HHsearch alignment for GI: 254780696 and conserved domain: COG0458

>COG0458 CarB Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism].
Probab=98.79  E-value=3.3e-07  Score=67.67  Aligned_cols=263  Identities=17%  Similarity=0.238  Sum_probs=145.9

Q ss_pred             CHHHHHHHHHHCCCEEEEEEHHHEEEECCEEEEEEEEEEEECCCCCEE-EECCCCCCCHHHCCEEEEECCCCCCHHHHHH
Q ss_conf             679999999988988999954124899989999999999807774126-5046443521006366883288622479999
Q gi|254780696|r   23 STFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYY-SLGEEKIIDLSQMDVILIRQDPPFNMHYITS  101 (316)
Q Consensus        23 TT~~Lm~eAq~RGheV~~~~~~dL~~~~g~v~A~~~~i~i~~~~~~~f-~~~~~~~~~L~~fD~i~iR~dPp~d~~yi~~  101 (316)
T Consensus        17 sG~qac~aLkeeg~~vvlvnsnpAti~td~e~AD~~y~e--P~~~E~v~~Ii~~-----E~~Dailp~~gg---qt~Ln~   86 (400)
T COG0458          17 SGTQACKALKEEGYGVVLVNSNPATIMTDPELADKVYIE--PITKEPVEKIIEK-----ERPDAILPTLGG---QTALNA   86 (400)
T ss_pred             HHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCEEEEE--CCCHHHHHHHHHH-----CCCCEEECCCCC---CCHHHH
T ss_conf             678999999866975999728872124780005302662--4737889999975-----376626324687---413468


Q ss_pred             HHHHHH---HC-CCCE-EECCHHHHHHCCCHHHHHHH-HH---HCCCCEEECCHHHHHHHHHHHH-HHHHHCCCCCCCCC
Q ss_conf             999986---23-5850-41174887525650343345-43---0443100037245568888521-43311168854344
Q gi|254780696|r  102 TYLLEK---IN-PETL-IVNNPFWIRNSPEKIFVTEF-SE---LMPPTLISRDITQITRFYLEMK-DIIIKPLYGNGGTG  171 (316)
Q Consensus       102 ~~~Le~---~~-~~~~-viN~p~~i~~~~eKl~~~~~-~~---~~P~T~vt~~~~~~~~f~~~~~-~vViKPl~g~~G~g  171 (316)
T Consensus        87 ~~~l~e~g~l~~~gV~vvgs~~eaI~iaeDr~~fke~m~eigi~~P-~~~~~~~~e~~~~~~~ig~PvIVrP~~~lGG~G  165 (400)
T COG0458          87 ALELKEKGVLEKYGVEVVGSDPEAIEIAEDKKLFKEAMREIGIPVP-SRIAHSVEEADEIADEIGYPVIVKPSFGLGGSG  165 (400)
T ss_pred             HHHHHHHCCHHHCCCEEEECCHHHHHHHHHHHHHHHHHHHCCCCCC-CCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCC
T ss_conf             8998772645644977994587895564209999999998399988-412356777765576369977980685788875


Q ss_pred             EEEECCCCCCHHHHHHHHHHH-CCCCCCEEECCCCCCCCCEEEEEE-CCE----EEEEEEEECCCCCCCCCCCCCCCE--
Q ss_conf             687448871158899999840-013340021053445682699998-998----863212204568600000014731--
Q gi|254780696|r  172 VFRITLGDRNFSSLIEMLFEK-YPEPLMIQSYLPQIRDGDKRILLL-NGK----PVGAVNRIPSEVDNRSNIHAGGKA--  243 (316)
Q Consensus       172 V~~i~~~~~~~~~~~e~~~~~-~~~~ii~Qefi~~~~~gD~Rv~vi-~g~----~v~a~~R~~~~~~~r~Nl~~Gg~~--  243 (316)
T Consensus       166 ~~i~~-n~eel~~~~~~~l~~s~~~~vl~eesi~G~k--e~e~ev~rd~~~n~ivvc~men~dp~g-----vhtgdsi~v  237 (400)
T COG0458         166 GGIAY-NEEELEEIIEEGLRASPVEEVLIEESIIGWK--EFEYEVVRDGKDNCIVVCNMENLDPMG-----VHTGDSITV  237 (400)
T ss_pred             EEEEE-CHHHHHHHHHHCCCCCCCCCCEEEEEECCCE--EEEEEEEEECCCCEEEEEECCCCCCCC-----CCCCCEEEE
T ss_conf             16871-8999999987322447642001244216856--999999983799879998678656566-----444323652


Q ss_pred             -EEEECCHHHHHHHH-HHHHHHHHCCCEEEEEE--E-EC----C-EEEEEECCCCHHHHH-HHHHCCCCHHHHH
Q ss_conf             -11007789999999-99999998498799995--1-17----8-788983688303788-9975199989999
Q gi|254780696|r  244 -ELTKLTKIDLDICK-RIGESLRERGLFFTGID--V-IG----D-YITEINVTSPTCIRE-IHRNGGENVASLF  306 (316)
Q Consensus       244 -~~~~lt~~~~~i~~-~~~~~L~~~gl~~~GiD--i-ig----~-~i~EvNvtsP~g~~~-~~~~~~~~i~~~i  306 (316)
T Consensus       238 apaqtl~d~eyq~~r~~~~~iir~igi~-G~~niQ~av~~~~~~~~viEvNp-RvSrssaLaskAtgypia~va  309 (400)
T COG0458         238 APAQTLTDKEYQMLRDAAIKVIREIGIE-GGCNIQFAVDPGGGELYVIEINP-RVSRSSALASKATGYPIAKVA  309 (400)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHCCC-CCCCEEEEECCCCCEEEEEEECC-CCCCCCHHHHHCCCCHHHHHH
T ss_conf             1455654378899888777788874114-78731489869985599999568-767640315544687699999