPIMLFMAARFFVNSPHYDNLYVKL-EVSDVNRISVA 66
              S    R L L   S+   +LVP   F  A     S   +     L E ++       
Sbjct: 2   DAYST---RPLTLSHGSLEHVLLVPTASFFIA-----SQLQEQFNKILPEPTE------- 46

Query: 67  LSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKV-----NSFG 121
                 D   +   +   +    +G    ++++   PS         FD+V       F 
Sbjct: 47  --GFAADDEPT---TPAELVGKFLG----YVSSLVEPSKVG-----QFDQVLNLCLTEFE 92

Query: 122 LTSFMQ--EI-TRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKI--------GAR 170
              +++  +I      L  E   T+     ++   +   +     F K            
Sbjct: 93  -NCYLEGNDIHALAAKLLQENDTTLVKTKELIKNYITARIMAKRPFDKKSNSALFRAVGE 151

Query: 171 PTASVMIRAI-----NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKL---LTANEM 222
             A ++  AI     N   Y   E +R L       +      ++  + +    L    +
Sbjct: 152 GNAQLV--AIFGGQGNTDDY--FEELRDLYQTYHVLVG----DLIKFSAETLSELIRTTL 203

Query: 223 ERN-ILGKSLSIVQAIQHE-------------IEMNINK--ALAAF------LGVD--NF 258
           +   +  + L+I++ +++              I   +     LA +      LG      
Sbjct: 204 DAEKVFTQGLNILEWLENPSNTPDKDYLLSIPISCPLIGVIQLAHYVVTAKLLGFTPGEL 263

Query: 259 RS---------------AVVAELNMDTQQIREIVYDPDSKVERSIRLSKDA--------Q 295
           RS                 +AE               DS  E      + A         
Sbjct: 264 RSYLKGATGHSQGLVTAVAIAE--------------TDSW-ESFFVSVRKAITVLFFIGV 308

Query: 296 RSE-----TSQPESAV--TVEQN------MPHVSDRKVPLPRS-LENTDKKEEQSNYEIN 341
           R       TS P S +  ++E N      M  +S+    L +  ++              
Sbjct: 309 RCYEAYPNTSLPPSILEDSLENNEGVPSPMLSISN----LTQEQVQ-------------- 350

Query: 342 TKSIATTHDNYKL---ERLSIAVVVNKGRLTEVLG---RSADQGKIDSYLAEINKIVSAA 395
              +  T  N  L   +++ I+ +VN G    V+    +S   G ++  L +      A 
Sbjct: 351 -DYVNKT--NSHLPAGKQVEIS-LVN-GAKNLVVSGPPQSL-YG-LNLTLRKA----KAP 399

Query: 396 TGINSRR 402
           +G++  R
Sbjct: 400 SGLDQSR 406



 Score = 45.3 bits (107), Expect = 4e-05
 Identities = 63/350 (18%), Positives = 104/350 (29%), Gaps = 139/350 (39%)

Query: 4   LDQLLQFFKSGTSLG------RTRI---------LILASVILVPIMLFMAA-----RFFV 43
           + QL  +  +   LG      R+ +         L+ A  I        A       FFV
Sbjct: 243 VIQLAHYVVTAKLLGFTPGELRSYLKGATGHSQGLVTAVAI--------AETDSWESFFV 294

Query: 44  NSPHYDNLYVKLEVSDVNRISV---------ALSEANIDFRISDNGSSISVPSSMVGKAR 94
           +         +  ++ +  I V         +L  + ++  + +N     VPS M     
Sbjct: 295 SV--------RKAITVLFFIGVRCYEAYPNTSLPPSILEDSL-ENNE--GVPSPM----- 338

Query: 95  IHLAAQGLPSSSSNSGYELFDKVNSF-------------GLTSFMQEITRV-----RALE 136
             L+   L         +  +K NS              G  +       V     ++L 
Sbjct: 339 --LSISNLTQEQVQ---DYVNKTNSHLPAGKQVEISLVNGAKNL------VVSGPPQSLY 387

Query: 137 G--EIARTIQSISGIVAARVHIVMPDMGSFRK--IGAR--PTASVMIRAINP--SVY--K 186
           G     R  ++ SG+  +R+    P   S RK     R  P AS       P  S     
Sbjct: 388 GLNLTLRKAKAPSGLDQSRI----P--FSERKLKFSNRFLPVAS-------PFHSHLLVP 434

