HHsearch alignment for GI: 254780696 and conserved domain: PRK01372

>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed.
Probab=99.73  E-value=6.4e-15  Score=118.17  Aligned_cols=270  Identities=18%  Similarity=0.237  Sum_probs=178.3

Q ss_pred             CCCCEEEEEECCHHH-CCCCCCCHHHHHHHHHHCCCEEEEEEHHHEEEECCEEEEEEEEEEEECCCCCEEEECCCCCCCH
Q ss_conf             653318997099888-4847646799999999889889999541248999899999999998077741265046443521
Q gi|254780696|r    2 KKIRNIAIQMNHIST-VKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYYSLGEEKIIDL   80 (316)
Q Consensus         2 kk~~kI~fimDpi~~-i~~~~DTT~~Lm~eAq~RGheV~~~~~~dL~~~~g~v~A~~~~i~i~~~~~~~f~~~~~~~~~L   80 (316)
T Consensus         2 ~~~~kI~vl~GG~S~E~eVSl~S~~~v~~aL~~~~y~v~~id~~~~---------------------~~~~------l~~   54 (304)
T PRK01372          2 KMFGKVAVLMGGTSAEREVSLNSGAAVLAALREAGYDAHPIDPGED---------------------PAAE------LKE   54 (304)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCC---------------------HHHH------HHH
T ss_conf             8777189993678712899999999999988375997999828964---------------------6778------753


Q ss_pred             HHCCEEEEECCCCCCHHH-HHHHHHHHHHCCCC-EEECCHHHHHHCCCHHHHHHHHH----HCCCCEEECCHHHHHHHHH
Q ss_conf             006366883288622479-99999998623585-04117488752565034334543----0443100037245568888
Q gi|254780696|r   81 SQMDVILIRQDPPFNMHY-ITSTYLLEKINPET-LIVNNPFWIRNSPEKIFVTEFSE----LMPPTLISRDITQITRFYL  154 (316)
Q Consensus        81 ~~fD~i~iR~dPp~d~~y-i~~~~~Le~~~~~~-~viN~p~~i~~~~eKl~~~~~~~----~~P~T~vt~~~~~~~~f~~  154 (316)
T Consensus        55 ~~~D~vf~~lHG~~GEDG~iQg--lLe~~--~IPYtGs~~~asal~mDK~~tK~i~~~~gI~tp~~~~~~~~~~~~~~~~  130 (304)
T PRK01372         55 LGFDRVFNALHGRGGEDGTIQG--LLELL--GIPYTGSGVLASALAMDKLRTKLVWQAAGLPTAPWVVLTRAEDLLAAID  130 (304)
T ss_pred             CCCCEEEEECCCCCCCCHHHHH--HHHHC--CCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHH
T ss_conf             3999999906899985649999--99985--9983579989987765389999999986999898499865313999987


Q ss_pred             HHH-HHHHHCCCCCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEECCCCCCCCCEEEEEECCEEEEEEEEECCCC--
Q ss_conf             521-43311168854344687448871158899999840013340021053445682699998998863212204568--
Q gi|254780696|r  155 EMK-DIIIKPLYGNGGTGVFRITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVGAVNRIPSEV--  231 (316)
Q Consensus       155 ~~~-~vViKPl~g~~G~gV~~i~~~~~~~~~~~e~~~~~~~~~ii~Qefi~~~~~gD~Rv~vi~g~~v~a~~R~~~~~--  231 (316)
T Consensus       131 ~l~~P~iVKP~~~GSSiGv~~V~~-~~el~~ai~~a~~-~~~~vLvE~~I~---GrEitv~Vlg~~~lp~~eI~~~~~fy  205 (304)
T PRK01372        131 KLGLPLVVKPAREGSSVGVTKVKE-ADELPAALELAFK-YDDEVLVEKYIK---GRELTVAVLGGKALPVIRIVPPGEFY  205 (304)
T ss_pred             HHCCCEEEEECCCCCCCCEEEECC-HHHHHHHHHHHHH-CCCCCEEEEEEC---CEEEEEEEECCCCCCEEEEECCCCCC
T ss_conf             618987997668886665389669-8899999999874-488625450256---56999999899777538994599875


Q ss_pred             CCCCCCCCCCCE--EEEECCHHH----HHHHHHHHHHHHHCCC-EEEEEEEE----C-CEEEEEECCCCH-----HHHHH
Q ss_conf             600000014731--110077899----9999999999998498-79999511----7-878898368830-----37889
Q gi|254780696|r  232 DNRSNIHAGGKA--ELTKLTKID----LDICKRIGESLRERGL-FFTGIDVI----G-DYITEINVTSPT-----CIREI  294 (316)
Q Consensus       232 ~~r~Nl~~Gg~~--~~~~lt~~~----~~i~~~~~~~L~~~gl-~~~GiDii----g-~~i~EvNvtsP~-----g~~~~  294 (316)
T Consensus       206 Dy~aKY~~~~s~~~~Pa~l~~~~~~~i~~~a~~~~~aL---g~~g~aRvDf~~~~~g~~~~lEiN-t~PGmT~~Sl~P~~  281 (304)
T PRK01372        206 DYEAKYLAGDTQYLCPAGLPAELEAELQALALRAYKAL---GCRGWGRVDFMLDEDGKPYLLEVN-TSPGMTSHSLVPMA  281 (304)
T ss_pred             CHHHCCCCCCCCEECCCCCCHHHHHHHHHHHHHHHHHH---CCCCEEEEEEEEECCCCEEEEEEC-CCCCCCCCCHHHHH
T ss_conf             77661255774110068999999999999999999984---997369889999079978999833-99998741589999


Q ss_pred             HHHCCCCHHHHHHHHHH
Q ss_conf             97519998999999998
Q gi|254780696|r  295 HRNGGENVASLFWDGIE  311 (316)
Q Consensus       295 ~~~~~~~i~~~i~d~ie  311 (316)
T Consensus       282 a~~~G~s~~~li~~ii~  298 (304)
T PRK01372        282 ARAAGISFSELVVWILE  298 (304)
T ss_pred             HHHCCCCHHHHHHHHHH
T ss_conf             99819999999999999