HHsearch alignment for GI: 254780696 and conserved domain: KOG3895

>KOG3895 consensus.
Probab=98.60  E-value=5e-08  Score=72.98  Aligned_cols=188  Identities=20%  Similarity=0.239  Sum_probs=123.6

Q ss_pred             CCEEEEECCC---CCCHHHHHHHHHHHHHCCCCEEECCHHHHHHCCCHHHHH-HHH--------H---HCCCCEEECCHH
Q ss_conf             6366883288---622479999999986235850411748875256503433-454--------3---044310003724
Q gi|254780696|r   83 MDVILIRQDP---PFNMHYITSTYLLEKINPETLIVNNPFWIRNSPEKIFVT-EFS--------E---LMPPTLISRDIT  147 (316)
Q Consensus        83 fD~i~iR~dP---p~d~~yi~~~~~Le~~~~~~~viN~p~~i~~~~eKl~~~-~~~--------~---~~P~T~vt~~~~  147 (316)
T Consensus       156 PdfVlirqhA~~mA~~~d~rslvig~qya--giP~vNSl~SvynFcdkpwvf~Qlvki~~slG~e~fPli~qt~yPnH--  231 (488)
T KOG3895         156 PDFVLIRQHAFSMALNEDYRSLVIGLQYA--GIPSVNSLTSVYNFCDKPWVFAQLVKITKSLGPEKFPLIEQTFYPNH--  231 (488)
T ss_pred             CCEEEECCCCHHHCCCCCHHHHHHHHHHC--CCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCCCCEEECCCC--
T ss_conf             77788705301010131068999988763--78642026789886145689999999987518544554400106874--


Q ss_pred             HHHHHHHH-HHHHHHHCCCCCCCCCEEEECCCCCCHHHHHH--HHHHHCCCCCCEEECCCCCCCCCEEEEEECCEEEEEE
Q ss_conf             55688885-21433111688543446874488711588999--9984001334002105344568269999899886321
Q gi|254780696|r  148 QITRFYLE-MKDIIIKPLYGNGGTGVFRITLGDRNFSSLIE--MLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAV  224 (316)
Q Consensus       148 ~~~~f~~~-~~~vViKPl~g~~G~gV~~i~~~~~~~~~~~e--~~~~~~~~~ii~Qefi~~~~~gD~Rv~vi~g~~v~a~  224 (316)
T Consensus       232 --K~m~s~~tyPvVVkvghahsGmGKiKV~Nh-~dfqDi~svval~~---Tyat~epFiD-aKY-DiriQKIG~nYKaym  303 (488)
T KOG3895         232 --KEMLSQPTYPVVVKVGHAHSGMGKIKVENH-EDFQDIASVVALTK---TYATAEPFID-AKY-DIRIQKIGHNYKAYM  303 (488)
T ss_pred             --HHHCCCCCCCEEEEECCCCCCCCEEEECCH-HHHHHHHHHHHHHH---HHHCCCCCCC-CCC-EEEHHHHHHHHHHHH
T ss_conf             --422148877679982543356532552341-55676999999886---2320023434-322-001565404688886


Q ss_pred             EEECCCCCCCCCCCCCCCE--EEEECCHHHHHHHHHHHHHHHHCCCEEEEEEEE----C-CEEEEEECCCC
Q ss_conf             2204568600000014731--110077899999999999999849879999511----7-87889836883
Q gi|254780696|r  225 NRIPSEVDNRSNIHAGGKA--ELTKLTKIDLDICKRIGESLRERGLFFTGIDVI----G-DYITEINVTSP  288 (316)
Q Consensus       225 ~R~~~~~~~r~Nl~~Gg~~--~~~~lt~~~~~i~~~~~~~L~~~gl~~~GiDii----g-~~i~EvNvtsP  288 (316)
T Consensus       304 Rt-sIsgnWKtNt---GSamLEQIamseRyklwvdtcse~f--GgldICav~alhsKdGrd~i~eV~d~sm  368 (488)
T KOG3895         304 RT-SISGNWKTNT---GSAMLEQIAMSERYKLWVDTCSEMF--GGLDICAVKALHSKDGRDYIIEVMDSSM  368 (488)
T ss_pred             HH-HHCCCCCCCC---HHHHHHHHHHHHHHHHHHHHHHHHC--CCCCEEEEEEEECCCCHHHEEEECCCCC
T ss_conf             65-3126754572---0899999987788999999899762--8832466542105655023243123543