Query: 187 SAEAIRHLVAAAVPNLDMGD--VTVLDS-TGKLLTANEMERNILGKSLSIVQAIQHEIEM 243
           +++ I   +     + +  D  + V D+  G  L    +  +I      IV  I      
Sbjct: 435 ASDLINKDLVKNNVSFNAKDIQIPVYDTFDGSDL--RVLSGSISE---RIVDCIIRL--- 486

Query: 244 NIN--KALA--A-----F-------LGVDNFRSAVVAELNMDTQQIREIV 277
            +         A     F       LGV      +    N D   +R IV
Sbjct: 487 PVKWETTTQFKATHILDFGPGGASGLGV------LTHR-NKDGTGVRVIV 529



 Score = 44.2 bits (104), Expect = 9e-05
 Identities = 71/467 (15%), Positives = 135/467 (28%), Gaps = 178/467 (38%)

Query: 187 SAEAIRHLVAAAVPNLDMG--DVTVLDSTGKLLTANEMERNILGKSLSIV-QAIQHEIEM 243
            A + R L       L  G  +  +L  T     A+++ +    K L    +    + E 
Sbjct: 2   DAYSTRPLT------LSHGSLEHVLLVPTASFFIASQL-QEQFNKILPEPTEGFAADDEP 54

Query: 244 NINKALAA-FLGVDNFRSAVVAELNMDTQ----QIREIVYDPDSKVERSIRLSKDAQRSE 298
                L   FLG   +   V + +         Q+  +      + E       D     
Sbjct: 55  TTPAELVGKFLG---Y---VSSLVEPSKVGQFDQVLNLCLT---EFENCYLEGNDIH--- 102

Query: 299 TSQPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNY----EINTKSIATTHDNYKL 354
                    +   +    +    L +       KE   NY     +  +      ++   
Sbjct: 103 --------ALAAKLL--QENDTTLVK------TKELIKNYITARIMAKRPFDKKSNS--- 143

Query: 355 ERLSIAVVVNKGRLTEVLGRSADQGKIDSY---LAEINK---------IVSAATGIN--S 400
             L  AV     +L  + G    QG  D Y   L ++ +         I  +A  ++   
Sbjct: 144 -ALFRAVGEGNAQLVAIFG---GQGNTDDYFEELRDLYQTYHVLVGDLIKFSAETLSELI 199

Query: 401 RRGDTITITSMDFLENQLFNSGTVQVSFMDILS----------RHFATVINALV-F-LVG 448
           R               ++F  G      ++IL           + +  +++  +   L+G
Sbjct: 200 RTTLDA---------EKVFTQG------LNILEWLENPSNTPDKDY--LLSIPISCPLIG 242

Query: 449 TL-LVTF------LGLH--ALR-RLHNIDDAKKGEVGGKS--ILSPPPISS--------- 487
            + L  +      LG     LR  L       KG   G S  +++   I+          
Sbjct: 243 VIQLAHYVVTAKLLGFTPGELRSYL-------KG-ATGHSQGLVTAVAIAETDSWESFFV 294

Query: 488 ----AVT----TGL-----MPNDNIALDSSNQDIFSH--------------SRN-LQSRI 519
               A+T     G+      PN ++   S  +D   +              ++  +Q  +
Sbjct: 295 SVRKAITVLFFIGVRCYEAYPNTSLP-PSILEDSLENNEGVPSPMLSISNLTQEQVQDYV 353

Query: 520 ---NSYV--SKQSDLRLLHMIEINEER-------------FAKILRK 548
              NS++   KQ ++ L     +N  +                 LRK
Sbjct: 354 NKTNSHLPAGKQVEISL-----VNGAKNLVVSGPPQSLYGLNLTLRK 395


>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty
           acid synthase, acyl-carrier-protein, beta-ketoacyl
           reductase, beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 1688

 Score = 40.2 bits (93), Expect = 0.001
 Identities = 69/289 (23%), Positives = 116/289 (40%), Gaps = 61/289 (21%)

Query: 47  HYDNLYVK-------LEVSDVNRISVALSEANIDFRISD---NGSSISVPSSMVG---KA 93
           +Y ++Y K       L V   N+ S    EA I+F I D   NG         +G    A
Sbjct: 518 YYQSIYAKYGAKGSTLIVVPFNQGSKQDVEALIEF-IYDTEKNGG--------LGWDLDA 568

