BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780695|ref|YP_003065108.1| flagellar MS-ring protein
[Candidatus Liberibacter asiaticus str. psy62]
         (563 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780695|ref|YP_003065108.1| flagellar MS-ring protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 563

 Score = 1140 bits (2950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/563 (100%), Positives = 563/563 (100%)

Query: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60
           MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV
Sbjct: 1   MAILDQLLQFFKSGTSLGRTRILILASVILVPIMLFMAARFFVNSPHYDNLYVKLEVSDV 60

Query: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120
           NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF
Sbjct: 61  NRISVALSEANIDFRISDNGSSISVPSSMVGKARIHLAAQGLPSSSSNSGYELFDKVNSF 120

Query: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180
           GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI
Sbjct: 121 GLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTASVMIRAI 180

Query: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHE 240
           NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHE
Sbjct: 181 NPSVYKSAEAIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHE 240

Query: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300
           IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS
Sbjct: 241 IEMNINKALAAFLGVDNFRSAVVAELNMDTQQIREIVYDPDSKVERSIRLSKDAQRSETS 300

Query: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360
           QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA
Sbjct: 301 QPESAVTVEQNMPHVSDRKVPLPRSLENTDKKEEQSNYEINTKSIATTHDNYKLERLSIA 360

Query: 361 VVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN 420
           VVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN
Sbjct: 361 VVVNKGRLTEVLGRSADQGKIDSYLAEINKIVSAATGINSRRGDTITITSMDFLENQLFN 420

Query: 421 SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL 480
           SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL
Sbjct: 421 SGTVQVSFMDILSRHFATVINALVFLVGTLLVTFLGLHALRRLHNIDDAKKGEVGGKSIL 480

Query: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540
           SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE
Sbjct: 481 SPPPISSAVTTGLMPNDNIALDSSNQDIFSHSRNLQSRINSYVSKQSDLRLLHMIEINEE 540

Query: 541 RFAKILRKWARSEIEDRYTQHIS 563
           RFAKILRKWARSEIEDRYTQHIS
Sbjct: 541 RFAKILRKWARSEIEDRYTQHIS 563


>gi|254780186|ref|YP_003064599.1| glutaminase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 311

 Score = 26.9 bits (58), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 14/59 (23%), Positives = 31/59 (52%)

Query: 116 KVNSFGLTSFMQEITRVRALEGEIARTIQSISGIVAARVHIVMPDMGSFRKIGARPTAS 174
           +++ FG++  +++ T     E E   +IQSIS +    + +   D   ++++G  P+ S
Sbjct: 34  RIDHFGMSLALEDGTVYSVGESEFLFSIQSISKVFLLTIALRKFDEEIWKRVGREPSGS 92


>gi|254780859|ref|YP_003065272.1| NADH dehydrogenase subunit G [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 700

 Score = 26.6 bits (57), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 8/77 (10%)

Query: 190 AIRHLVAAAVPNLDMGDVTVLDSTGKLLTANEMERNILGKSLSIVQAIQHEIEMNINKAL 249
           A+ H VA+ V  LD+G V   D      T N M  NIL K+  +      E++ +  +AL
Sbjct: 490 AVLHTVASRVGALDLGFVPADD------TINAM--NILDKTDIVFLLGADELDFSDKQAL 541

Query: 250 AAFLGVDNFRSAVVAEL 266
             ++G    R A  A++
Sbjct: 542 TVYIGSHGDRGAQSADV 558


>gi|254780172|ref|YP_003064585.1| general L-amino acid transport system permease protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 386

 Score = 25.0 bits (53), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 15/23 (65%)

Query: 243 MNINKALAAFLGVDNFRSAVVAE 265
            +++K L A LGV  F SA +AE
Sbjct: 244 WDVDKLLRALLGVSAFASAYIAE 266


>gi|254781222|ref|YP_003065635.1| hypothetical protein CLIBASIA_05645 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 70

 Score = 24.3 bits (51), Expect = 5.2,   Method: Composition-based stats.
 Identities = 10/23 (43%), Positives = 13/23 (56%)

Query: 454 FLGLHALRRLHNIDDAKKGEVGG 476
           F   H +R L   +D KKG +GG
Sbjct: 44  FSECHRIRALRGFNDVKKGALGG 66


>gi|254780289|ref|YP_003064702.1| RNA polymerase sigma factor RpoD [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 682

 Score = 24.3 bits (51), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 26/47 (55%)

Query: 271 QQIREIVYDPDSKVERSIRLSKDAQRSETSQPESAVTVEQNMPHVSD 317
           ++ R+ V + +  +E + ++SKD +    S PE+A   E+N+    D
Sbjct: 217 EKERDDVQETEGDIESAAKVSKDDRSKVDSPPENAENDERNLDEDED 263


>gi|254780809|ref|YP_003065222.1| tRNA modification GTPase TrmE [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 440

 Score = 24.3 bits (51), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 38/96 (39%), Gaps = 14/96 (14%)

Query: 168 GARPTASVMIRAINPSVYKSAE-------------AIRHLVAAAVPNLDMGDVTVLDSTG 214
           GA P+A  +IR   PS ++  E             ++R+        LD G + V  S  
Sbjct: 14  GALPSAISIIRLSGPSCFQVCEFICKKKKPFPRKASLRYFFGLDGRILDKGLLIVFPSPE 73

Query: 215 KLLTANEMERNILGKSLSIVQAIQHEIEMNINKALA 250
                +  E ++ G  +++V  I  E+    N  LA
Sbjct: 74  SFTGEDSAEFHVHG-GIAVVNGILEELAKMPNLRLA 108


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.317    0.131    0.353 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 318,097
Number of Sequences: 1233
Number of extensions: 12376
Number of successful extensions: 53
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 46
Number of HSP's gapped (non-prelim): 11
length of query: 563
length of database: 328,796
effective HSP length: 79
effective length of query: 484
effective length of database: 231,389
effective search space: 111992276
effective search space used: 111992276
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 41 (20.4 bits)