HHsearch alignment for GI: 254780696 and conserved domain: PRK05246

>PRK05246 glutathione synthetase; Provisional.
Probab=100.00  E-value=0  Score=743.37  Aligned_cols=312  Identities=50%  Similarity=0.880  Sum_probs=306.5

Q ss_pred             CCEEEEEECCHHHCCCCCCCHHHHHHHHHHCCCEEEEEEHHHEEEECCEEEEEEEEEEEECCCCCEEEECCCCCCCHHHC
Q ss_conf             33189970998884847646799999999889889999541248999899999999998077741265046443521006
Q gi|254780696|r    4 IRNIAIQMNHISTVKVKEDSTFAIALEAQVRGYQIFHYTPDQLYMRDSKIYANTQPLSLDEKKEQYYSLGEEKIIDLSQM   83 (316)
Q Consensus         4 ~~kI~fimDpi~~i~~~~DTT~~Lm~eAq~RGheV~~~~~~dL~~~~g~v~A~~~~i~i~~~~~~~f~~~~~~~~~L~~f   83 (316)
T Consensus         1 mmki~f~mDpie~l~~~kDTT~~Lm~eAq~rGhev~~~~p~dL~~~~~~v~a~~~~v~~~~~~~~~~~~~~~~~~~L~~f   80 (316)
T PRK05246          1 MMKVAFIMDPIESINIKKDSTFAMMLEAQRRGHELFYYEPDDLSLRGGEVRARARPLTVRDDKGDWYELGEEQRLPLADF   80 (316)
T ss_pred             CCEEEEEECCHHHCCCCCCHHHHHHHHHHHCCCEEEEEECCCEEEECCEEEEEEEEEEECCCCCCCEEECCCEECCHHHC
T ss_conf             94799996897877998872999999999879989999727569989999999999998158887479415155130019


Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHCC-CCEEECCHHHHHHCCCHHHHHHHHHHCCCCEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             366883288622479999999986235-8504117488752565034334543044310003724556888852143311
Q gi|254780696|r   84 DVILIRQDPPFNMHYITSTYLLEKINP-ETLIVNNPFWIRNSPEKIFVTEFSELMPPTLISRDITQITRFYLEMKDIIIK  162 (316)
Q Consensus        84 D~i~iR~dPp~d~~yi~~~~~Le~~~~-~~~viN~p~~i~~~~eKl~~~~~~~~~P~T~vt~~~~~~~~f~~~~~~vViK  162 (316)
T Consensus        81 D~V~mRkDPPfD~~Yi~~T~lLe~~~~~gv~ViN~P~~IR~~nEKL~~l~F~~~iP~TlVt~~~~~i~~F~~~~~~iVlK  160 (316)
T PRK05246         81 DVILMRKDPPFDMEYIYATYLLERAERAGTLVVNKPQSLRDANEKLFTLWFPELMPPTLVTRDKAEIRAFRAEHGDIILK  160 (316)
T ss_pred             CEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEECCHHHHHHHHHHHHHHHHHHHCCCEEEECCHHHHHHHHHHHCCEEEE
T ss_conf             89999269999768889999998515387089769899864264788874064489935737899999999973878999


Q ss_pred             CCCCCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCEEECCCCCCCCCEEEEEECCEEEE-EEEEECCCCCCCCCCCCCC
Q ss_conf             168854344687448871158899999840013340021053445682699998998863-2122045686000000147
Q gi|254780696|r  163 PLYGNGGTGVFRITLGDRNFSSLIEMLFEKYPEPLMIQSYLPQIRDGDKRILLLNGKPVG-AVNRIPSEVDNRSNIHAGG  241 (316)
Q Consensus       163 Pl~g~~G~gV~~i~~~~~~~~~~~e~~~~~~~~~ii~Qefi~~~~~gD~Rv~vi~g~~v~-a~~R~~~~~~~r~Nl~~Gg  241 (316)
T Consensus       161 PL~g~gG~gV~~i~~~d~n~~~i~e~~t~~~~~~v~vQ~yl~ei~~GDkRiilv~G~~ig~a~~R~p~~gdfR~Nl~~Gg  240 (316)
T PRK05246        161 PLDGMGGAGIFRVKADDPNLGVILETLTEQGRRPVMAQRYLPEIKEGDKRILLVDGEPVGYALARIPAGGETRGNLAAGG  240 (316)
T ss_pred             ECCCCCCCEEEEECCCCCCHHHHHHHHHHCCCEEEEEEEEHHHCCCCCEEEEEECCEEEHHEEEECCCCCCCEEEEECCC
T ss_conf             75688984089977786238999999974587368988651243689879999999991146883267886113230598


Q ss_pred             CEEEEECCHHHHHHHHHHHHHHHHCCCEEEEEEEECCEEEEEECCCCHHHHHHHHHCCCCHHHHHHHHHHHHHC
Q ss_conf             31110077899999999999999849879999511787889836883037889975199989999999988633
Q gi|254780696|r  242 KAELTKLTKIDLDICKRIGESLRERGLFFTGIDVIGDYITEINVTSPTCIREIHRNGGENVASLFWDGIEKIKE  315 (316)
Q Consensus       242 ~~~~~~lt~~~~~i~~~~~~~L~~~gl~~~GiDiig~~i~EvNvtsP~g~~~~~~~~~~~i~~~i~d~ie~~~~  315 (316)
T Consensus       241 ~~~~~~lt~~~~~i~~~i~p~L~~~gl~f~GiDvig~~ltEINVTSPtgl~ei~~~~~~~~~~~~~d~lE~~~~  314 (316)
T PRK05246        241 RGEATPLTERDREICAAIGPELKERGLIFVGIDVIGDYLTEINVTSPTGIREIERLTGVDIAGMLWDAIEAKLA  314 (316)
T ss_pred             EEEEECCCHHHHHHHHHHHHHHHHCCCEEEEEEEECCEEEEEECCCCHHHHHHHHHHCCCHHHHHHHHHHHHHC
T ss_conf             02671699899999999999999879889999753782689936895459999987599989999999998761