Query: 94  RIHLAAQGLPSSSSNSGYEL--FDKVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVA 151
            I  AA  +P      G EL   D  + F     +  I R   + G + +  +S  GI  
Sbjct: 569 IIPFAA--IPEQ----GIELEHIDSKSEFAHRIMLTNILR---MMGCVKKQ-KSARGIET 618

Query: 152 ARVHIVMP---DMGSFRKIGARPTASVMIRAINPSVYKSAEAIRHLVAAAVPNLDMGDVT 208
               +++P   + G+F   G    + + +  +    +  + A +  V  A+     G   
Sbjct: 619 RPAQVILPMSPNHGTFGGDGMYSESKLSLETLFNRWHSESWANQLTVCGAIIGWTRG--- 675

Query: 209 VLDSTGKLLTANEMERNILGK---SLSIVQAIQHEIEMNINKALAAFLGVDNFRSAVVAE 265
               TG L++AN    NI+ +    + +    Q E+  N+   L   +     +S V+A+
Sbjct: 676 ----TG-LMSAN----NIIAEGIEKMGVRTFSQKEMAFNLLGLLTPEVVELCQKSPVMAD 726

Query: 266 LNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPH 314
           LN   Q      + P+ K E + +L K+    ETS+   AV++E  + H
Sbjct: 727 LNGGLQ------FVPELK-EFTAKLRKEL--VETSEVRKAVSIETALEH 766


>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant
           photosynthetic reaction center, peripheral antenna; HET:
           CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1
          Length = 154

 Score = 34.6 bits (78), Expect = 0.068
 Identities = 10/43 (23%), Positives = 19/43 (44%), Gaps = 15/43 (34%)

Query: 269 DTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAV--TVE 309
           + Q ++        K++ S++L  D      S P  A+  T+E
Sbjct: 18  EKQALK--------KLQASLKLYAD-----DSAPALAIKATME 47



 Score = 28.0 bits (61), Expect = 5.2
 Identities = 5/26 (19%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 66 ALS--EANIDFRISDNGSSISVPSSM 89
          AL   +A++     D+  ++++ ++M
Sbjct: 21 ALKKLQASLKLYADDSAPALAIKATM 46


>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic
           vesicle, membrane, Ca structural protein; 7.94A {Bos
           taurus}
          Length = 190

 Score = 31.1 bits (69), Expect = 0.79
 Identities = 21/87 (24%), Positives = 38/87 (43%), Gaps = 22/87 (25%)

Query: 263 VAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTV-EQNMPHVSDRKVP 321
           +A+ +  TQ+       P+S     IR  ++ QR    + ++A  V EQ      + +  
Sbjct: 74  IAQADRLTQE-------PES-----IRKWREEQRKRLQELDAASKVMEQ------EWREK 115

Query: 322 LPRSLE--NTDKKEEQSNYEINTKSIA 346
             + LE  N  + E+    +IN + IA
Sbjct: 116 AKKDLEEWNQRQSEQVEKNKINNR-IA 141


>3hq1_A 2-isopropylmalate synthase; LEUA, mycobacterium tuberculosis
           inhibition, bromopyruvate, amino-acid biosynthesis; HET:
           FLC; 1.70A {Mycobacterium tuberculosis H37RV} PDB:
           1sr9_A 3hpz_A 3hps_A* 3fig_A 3hpx_A
          Length = 644

 Score = 29.3 bits (65), Expect = 2.3
 Identities = 14/68 (20%), Positives = 21/68 (30%), Gaps = 7/68 (10%)

Query: 132 VRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAINPSVYKSAEAI 191
            +     I RT Q+ SG   A VH         R++  R   + +            +  
Sbjct: 144 TQCRPELIERTFQACSGAPRAIVHFYNSTSILQRRVVFRANRAEVQAIA-------TDGA 196

Query: 192 RHLVAAAV 199
           R  V  A 
Sbjct: 197 RKCVEQAA 204


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.317    0.131    0.353 

Gapped
Lambda     K      H
   0.267   0.0667    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 4,412,381
Number of extensions: 200533
Number of successful extensions: 603
Number of sequences better than 10.0: 1
Number of HSP's gapped: 598
Number of HSP's successfully gapped: 19
Length of query: 563
Length of database: 5,693,230
Length adjustment: 97
Effective length of query: 466
Effective length of database: 3,341,562
Effective search space: 1557167892
Effective search space used: 1557167892
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (26.6 bits)