HHsearch alignment for GI: 254780696 and conserved domain: COG0151

>COG0151 PurD Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism].
Probab=98.41  E-value=0.00013  Score=50.58  Aligned_cols=220  Identities=17%  Similarity=0.223  Sum_probs=133.0

Q ss_pred             HCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEECCHHH-HHHCCCHHHHHHHHH--HCCCCE---EECCHHHHHHHHHH
Q ss_conf             063668832886224799999999862358504117488-752565034334543--044310---00372455688885
Q gi|254780696|r   82 QMDVILIRQDPPFNMHYITSTYLLEKINPETLIVNNPFW-IRNSPEKIFVTEFSE--LMPPTL---ISRDITQITRFYLE  155 (316)
Q Consensus        82 ~fD~i~iR~dPp~d~~yi~~~~~Le~~~~~~~viN~p~~-i~~~~eKl~~~~~~~--~~P~T~---vt~~~~~~~~f~~~  155 (316)
T Consensus        63 ~idl~vVGPE~pL~-~GvvD--~l~~--~Gi~vFGPsk~AA~lE~SK~faK~fm~k~~IP-ta~y~~f~~~e~a~ayi~~  136 (428)
T COG0151          63 NVDLVVVGPEAPLV-AGVVD--ALRA--AGIPVFGPTKAAAQLEGSKAFAKDFMKKYGIP-TAEYEVFTDPEEAKAYIDE  136 (428)
T ss_pred             CCCEEEECCCHHHH-HHHHH--HHHH--CCCCEECCCHHHHHHHHHHHHHHHHHHHCCCC-CCCCEECCCHHHHHHHHHH
T ss_conf             99989989717876-44689--9987--79962386788988775399999999981999-6411100898999999997


Q ss_pred             HH-HHHHHCCCCCCCCCEEEECCCCCCHHHHHHHHHHH----CCCCCCEEECCCCCCCCCEEEEEE-CCEEEEEE-----
Q ss_conf             21-43311168854344687448871158899999840----013340021053445682699998-99886321-----
Q gi|254780696|r  156 MK-DIIIKPLYGNGGTGVFRITLGDRNFSSLIEMLFEK----YPEPLMIQSYLPQIRDGDKRILLL-NGKPVGAV-----  224 (316)
Q Consensus       156 ~~-~vViKPl~g~~G~gV~~i~~~~~~~~~~~e~~~~~----~~~~ii~Qefi~~~~~gD~Rv~vi-~g~~v~a~-----  224 (316)
T Consensus       137 ~g~piVVKadGLaaGKGV~V~~~~eeA~~a~~~~l~~~~fg~~g~~VVIEEfL~G---eE~S~~a~~DG~~v~p~p~aQD  213 (428)
T COG0151         137 KGAPIVVKADGLAAGKGVIVAMTLEEAEAAVDEMLEGNAFGSAGARVVIEEFLDG---EEFSLQAFVDGKTVIPMPTAQD  213 (428)
T ss_pred             CCCCEEEECCCCCCCCCEEECCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCC---EEEEEEEEECCCEEEECCCCCC
T ss_conf             2998899345446789859827799999999999740001478874899853346---1799999976986787853145


Q ss_pred             -EEECCCCCCCCCCCCCCCEEEEE-CCHHH-----HHHHHHHHHHHHHCCCEEEEEEEE-------CCEEEEEECC--CC
Q ss_conf             -22045686000000147311100-77899-----999999999999849879999511-------7878898368--83
Q gi|254780696|r  225 -NRIPSEVDNRSNIHAGGKAELTK-LTKID-----LDICKRIGESLRERGLFFTGIDVI-------GDYITEINVT--SP  288 (316)
Q Consensus       225 -~R~~~~~~~r~Nl~~Gg~~~~~~-lt~~~-----~~i~~~~~~~L~~~gl~~~GiDii-------g~~i~EvNvt--sP  288 (316)
T Consensus       214 hKra-~dgD~GPNTGGMGaysp~P~~t~e~~~~~~~~Iv~ptv~gm~~EG~~f~GvLy~glMlt~~GPkViEfN~RFGDP  292 (428)
T COG0151         214 HKRA-YDGDTGPNTGGMGAYSPAPFITDEVVERAVEEIVEPTVEGMAKEGYPFRGVLYAGLMLTADGPKVIEFNARFGDP  292 (428)
T ss_pred             CCCC-CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEECCCCCEEEEEECCCCCH
T ss_conf             6433-489989988887777798879989999999999999999999718981478876789828996799985666883


Q ss_pred             HHHHHHHHHCCCCHHHHHHHHHHH
Q ss_conf             037889975199989999999988
Q gi|254780696|r  289 TCIREIHRNGGENVASLFWDGIEK  312 (316)
Q Consensus       289 ~g~~~~~~~~~~~i~~~i~d~ie~  312 (316)
T Consensus       293 Et-q~vL~~l~sdl~~~~~a~~~g  315 (428)
T COG0151         293 ET-QVVLPLLESDLVELLLAAVDG  315 (428)
T ss_pred             HH-HHHHHHCCCCHHHHHHHHHHC
T ss_conf             57-777876026099999999718